%PDF-1.4 %ту╧╙ 1 0 obj << /OPM 1 /SM 0.001 /Type/ExtGState >> endobj 2 0 obj << /OP true /Type/ExtGState >> endobj 3 0 obj << /OP false /Type/ExtGState >> endobj 4 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[255] /FunctionType 0 /Range[0 1 0 1 0 1 0 1] /Length 699 >> stream XЕ ─░ ╤{^l█╢m█6l█╢m'k█╢mЫ╡{╗ъ4╩S│─6┴▒└╧_B"Й=H$ї!@6╔bфРЬFо#╖фI0ЄJ╛#гА╠ЖQH g╟(Тги╦ЙQ\Jф┬,Щ│ФФ╬ГYF╩ц┼,Ч│╝T╚ПYQ*└м\│КT-ДYMк╞мQлж╘*КU[ъ├к[лЮ╘/Б╒@Ц─jT л▒4)Н╒TЪХ┴j^лЕ┤,З▌JZЧ╟nS╗н┤лИ▌^:T┬юX╗УtоВ▌E║V┼юV ╗╗ЇиО▌Sz╒└щ]зПЇнЕ╙п6NPgа кЛ3╕╬ZgШ oА3в!╬H╒w┤МiМ;╢ ю8▀wВLlЖ;й9юdЩ╥wкd╡─Э╓ w║╠hН;Sf╡┴Ы▌oО╠mЗ7Oц╖╟[╨oб,ъИ╖XЦt┬[┌oЩ,яВ╖BVv┼[╒ ╡мщО┐V╓ї└_▀ГlьЕ┐I6ў╞▀╥лlыЛ┐]vЇ├▀┘Чь@░GЎ$╪7И`┐LpP !8<ФрИFpLО'81ВрдЬIpZ╬М"<;ЪЁЬЬCxa,сE╣4ОЁ▓\Oxuс5╣>СЁЖ▄ЬDxk2сmr√в;ф╬йDwe▌ЭEt╧4в{х╛щDў╧ z@ЬIЇР<<ЛшС┘DП╩csИЧ'ц?9П°)yz>ё3Єьтч?//,"~Q^ZL№ЄтWф╒е─п╔ы╦И▀XNЄж╝╡Вфmyg%╔╗лH▐УўWУ| о!∙h-╔╟Є╔:ТOх│ї$Яo ∙B╛▄H·Х|╜ЙЇЫ═д▀╩w[H┐Ч╢Т■╕НЇ'∙y;щ/Єы╥▀vТ■.ь"¤S■┌Mця=d■СўТ∙oЩ /9╤X endstream endobj 5 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[2] /FunctionType 0 /Range[0 1 0 0.6 0 0 0 0.06] /Length 20 >> stream XЕ ┴@  OгШ ■¤ endstream endobj 6 0 obj << /SA true /Type/ExtGState >> endobj 7 0 obj << /FL 0.2 /Type/ExtGState >> endobj 8 0 obj << /Width 708 /ColorSpace/DeviceGray /Height 1262 /Subtype/Image /Type/XObject /Length 893496 /BitsPerComponent 8 >> stream                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               у┌┌┌▄▌▌▌▀▌▀╫аааабввгвджСrqqrsutrqpnYKJJKLNNMMLWtuwzwtuvvsxееедис▐▐                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ътттффцццчцслллллллйкккШy}ББ}}||}}fUUVVVUVUY[YWXXYYZ\^^]]\[]^\ZYZ[\[[\^^YXXYZ]^`_^^`a`_Y[XVXXWZYZ\[XZVWVY[Y]Z]]^a\`^]]^]\[[^^][XT_xИй▐                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ыур▀тфуфхцц▀иииззикммннЩ|}|БББВВДm]]]^_bdcbbbaddedddfffffffefefhhijjihgghfbhcdddjjifhfdfbhfhfcebdaacbdcgcdbba^a`a```^]^___a``^\\]]]][^_]]_`^]^_^_\ZWWZ[[[Z[[[ZYYYZ[[\]Z\[[\\]\]]^][[^]_]\^\]Y\[WYWШ                                                                                                                                                                                                                                                                                                                                                                                                                                                                    шсстттфххуф▐зийймкллно░Ъzz{АБВААiZ\^^^^_^][YZ\^\[^baa`badedecccbcccdfgfffgebecigffcgdffjkfihkjjlimmlkilmnkiiijmqoonmlllllllkmlppnnnnhkjjjlppmjjhehfiijhfihhdceedcebcdac^a__^]_Z]\]^^`]_ZZ[[][^]^^\^Z][[\\``]VWZ[]Z\Y[_]\X\[\Z[`a`_^]]^\[[\]\\X]]^[X]_]Z\[XVRUWaе                                                                                                                                                                                                                                                                                                                                                                                                      цсррртууфуф▌жежзиклкйммЧxyz{~~АiYZ^]\YY]]]][[]_^__^\^`a``befgfffdadfhhgheghfcfad`dfeeadbccaaacbbbcdbdccdcdbdcccdddcefeghfdddfgiifgiiiihfijjjjkiknoomonomorqqtutsurupqqqrpvvxuuvuzvvwxvvy{ywwy{yxwwx{}zvvvvuqrrsttsrponllmmklkmlkjkiihgfedbcddefdcb``abdddcceggfeaabcddeddeeedehhfffgfddggfffeeefb`cefeeffgiifbb_``_\Z[X\ZXYcм                                                                                                                                                                                                                                                                                                                                                                            ё┤БaBCEHMQRRUUWXYZ^_`aaaabcdcbabfhihfffgdahiiddeckbbbcdchefdcdefcfdbbcccdfdddfdffffeehgghgiffhkkkkijijhgijjfikkieijjjggfjlkihjgllljglijghjmnjlmnnmpknkmnqrrssrqqqtstttruxvwxz{zy|{}ВЕИЖДВБГДГАБ}БВГДДДДВГЖИЛНРРТРОННПРНРРФЦШЪЩЦФТРЛККНТУФФФУНЙЙИЗЙКНПНЛИЗЖГГ}zyutruvvxwusmkkgkhmkkomojkhghhpjlijnilgigggdfhhfhfdfchigghffgffgeiinmjkhohnjdcaffeca_YRQcп                                                                                                                                                                                                                                                                                                                                                                     √л_IMOVZ_bcegbeeadbebefdfdfdeeeedffeegfgeggggeffhgfedecddeedgdehhgehcfedfehfgfghgkikjjiilmnlmnlnmqpqsrurrqqrrsqsssuuuuvvvtsttvyy||}~~}}|{zzz||}А|}~АВГДЖЗЙКЛЛМООННПРУЧЪЬЮЭЭвикйикнп░│╡╢╣╗╗╜╝╕╡╢╖╕╣╝╜┐┴┬┬┴┴├├╞╟┼├┬├─├├┴┐┐└┐╛╝╝╝╗╝╝╗╣╣╕╕╢╢╖╖╢╖╢┤┤и▓вггЯйЬнабЯШаОЧМПНДИyz{z{||wrpkifdcccdeedecc_^_`a_^Z[^_`_]\ZYXVVUSTVXXYXUTTTRPSWYYY`ffdc`^`c``___cedc`_]WTRPNb╢                                                                                                                                                                                                                                                                                                                                                               ю}NR[cfhjigffdeb``aa``^]^^`cacacdeeaddfccihjhjigfdjjljijhiikmmnkllllnnpqrpooppqqpoppstuuttuwz{zz{||}БВГЕЖЗЗЗЗЗЗЗМНПТФЦЧШЪЬЫЪЩЪЯдл░╡╢╡┤┤╢╣║╕╢╖╕╣║╝┴┼┬└├╟╦╠╠╧╨╨╧═╬╧╧╬╠╦╩╩╦╟╟╚╔╩╩╩╔╩╦╠╩╚╟╞┼┼┼╞╟╞╞╞╞─┬─┬┼┴┬├├╟┬┴└┐╜╛╛┐┐┐╜╜╛┐╛╛╛╜╗╗╜╗║╜╛╝║╗╣╣╣╖▓йижийзебЭШТМЙКЙЖГДБ}zvstsrolie`]]^_^[WTQMLNRQOONMNLMNLIHKNNLKJKMPONOLJLIMNNPPOKIHILLNKKMPQQTW\]ZXURNKIIHIMPNLMQUXZRTSTURSВЄ                                                                                                                                                                                                                                                                                                                                                          ▓XUckppqtonkifdb`^]]^\Z^\\[\`afdegimmmlmonppqrtvuqprutqrssssuyyzy|}~ББГАВГДГГЖЗИЛЛЛМРРУЦЩЭЮЮЭвдежилнп░▒│╣┬╟╟╞╞╟╟╟╔╠╧╤╨╙╓╫╒╥╥╘╙╨╬╧╧╤╥╘╓╪╓╙╙╘╙╤╧╬╧╬╬╘╨╤╪╨╓╒╘╪╘█╒╒╓╘╘╒╓╪╪╓╫╓╫╒╙╘╒╒╓╫╓╒╫╪┘╪╓╫╒╘╙╤╨╬╧╧╬╠╔─└┬─┬╛╝╜╝╗╗┤йжиидбЯЭЮЮЯЫЧФРОЛЙИЗКНМЛКЖВ}wsqpqpolkihebaa```_^^\XUTSSRQPONMJNPQRPQMMLLKHLHNPPMLHEECDHIIIIGGJJLLLJIJHIKKLMMJKHIIKJJHFILMOPTUUROIC?:9:;?A@@@?=;=AABCCABDDDCEDDCBB@>;<<=??BEC@ACEEEECBCCB?BBCB@?=>====<;;;;;;<;=;:630-//001334654456:?DFHLOTXYWTR┼                                                                                                                                                                                                                                                                                                                                              tT^ims~ЛЦЮк┐╫с╘─вЪГnjjkputx~xБ~ЗЙМРМЪе░╡│░лжбЭЩЧФУТФХТОЛМЛКЙЙИИЗЖЗЕДГБДЗГАБГГБВВВБ|vvvwy{yyz|ywwvtuvurqqqstw{~БГГБААВЖЕЕЖЗЖwtsspoppkddfiihfedcbceddbbcdeeeffeba`^__aeeefddcb_`^_`aa___`a`_\]`]ZYZXYVVWTTQPNMONNKLJKLLKJIIHHHHGHHGDDGHFCDGGFEB==@AACC@=<<=?=;<<;;::9::9775534678779::979;;:8798764421488889>=<:75435875457755777433443200/01/./10021.*++--./02121231347;=AFILQUWTSK]                                                                                                                                                                                                                                                                                                                                           ЪR`glnnxЛС╡╟щїЇё█╟▒ЧВuttqvsrsstvwz~}}|БДЖЗЖБ}ytsrrpqqrqmklkkihhgeeghjiikkhegjkihigea_^]\Y\^_^^_a_]]^aeca`^\Z\_acehjjjjjjklprsurolieebabba\[[^\\\[[[ZYXXYXYYYZZ^]\ZVSTVUWXVXX[YWVVUTTTQRTSSUTTTVVSRRPOQPPSOQONKIHFFDCB@BAA@>>>==<<=><:::9986557877655645443332///010.../01.-../.-,+,+.00..0124442232./.-.,-,-..,,310.//././///.010000//,,..-+-,.--,+,,,+*+++*,-/1223334566777778;=BFKNPSUOF▒                                                                                                                                                                                                                                                                                                                                       ¤]WaeimrzИЪ╠Ё°ўєы█╤зУГxsmigigda_\Z]bbddgllnoooica_][[_a`aabca]\[]]\]\`cb``cccfeedcgc`]\[XTUWWWW[`^_\Z\^b^][XWVXY\]_`aca`_`aacccddd`\]^_^]]ZVTTVWXXVUSQPPQPPOOOOQRSSQPMLMMNNLOPSSRMLKKLMNOMNNNMMOPPPONMLMLKIIIIIECA@==;;:877766557665524345752000..100-----,//.---,.00/-,-....--+-,+**+,--...0/1210/0//.--,-+,++,,.10...//0.-.//0110000/---.----//0.--/.--,,,,-0014697689:9:;;:85417>?ABAAA?@????@?ABDEFKJIFC@=<;=@@AA@>@BBBAA@=<::;;::9998877445222334300/1111/200/0100.////00-...-,-..----/0242.-/-/0////.-./.././2221111221212/002300/0/..11110110.00011212332101121110111000/0///.,..022566768:88:;;<;8543678<<>?=@<@@><ACDFKMIE>:868:9877667898858653253424653/312440-013552/1213324300220100000111/0/.//01/..04589730332221210./1202123454420023223/03542//0111221223201221236443221.0222211232//../////.//111344335688:;;<=>:554554;EKPSUUN[                                                                                                                                                                                                                                                                                                                                 [Yfjjjilt}Ы╨ущэу╟│Уyj[RGC@<=>CHIC?@<:9;<;;9@EGGINRNKGDCDCA@DEFGFJFJIIIDHDEFGIGLEHDBB>FCEDCC@B;>==;>>??@@?<=???>=<>>@?=@@ACDCABBCDC><>=<<;;=<9;<<=>=?>>>>=>ACLVW[jxkYG;87786444554653132222241/.1232/413421/0122222322233353321022333364222211022110246;AA:46<:7556331244433255332101123252001100//0132001124010//1322210110102000./.--..-.-++,+,,,..010.124668<;<>>>=985447=GLNQWYRS                                                                                                                                                                                                                                                                                                                              █[eqroljnszЙм┐╚╦└│ЭЕsg[PHB;899=FNQOKJKKFA?@?>?CDGHKNEGIHFFFEFIKLMOPNOPPPOQUZYWUVWVSTTTSSTSPONNNMLNNMJHLOPRSQMPTTRPPOLHILNOMMMOOMLJIJJHHJKLKKKMLJGMIDA?A>?>><;=;>=;:;:;=>==QRRRRQzДЗЗЖЗе╬│ИЖВW822557:=@D@><8668?HMQWY]TNш                                                                                                                                                                                                                                                                                                                           ╩\oБВГzomqxЙЧл╖╡йЭКwkaWNFB;<>BN[ixyyuoh^TMGDB@CCFKPX^cghjjkmnntx|Г|БЖИЕГЕЖИКИДБББА}ywsrponmmmmkkghhigdffeecb`_`^YWSUPMMMOMNMOPNMILJKJHKIKKKLMJGGGFC@>>>=?=979877775777875478;>DJTgЩК]B9542211200......--,,+,----+-000//.-.-1//.-.-//.,-...//...//00121010////...../137JVaR9.00/-,,,+*,-...,*+,,,++,+**+++,*+)(')++**+6SRQRRQdЖЖЕЕЖИд╠╠╠═╠╬ь                                  Д..035:=@@A@>9357=DJOSX]VNъ                                                                                                                                                                                                                                                                                                                         └XqРл╢дУ}qzИЧЯивХИ{lcYOGA?<@FQ`q}НГХЛВВor]YVRPKIOUaq}ДЙНСУФЦЪЬабджйижгабжйижЬгвднйдЩЯЩТШЩЬЪФЧШТЖЛАИГАw~prqmjgeb_\WTRPMJIGFGIEDEHIGEEECAA@ADDDB@A@>>=<::7999855140133323330/01456775210110///.,,,+)+,***++---/125210/0260.-.-,,,++**++++,,--,-,,-,+),,,*+,,*++,,09>B>4+)&)))'&9PQQQPNTЖЕЕДЕДМ╦╦╦╔╦╦┘                                                                      ь6--15;;?CBB@8057>DIPbnvИИЖЕГАxrpc``^VRUX\ht{ГЗОТХШЬЮЯЯЯЮЮавЭЩЪЪЫЪЩЦУХШЭЯвШОМКЙИЗИЖЖЕГБ~|xwvuqlhb_\WTQOLJGFEDDCC@??<<;<><=<>@A>=<=???>==>>;;:::99899887655421232120//023159@PcWG<97333420./0/.,,,,++,*+-,---.16520.-/10,,***(*))**++3RQQSSSSWИЗЕЗЗЗИЖ╦╦╦═╠╦╠╠¤                                                                                                             B+07<@AABBA?:776;EOTWZ_]Uь                                                                                                                                                                                                                                                                                                                     ╬UmЙм╦э▌╞ЦЛТЭжоЦЖwi_ZWKA@CGHMKYchifbccddegjffffbY[Z]biouy}~АБААА||{}{wtplkggfffhlnjfdc_`^^`_^]\[[YYYWTRQORNMJGJGHFCA?AAB@?@=:8:;<<;==??>;:;>@>=<:=?<<;9;:<;=;:96667532352111//122237;CFB=96422530-..5VTSSSUSSИИИИЙЙЙИ└═══╧╧╬═є                                                                                                                                                       ^19>B@@ABABA=989@NZZZ^c_P■                                                                                                                                                                                                                                                                                                                   ыUe{б╦сщ┘дЩЫЯжйЩДteYUPHBACEFHJLRTX\WZTRQSX]adlurbZWYXWX\]adcccccbb_]YYXVTTRTUQXSXW\a^a\]ZXXS\Y]^]]]\[YWVSSSPLKIVqosomkjmknkkidbvЪЩЪЩШЩШЫЩЩЩЦЩЪЫЪЫ╗┌┌┘╪╪╪╫╪┌┘┘╪╫╫╒╙╥°                                                                                                                                                                                                                    Г7B?>>@CCDDD>88?KW]]\]^]P¤                                                                                                                                                                                                                                                                                                                  XelИ╟шч▌▓двй░пЧГseYQJF@AA@ABDEJQR[bW]HCBBDHLWmrkbXPMIIWsПйллмнп░│▓╢ыъшчхффухшцъщъЇ                                                                                                                                                                                                                                                                                                       Ю7;::=ACDGFA=9;DTY_`^[^\N                                                                                                                                                                                                                                                                                                                 likrмЁїц┬кЬи┤▒ЮДsc]RID>@C?<=?BFILONIFA9U[\_b_MoАзз▀ф                                                                                                                                                                                                                                                                                                                                       й1369=AFHGF@=;:GU_ff`]]VW                                                                                                                                                                                                                                                                                                               ЦgfhБ╟ст╙│вл║│аМra`\NC@>?><:987:^Н├·                                                                                                                                                                                                                                                                                                                                                         д.158>I\iorlfcWy                                                                                                                                                                                                                                                                                                             єefdiМ╛╘╨╣ж░╣╕еР|da]QE=>><96=xы                                                                                                                                                                                                                                                                                                                                                                л-/27;ENPMHC@??NdpsnondQ▓                                                                                                                                                                                                                                                                                                            kkidhЖиобЮ░╜╕▒У|qhcRE?<;:9nє                                                                                                                                                                                                                                                                                                                                                                    к+-19j                                                                                                                                                                                                                                                                                                                                                                                    Ж5:DP_wФМxksЯч     ░Оm                                                                                                                                                                                                                                                                                                   ┐zЕп═┼оЬУЧк╣└╝мКnj`QEA                                                                                                                                                                                                                                                                                                                                                                                      C9CNYauВwjnТ╥     ьиАк                                                                                                                                                                                                                                                                                                  ~}Н═╠┴┤гХб▓╜─└г{rk^L>║                                                                                                                                                                                                                                                                                                                                                                                      ╨7AJT]ikmmpГ┬√     щЭz                                                                                                                                                                                                                                                                                                 ъА}П▌▌╪║овб╥фт─ЯwrfXIO                                                                                                                                                                                                                                                                                                                                                                                        V=GOW`bfjnz▒°√     ║Й╤                                                                                                                                                                                                                                                                                                }muШ▌▄┌╛▒з╖ўяц╔Юqm_ZJ─                                                                                                                                                                                                                                                                                                                                                                                        ∙:CJRX_cglsЯ┘∙     ╥вУ                                                                                                                                                                                                                                                                                                gnuб▌с╙┴║└╦№°ч╔ЬlhhbV                                                                                                                                                                                                                                                                                                                                                                                          p@HNUY_fjnО─є      ┼М                                                                                                                                                                                                                                                                                               д_epа╦╒╙╠┴└у№°ы┼Пhhoe▒                                                                                                                                                                                                                                                                                                                                                                                          ∙KRWZdsЕХ╝Ў      ∙▓╠                                                                                                                                                                                                                                                                                            ЖDOkКп└┌·°·чў∙ь┐ЙjXYB                                                                                                                                                                                                                            ╬А_БУво▓┤┤│╝├╟╘                                                                                                                                                   Ї;HNQXetВУ╖щ■      ═ж                                                                                                                                                                                                                                                                                            dKXwв┤┼▐ў°ю▐я°ф╣i]VL                                                                                                                                                                                                                      р╖йд{ajsИЭдбгй░нп╖╛└┴╧пЬУО╢╝╗╖╢╢┤▓чтс▐┌                                                                                                                                 [DHMVcqАР│╫№      эв                                                                                                                                                                                                                                                                                            PQjЧ┤╝╠▐эы█╬▌щ┌иsdZPИ                                                                                                                                                                                                               ¤╨нgagkosyАВВВЖМФЩЫЯвидймп▒▒дХОЙГ~vqklmjhba`[UPLHD?=PccВФР└╘ю                                                                                                                  у?EJUbl}Мк├ю       ├ь                                                                                                                                                                                                                                                                                           LT}╖╜╞╙▄┌╨╩╚╔╨╠Ыk`WK▌                                                                                                                                                                                                           ═Ь}yuqpsvyzzДА~ГИИЛНСЧЪЯвейекмклигЮаЮЪСЖ}zxywvtsrqjd^^\ZURRROGC><;::9L]БП╞╘                                                                                                          GEHSbkyСд║у■      ц╚                                                                                                                                                                                                                                                                                           P]|▒╩╪ц█╨─╖▒└╥╞Лb^UF                                                                                                                                                                                                       ўоxБДЙЗАzvxzz}ЗЗЛРУУЦТХЩЬЮабгбдддгбвббвЯЪЧМОНЛМММЛК}xsklb`]]_`_SOJKJEDAA>CFFGABACdЗ╣щ                                                                                                  йBEM[g|Уе╡╘■      №╖                                                                                                                                                                                                                                                                                           T^uв┼█ш╘┬╢п▒╣─║Б^YRI                                                                                                                                                                                                   №║КwxzВГЗЖДВ|v|БЕИЙЙСНСУСРРПУЧШЩЪЭЮЭаабЯааЭЩЦУПЛЗЖИИЙМЛЙ~slhc]WVW]m{qYOIFGEDE@>??A@>@CBDE@A>B^~д╪                                                                                             CDJWmШм╖╬√       ┴                                                                                                                                                                                                                                                                                          юT]rЫ╝┌т╥╕ойл║╦╡wXUOp                                                                                                                                                                                                ┌УuyАДВБДААБАБ}ВДЖЙКИИЙЖКЙКММПФФСТСРРСРНЙЗЕДГВА~}|zxxtnha[YXVROPQR\k}ЗqUJDA?=;9;;9;::9:9:<><:=@AAB=>LmШ╤                                                                                       }>FVtЪ┐╕╕╩Ё       ╠┘                                                                                                                                                                                                                                                                                         ╫U]pЩ╛┘▀╚│еви║╚иqVSKг                                                                                                                                                                                             ┘Оy{}~ДЕИЖБАБ|ВДЕЖЕЕЛЗЗЖВАДДЗЙКЛЛКМКЙИИЖЕВ~xtsqstusomhc]ZWUTRSSPLMNKKHKNUdwГКkPD@=>;;<;::;69:9768677789:;;<>AC=>\С╧                                                                                  √;DTu╣╖╡▓└у■      ╓▓                                                                                                                                                                                                                                                                                         ╙V\sЯ╜┘╒╛мабз╗─ЬjTQH╘                                                                                                                                                                                          ╗Бqw}}~ВВЖИЗГВЗЗЙКЙЙЗДДЕАВДГДЖЖЙЗЕДЕГБ~}yvsnkehjkigc`\XRNHEBADDEGGJKNPMMKJMP^ГоЦБ_NHEBBAA@@BB@==<9998777776889<=<<=<;><=fеў                                                                              ^CTnЯеик╗┘№      рж                                                                                                                                                                                                                                                                                         ╫Y_{й╧р╘╜мЯЯв║╜ОdVVF                                                                                                                                                                                        ┘ЕrwupВЕЕЙМЖЕЛЛКМННУНЗДГДДЗЖЕЖГА}z{zywslfeefeecc^ZXWWVRPMJFAB>??=A@DGLNMNPRRZdГ┐╗Ъq`YTQNJHFGFFHGEC@<;<:9:;:9:969:;===;=;;<><:`вў                                                                          уETmyЭ├═╔╧¤      █ею                                                                                                                                                                                                                                                                                        ╘\cВ▓р┌╥╜мЭЫЬ┤░ДaSQE                                                                                                                                                                                     ёЭzru{|ЖОКЖИЕБМФРСРЙЕw|~АГЗДВГБ~ytuvtrmfaa`bca_\VPKGFHHKNMLIGFEGGFFCBDEHMRZadhpvvК║░ЭБne^\QSLJKKNIJGJIFHDEB>>=;<;;;;>>>?>>><=??=>=<<=?GCA@@AB=?>@@A@A@>====>;;LТЁ                                                                    Y^Г╗   ё╥▐■     ┬УЩ                                                                                                                                                                                                                                                                                        █diИ╝№¤╒╢кЯЪШЯХsXON^                                                                                                                                                                                ыСДАvptxЖЧШМППИКМЛИИЕДxt}АВДВВ~zuwpqrpibcZ]a_\]VPNJIIGCFA@??B@??>AGLU`iqnhlga_]ZWSTTSRYh}ну╦СcTGD@A?=;78<=>?=<;:<=>>@EGFEFGHCABABCBDEC??@>;;8379::89::;;;<@FIHEDCCABDFGHHIFFDCAAA@AB@?<>=?Вў                                                              ╬iЭх     ╦╥№·¤№ьЬПm√                                                                                                                                                                                                                                                                                       щpvМ╥   Ё╦╡забУq[SOЧ                                                                                                                                                                           ў╣НСГux|ЗЧгХШУРРШЭСПЗ{{|ВИЗЖЕГВ{rvtswxobc_]adZXVTQJEC>@>=>:=>@@CMUVe]`aZTQNLJHD@?;:::98:<@DGT|╡ЇЄ╢\O?@?@A?<:878889<9:::;<>BLKHGEBA@CFHJKHHHJIIKEBBCB@??A=;8FЯ                                                             kач     ┼╧тўЇэ┴Ш~g░                                                                                                                                                                                                                                                                                       ·o|Т┌    у└о▓░Шua[T┤                                                                                                                                                                         ц▒ЯФКЕpАФаййЪЙЬЪШЭЯТЕЖwyЕНОТФЩИАГ~u|Аyxywhghfik_RKHGIHEHCEDEFCCGJPZ^X[UOIFB>:;;<<;<=:78654156:?Lp░Їё└bP>5747;<:=;::957689:9<A?===94T┘                                                          iЭц     ╩╚хх╒╖бРr`n                                                                                                                                                                                                                                                                                       ·p~гю    ь╠╝╚╛Эx_WQ╙                                                                                                                                                                       уаЯСБ~ДВШ▓дгкеЦЯеЯЪТИ}|ЗСЧТРФШЛ}{}~ВylmxxvtlfdZHG<=>??>@>A@GQTZ`XWUQLJHD<:957444477898::863235:Heзёё╟kR?:775565:=>@>;7:789:;>==?ACGKJMKJIHHFCEBACDGIJLMJHECB??@A?=9B╡                                                        ИЧ▐·    ╙▐т┌╩╝оЕkZM                                                                                                                                                                                                                                                                                       √nyо·    ъ╚└┼╔дze^Wё                                                                                                                                                                     тлЧСГv{ИШл╛иЮвееимвЫРЖБМХЦЩЫЭЬЦСН}|ЕИБДВojnsvАpe\YVPLHDCDCCABBIRYW]WQJA;<::9849<>@B?A<99:;;;<;;>BFMKMMJIJIGKHCAECFGILMHFFECAABCA@<9:М                                                      ╕М╦ў№  ў╒с╪╧╟─╣ЖgZNў                                                                                                                                                                                                                                                                                       uyо№    ▀┐╔╥╟зАcWR                                                                                                                                                                    ┌нйСАwnЪм▓╖▒Щго░лзЧИДБИЧеЪЧЪЭЪИ~ЖГИОНБwАА}zupo_QPQRRRQPKNOORSSUYXTOKGA<997:88789989898779789:;<=>?CHN]Ь█с╟uW@@?>?>><979:;?CBA@>=;89;::<<>CEHKLLNMHIJLJGGGHGGHHEHEBABCB@@@?<:7x                                                    я~▓хє ·ь╨╔└╛╗╝▒Жg[O▓                                                                                                                                                                                                                                                                                       xВ│¤    ┘╝╜┴╞мДl`Z                                                                                                                                                                  ▄ЪЯФ~uyrНм▒нонви░▒огМyВГКШжбЬШЭПzsЖЗИРЕrk{ЕЖЗwe`]FHCCECCBDDJPQYbUTOFBCB@@=:99:84421327;=>?<>>==<<=9;?EMYlФ╒╥└vaUQPLJHFFEB=;:CDDCA=9889:<<:=?@@@@CDFDEB=9A╕                                                 `vУзл╢▓гижлмпжЗgZRI                                                                                                                                                                                                                                                                                       АПпЎ    ┌░кгеоТn^[                                                                                                                                                              ╩епЮКyioЕШж┤дЧЭип▒┤дХЗyvЙЯФСЧааОГЗХШЗuuswАГ|БkUPSWZ]UYY[aefhie]WRHF@<877656665537:;;;:<::>CHLPV[__aeg\bgjmsСЙqo^YUQNLIJJGDEFHHJLLLNQIID?=>?><<;<<=@BGNQTVRPONLJIIGE@<;;@B?BDHIHHFIFBAEHJKSW`v}sugSLJHDGCBA>;74678856578;<<:=ACEFGIKIGC?9i                                              ╛g{г┐╨╚▒░ил░▓йМkXVJр                                                                                                                                                                                                                                                                                      ~Укя    ы┤ЮТЮл╖Мh`╔                                                                                                                                                         яаЧаУ{oslЕдвЧЧЭЫЯдедЭЙw~ЕЛУЧЦУММidv|МАl`bfБЫКlZK?:669@FIOXjАМ~pXE<967::::=>=>:=>?@<989CGM]О╧ц▓cG=<;;:863433312379::::8::=@BFJIKLJHD?A=?BHNUQQQPMLLLKIFFA9;;>ABDFHLMJHED??└                                             fГз╖╚╠╗нммппжЕo]YMЧ                                                                                                                                                                                                                                                                                      АПжх    ь║аДЪ╦╚ЯocУ                                                                                                                                                        ЬЯЩТ~idq|ФнбРТЯЯЯбЮЩОvВРМЛОУСЛВo[]pАz}p]\kzНаЙhRF963338?JZoБФПrYK=842//123445677:>AEEGILTTQUQOIE@><<===<<98488;@FYУ╙∙рjA;777677532210/14467667579:=>ACEIJKMGGEAADEINPSSOJLIIFEHGC<>>>=?BCHKMKHIGD=:7625468889789:=DVТ╘№уrG;77565676652//01134358776559<>?ABBDEEGHGGE@HJORVRQOMIHHHIEB@>;;9?EIKOOQLICAAг                                          ЙЭ▄■  Ї╧│╕║нЬЙiicYM                                                                                                                                                                                                                                                                                      ЪС╤    ю╗дВС─╩╗Еk`                                                                                                                                                    ╚ВЧЫЛ{nanАМТЩСИПаиеаСВwmqДСЖ{БЙДqc]Warvj`YQ_xДБ~sgVGA><=?DJYwНДxcPGA962100224545679AIOTTQSNHC>:;;;;9887641100436678:X                                         ┐╡у    ─┤║┴│иЭ~hg]L                                                                                                                                                                                                                                                                                      нzК┬    ю╖дВК║═┼Оk_ъ                                                                                                                                                 №КМЪУАuo_uОУПОЙВРЮгбЪЖusnrГПБu}ЕzfZ\Yfvoa[[Rez{qgc]VJB?BEJUbuМРt`THCA=8431245668569AISQURJC?:732001/024555742//032557;@DVМ╨∙яЩNG?<953455878989621300.2568:6488;@A=7977<>@CFIHFHNOSSRLIFCHHHIHB;<<@BFFIKMMJEDACн                                       ·╖ц    ╜╣┬╙цц└ЦumdQ┴                                                                                                                                                                                                                                                                                     ╛tГ╡    э╖зВЙ▒╡оФtdТ                                                                                                                                                жЛУЭМwnljБЩФЙЗЗЖТЬЮЮС|mpoxВДzt{Бq]VY\hsi]YZatЗ|ia`[SLD::BJ_tГУЛmTKA=<;:96668:99<@FLQUVQKE>962330--...-/01345733443554249AQЖ╘ЄэгLG?<;:74424359:865331///2246765434:=<;:9:;<>A@@BGJNQRTSOIHHJKKJHC;<;=>>BFIPRMIJGDc                                       ╢ь    ├п╢┘√  ▀ЙplWЛ                                                                                                                                                                                                                                                                                     ┘xЕк    Ё╣мКЖк╓╪д~kd                                                                                                                                              т~ПШЮЕnjmuИЯРГГЗЙМХЧЧЗpforuАВyrvБs`\cjptbRORXlБmYOFBFLLD?>GcКyZF?;987667478;?CJRX\UNLHC@;863100/.-..-../12343337:;=;8668@L~╚▄╧п[H@;=>>;763569958875432132238;98768=C?@=988;;9:9;DKKLNSXTPOMIFFJLGA@???>BCIPROONJGH├                                     лх    ╚нпщ    аyo`e                                                                                                                                                                                                                                                                                     ьn{ЭЇ   ы╝оОДа▐я─Цsk∙                                                                                                                                            КАУЦФybls|МЧИ{БИЙИЗМП|fdt~{}~{usti_dlonkYHLOUdp^NE=:;=FNLHRqМВxcNA:6545447998=BJT^Y^SGAA==:8763/0/.-.//-.0022564569??BCDEFKQf|╕▐╒вmcYVTTQPJEB?>==>??=:8564432437888899:<>==;9;::;<;:=ADILRUQPMGEEHKPJD@@AAADFKMQQQNLJGq                                    ┴═    █м╢¤    пЕpeR                                                                                                                                                                                                                                                                                     №wСт   Ё┼пСЪт№эк|t╟                                                                                                                                          ╦kБНФПq\kxВНП}o~ЗИЕДДЕv_cvА}{|zvofWMdmongUFJLVacQB>94349A\dsЕКzhSC;732113447=>ENYdi[PE;5215:62465233//00/,044346889=;97335579:<=:79;;=A=;:779;9588;?DIPNNJGDEGKOMHDDFEEFGHLPPPNLIHRї                                  Ё║    ьл╝     ┼ТrjX                                                                                                                                                                                                                                                                                      vМ╬   ·═нЦЦЩш  ╒uwХ                                                                                                                                         zrМООБeVpДКНЗzr}ИИДВБ~t`k|Аwv{~uh]QJ]qpk`L@LOYd^J<:10/149Lj|ЛЗmWH9630001-259AHVhce_PB;4310./1./2333487555322458>EJPV\dozvsnga^\dkГДБqg^PKHFDCA>>>@BCCBCCDCD@B??>@>=::;;==:7768=@<9988:;85547=CGIJJJFBDGKMLIGHGEFEGIMNPTSNJJKЮ                                  ░№    н╛■    ╪Юwo_╨                                                                                                                                                                                                                                                                                     wВО╟    сжЩМШч  яЗКs                                                                                                                                       ╡^yРМЛzdYnЕИМЗytВРЙДВГrerГБvr||ri\NL]srn_MBKRXbZH;764225;HZyМДjTF<976337:8;AJTdsg[OC:730/..,.20011122778:;:8;:898:<>==<;::;>A?@CDGGFC>=??<8644:><;;99;>:65338;@CEIIB@CHJKKKNJDDDFINNPPQQNIJIf                                 бЇ№   ╕┬■    шжzwgШ                                                                                                                                                                                                                                                                                     uАК└    ївЫЭЭ▌   ЬЖv                                                                                                                                      mgБЧПВp__rЕГД~vyДОКЗА{ukfuЗ~qr{zl^UMPcvkcUJJT]`bSB:858799@LZnЗЮaRA=989:9642/../..//0123368:??=;:9989@Jx╥щ╪mT?:9::9777567::;:86547:98:?CFGFGGFIGHE?;:8:?>>=;9;;9875379:;=?A@@DFHJMNPMGFGILLMKLOSNIIKO▐                               │х·   ┬├·¤   ї▓А|lo                                                                                                                                                                                                                                                                                     В~И╜■   ўвЮЦЧ╙   ├Е{∙                                                                                                                                   ╦^qЛЪТЛp`fuБ}xtyДОЙД}vmacuДxmq{zhZQIRerhaTFJX```V@;;;;>BDJU`hВЦ▓ЪpRFICHGHNRUh{{tnZGF;763441--.../104578;AFMRURNGA@A@??<866675544444:Gw╪ёрzVA6330303663256898644343358:;<<<==DHGLLIG?6=>>>=;7:<:886445689;?JZlУz_NC:8776788788997977>CIPSNTKE>;77343210244766642232334:Dr╙яфСVC;8532//0133575112236300/0305876553558;>EIFJHGGGEA;8768;76433579=;;:<@DTdebWJBRТй░МU@@AQk|ГЕgOE=86330124578:;<=@DNXTWUMFA;864433100/../.024695465665;Ao╩штЭUC<:8661000125642000136421221567740412479;=>BGHJNHE@:7:;;<9421146;?DGJMNONOSTNGINPRSTVTRQONKGE╢                           йт¤  ц─╙№    ёд~|iй                                                                                                                                                                                                                                                                                    фГХлф    ╨иаЯо    ╓ХБ                                                                                                                              rZpЛгХЗynnАХДwy~ГГЖДВzrj`WkБ}ketВqa[TPbtg]VRUdnd]OA764658=FZiaYM?9>LР┬╙ж^IDZx|{u\F@:6200./00158;@@CMV\aXQKEA><9543221//.--./-,.02667;<<::;Dm╛█▄ЯXF>;85511//100/1/.0211242111./.15655411123257;@DFFEIEA<===<83.1149=BEFINNMJJPTLGHMOQMQUSPMMNIEDВ                          ─╪№  Ї╔╧№    ■пВtm~                                                                                                                                                                                                                                                                                    ·ГФгт    скдай№   єЪЙ°                                                                                                                           щP[sОжЪБxjmЖЩЗyГМОЖГЖЗ{laYVoЗzdbtАr`][bnwgVMFJ]hd]M:220137=H\m^TE7246IМ─╓╗mTlЙВsaM<61110/0./0/05:BHT`d]]MA<:877764211/0/--,...-..1589;?BC@?EIq╢═├оlJCA>;88655410000./012/02225/--/2334520.////27<=?ACEHHFBB@><;62338>BDEJNNIHIMOPNJINPQQRRQOHKMJFDb                         Ё┼∙   ╦╚ї     ╞Кusc                                                                                                                                                                                                                                                                                     ВЧдс    эмйежў   ■кЦ╦                                                                                                                          ЬK]uНЫЧЛzowЛХДsЧФИДЖЖ|pcXYpЛzfgsynb\[ctygXLAGV`a]L;300239AOak^RG<6569HЕ┬╥┬ВВПyfWI=9733410124547AFNRV[eyв┼╚Яzf]YURNKHEEEECA>;855674/00/220000.03566300-./17;=;=H^pgl\L@953000001000/145575787688;=BKQZbegdcl`izМШЭПu`XTPMJHFEDBCA?B@DD?B@><:875544200034577420-./16989989>ACHEEBA<958:>AEGGINPPMKMPTTPKNMOQRWWQMJIGC?Cт                       Ю▀   ╧║р     уЪ|yd                                                                                                                                                                                                                                                                                     ГЧпъ    ЄлодЭ█    ╟ЦИ                                                                                                                       √PXoЕЫЪСЕxoБСЖqkv~ДЗККИАt\Sa}Йxhs|ujZPHaspfXG>O\_\UD866536;@RgcSHD97558A@@?@B>B;:731445456741///01468:96599988=BCDHMQMGILPTVSMMOQQRUTQJGHFCBAи                      л╚   ╬╡╒     эеВyh═                                                                                                                                                                                                                                                                                    ЦШ▓ъ    °лпбЫ┼    ╫ЯЛ                                                                                                                      ╠Q`vКвбТГxqДЧЕmit}ВЕИКЙБs_K^{ЕukvЗ{kYJD[tthXFA<=@ADGO`u|Бx_KA75320----,+-,./003447:CJRY_V][YVSPLGDA?===BHOZqЖВ}mYKE@<875433341//144569;DKSYXY^ULGDB@@?<=998788;D]╣┌яХO83//-,..-+++++*+++,..//012258:9:9>;<:76;<9410--/478;;6.25:<>DKIHB:578;@CFHMOKJJILQUNIJNPPSUYSHBGKIEB_                    №ес№ ╪│├°    ∙╕Й~uz                                                                                                                                                                                                                                                                                    ╬Йг╚     ┴░кЬ░Ў   ·пП╜                                                                                                                   uUlРЮвЮИsrЕУ}jim{ЙЛЙДЖИБm]nБynkq{yp]LLZnlfVGFP^ef[F;;;@BIP[nxdPLHD?;<;?BMaosxа╓╫пSD965589<@FO_tЖt`RF??=>?;:;88877645579?HNTWNTPJFA<:88889:877545469B_╢▌·нU;1-,,+++****)(())))**+)*++,,--/2379;<:;?@A<630-02367:;62379;@DEFEB<987:BDFGKLIGFHIMQMIHIMPQTURKFHKHCAP                    Н╒ё у┤╝Ё¤    ┬Лyxb                                                                                                                                                                                                                                                                                    ёБЪо     ╨░оЫзя    ╗ОХ                                                                                                                  d^vКЩдилМsuЙТ|ihfsИОwЛЧЙslzЗ{mlpszwZIO^illSCFQ]ei]LGGGGNLO\nr^I@:742359;L`ijkhЯ█т┼[?42359=>M^nАБeND;754101479<:>==??@CGLSQQRHA<886453210./3444542358A^мс ╔`=0+**++***+*()('''(&)('&''&)**++--.0269;BBDB=84/0/147:?83456;@BDBBA<999;AEIKKHGHJIIJLID@EQQSSWWMCDGEA?Fы                  Н┬х№т┴└х√    ╒Сuz`                                                                                                                                                                                                                                                                                     zМЮЁ    р▓▓кж█    ╧Фx                                                                                                                 \fНгпойХyАОН{ccdsЕЙ~xЙЪН|zДЛАnmqw|{\CObnqmV@EQ\gm_RKJIGGIJ]qs^K=2100./59Ldojh_WУрь╤ZB2103;DYr|ГvYD<41/..,-/13366;?DJPVZRVRKE?;943100...--.-/012443268A]зц ┌jB1,,*+*****+***('(')*)'''''((()*)))+./36;?BDB;86321158:<:6468;>>=JOQPRVUNABGHFDD╘                 ╡л╓Їсми▄√    яШr~e¤                                                                                                                                                                                                                                                                                    uДО▌    ·▓│йв╠    ┌Ы~                                                                                                               чZj~Сам│кРАЕПИykcaxРИutИЯНzu{ББzkhwИВbIRamxu\FKS_il^RLGB??@?Tml^N?2011125BA<=EJJJIGGHJJKIHEBCIQRQQUWKCDIKGEG╢                щХ╤╓╒пб╨·■   ўбxj╦                                                                                                                                                                                                                                                                                    sЛ╠     ╖╖░з└    ъзВы                                                                                                             ┤ZoВРвм▓зП}ЖОЖwi_]}УЕrtИТmrv|{pevКБdPQctВ~dOVZcnhSD?:878>BQgaXL>50/0037>RjicWG;?IДсє╪fQ>@DVuМ{lYG>941//0014579:?EOYdVTQH?;7689::7763430200//012258:;<>>K^С╘ё╬oN>87754320//...,+++***()****))('')(''*-0344569;:=<<<8577;>=9479;<=;;;=?BA@AHIKHHHIIJJKKHEEGKQSRQRSMFFJLIFFЦ                Д═∙Є┬в╩·■    п~{nЫ                                                                                                                                                                                                                                                                                    И|Й╞     ╝╖ое┤є   °оК╗                                                                                                            Й\qДХб┤└дvЗОЖzfY^{ЬИowМПm[js}ЖАh^{РБcSUZ}ПВj_ejqueL>855558BXf\QG<40-.158@Vme^QB77@HWdgiZMC;542222/.744666775543456877:<@CFKTfМ▓▒├zkaZWUROLJFB=:98430-*+,,,,,+*)((()*)(')*-3642343259<>A?::892699::::;<>@ADGHLKJIIIIGJOLEADHNRUSOPPMGDHKJGFГ               ~╚∙√▄и┬∙¤    ┐Жust                                                                                                                                                                                                                                                                                    иzИ┼√    ╠╖▓имь   ¤├СП                                                                                                           pbwЙЪл╣├й|qВПЙ|fT\}ЪУzВТОqR[o|Кh[|ЪЗgTTZ|ЫИm`akxДiN<5./024@VmcOE8210.037DZmj^P@735=Fx╫Ё▐ЗgXeГЖlVJ=96310/-/128?FO_ro_]N=8440///..///0/147:;:9:89:;@DKS\gromhrЖвЩЙuh^\YWTSQLFHBHA@CA@;85310.-+***)()))('(*/97422/0269:65668;;99:<@DDEHJKLIMLKKKIEFCGKPTVSMPQNE@GMMKIm              Щ╛°■щ▓║ь¤    ┌Оwxf                                                                                                                                                                                                                                                                                    ╦vЙ╝Ї    ▌║┤киу    ╫ЦА                                                                                                          cf|НЩк╜╔мД}ЖНЙЕiT^|ФОЗУаПsaZ_АЪЕgbбОqd]a~ЯЕk^X`АНoQ@62./47BTcd\E95433247E\jhbTC<758APu╔х╪ЭvuГ{fWP?;8666767878>Obpt`QE863110/-.-/110/0146:>>AEHMRX`cfgeca`[Y\kБ|Вq`LDA>;;;;;99;:8:<>@C>A=;<<:520.,+++,*))*+3;:851-.78:>>==FGDCBA<8423:?;88;<>AEIKORRRPKJIGILHFGLPW[TONOLHCFNNIE`             ╠┤ю■∙╜┤с¤    ўШ{}i                                                                                                                                                                                                                                                                                    ёrИ│ё    ∙┐│кд█    ▐ЦЕ                                                                                                         `hГСЭн╜┼┤КВЙПЙ}gW`}ОЛЛСдЧye`_{ШЖjgВвШ|rkrМаЛi]V^wОsVE93113;GXbc^K976656896311010//.021234579>COY^bca^YSMIGGEDCEGZМ┐ХrXC7654110//.123223468879=?:<9:841.,,+)+,,.38:731.137<><9>CEDEED?8359:<;9::>?CFILQUUTPNLIHJLHFGMSXZUOLNNHAEKLIHZ             жх■ ╩▓╓№     дЕБpЎ                                                                                                                                                                                                                                                                                    mБдс    №┴▒лв╬    хШЙ▀                                                                                                       WkГУЯ▓┴╞▒СНМПТВ^NfzВВЗСЫОБiWaЗйАeiБЪЬСzИазРwVL]wГzXD942337K[ch`K<96468=CRbea_ZTJJKJJKP]tл╙╥ЩЛdKC@><=>>>AEGLTZkВЙueYNG?9842///00//0213459>EMTWYXWPFAAA>?<:889:;?SТ╪фЫ^B1./.---,*+,--,,,,,,++,.35579=@9;840,,,*,.3785201137:;;89;>AEEC@95568<;99:;>?BGMSWVRPOLIIHFFEGOTVYVOMONF@BGIIJT            С█° с░═№     ┤Н|s╟                                                                                                                                                                                                                                                                                    jЦ╔    ¤└▒еЪ╩    ьаМм                                                                                                     °VlДУб╡├╟╖ХЛКПЪЙcF]~ГБГЙТНКmT_КнОbbzЦйеИВЭпа\DTvЗ|eF510025J`lumR:;:7415346:@FWhyМЕeOJECA><>;8643211/158=AGNLPTRNIC>85444678654447;PЩ┌ь╡jD2.,,+,++*(*++,*++*))(*+-/-024689;8;;631//0267642/0469=<:9:9@DDEA:3347:;75:<==AIQUWVSOJEHFGHIHIPPUXWSONGCAAFKLKU           Ъ╓Є Ї╢┴∙     ├ФwwЬ                                                                                                                                                                                                                                                                                    q}Ц▓     ┼░ка┐    єлМВ                                                                                                    ▄UnЕЧл╣┬─╝зНЖХзПm[drКУЗ}ИвкvYbИзФukmИзкФ~ВКдлТbKWl}АnO85345;J\o|t]NKKFJIIO\lf^PD;8444579:>TlОйжМSC=85104568=G`|БИvZG>88788;>@DJRTXYRJHHIGHHIKLOTWZYUSLJGCCHNLKR          ┴╚ь ¤╛╜Ї     ╨Чx{                                                                                                                                                                                                                                                                                    ПyНк     ╩│йЬ│Ў   №╡Кx                                                                                                   ─\sЗЩл╕└├╜оЧЙЫ▒ФocitЕЩН|Ебй]gИбЫВmiДжгВkuБЫнЧiPVrБМzU?;89;AN`vНvaUPMJDDCJYgd^L<653111258?PgrЙм╟╙eA9641049=@MjД|vaM@:34443467<@CEFGIJINRQNOF>:8531200//121233211035:NМ╫р┘xL60--+,,+*)(')((()((''(*)(()**+*++,./258:899648:97543469=;84559;>@B=8778<@?;;<=>>EKQXXPHKNMKMLMMNRUWWVSMJGECCHKKLO         є╝х  ╟╖ц     ▀Юyl                                                                                                                                                                                                                                                                                    оuГвё    ╥╖мвлч    ╩К{¤                                                                                                 ╣awЙЫм╖└├─мКЙо└ШsmpzТйБiАзкz[kЖЩЮРxiЙнЮw`_fЫ╖ЩhNScСгЕZC?;:;EPcГЬ|^QKE=877ET\b^L:4310./237>PdhsЕ╚тъvF944325?GZwЕudR@963100123434ADFGMY`QPKFA>::0/1000-,-.00111120/-059LГ╥ыъЖN51.1.--,***))*'()'''((('&''(''(*)()*)**/569:89;;:8643226;;852037;@FB=978?B@=<==<;DIQVWPKIHKMNNMOTUTSUTNMKHFBDFKLKN         м▀  ╓╟╒     №з}{l                                                                                                                                                                                                                                                                                    ╤o{Ч▄    с╗каж╫    фФ}р                                                                                                ┴eВСЮз▓╝╚╔пЗДн╔мyuyЗЯмИd|змБWaАФебЕwЦ╕з{^T[Л└гnRPZЛ╖ХcG@:?@OavПа|SF>75242AU_a`M41/.-.-,04@VkhfsГ┼цЎЛM;5347CNdАВjWG730-,,.,-.013:BLV_bcUHA869:98730/-,+----.0/00/10/049Ix┼фшЯQ72-/....,,+)))))*)(())('&(((('&)''()(*++./27::<=?=954/169:860//145=EA=;;;?@?=;;:;9>ELSXRFGJMNPOPRTUTTQLLOOH@ABFJLLR        а█  уз╩■     ▓Вxs                                                                                                                                                                                                                                                                                    ¤jsМ┐    ў┐лзг╧    яЪГл                                                                                               ╛lЛЭлмй┤├╧▓ЛМк└▓ТБПимМl|еиКlciЧ╖иНВК░зМhT\Г╖е]P\В╡аuYHCIR]kАЫаXE;63244AR_gaK<5420/0133C\nlhWQk╜у°ЭR@;59HWmВzbOB6432/01112579=CUke`bZD<842156676321//....01245444646=Km╜┌рЪX>3011/-,,-.,*,,,,-*++*))(*()**))(''(()+*+,--137<>@A>93/38:9650///16:>>>>@AACA=<<>;9=BIRWOEEJOQSTSUXXVUPONONGACFIMMMU■      ║╓¤ ўи┬¤     └М{zс                                                                                                                                                                                                                                                                                    ckБеё    ┼ижЯ─    √гИВ                                                                                              ├oМЯмнжн┐╚╣ПТм╗▒ЦЖ}КдмТv}ЭкСsceМ╡жЛЖЫЯОnUWzийЖgU\~здБmZT]daf~ЫвИcH962258AS_jcL;83311248:E[klfYHPg░▀∙│ZD=AMYfzhTF@9754215569:=ER_juk`abUG94///01-/24684453246668:::9:;@FTtЯ▓╗Р`LHDB?><<:986620//-+-,,,++,,,++*))(''))*())*+-/.27;?B<764599896410.159<@ADC?@A?<<==<:;CJPTPGGORUWX[[YVUTQJGMUMEGLOPNOR      т╞Ў Ўл╗√¤    ╫Ч~╗                                                                                                                                                                                                                                                                                    `hvП▄    ╠здЪ║№    лМx                                                                                             ╝tОб▓ол╡└├╢Ыдм│▒аДzИЫЪОЕБНжг|`eК╡ЫЕ~ИзжoRUlОдЫgQ[xШЭТ}kbcjdfЦШИpL942138@OfyeE642443238>N^hlk]JMSkк▐Є╔lWW^acudTLD;86332368;ADShwpxfWTajdJ:2.--00--/14668:9768;>AFLPV]bhlozМдЛЖi\WKQHKHHJBE@B@=<;:75431.,/0-*)))))*+++-)()('**+-/159>:<;978679841//36:>BDIC::<<<;<=:79FJRRPNNU^_^^`a]XTTMFGRXSKLRWURSZ      ╕я Ўп┤ў¤    ЁвВАЪ                                                                                                                                                                                                                                                                                    }er╗    █кдЫ░ў    ┴П~√                                                                                           ┐wТе╢╡▒│╛─╣аЩвк▓еЙu{ФЭЩНВ~днЗ]\Дмаyoj|Ял|MJ_БЬЭoFNlСжбЕzaYZY[uЪЬХV63///3=Jf}jJ74135679=CSemql`VQWYnг█Ї╤}prpkfZOKJEAC>BB@??@JShВВngYKMOaГЦh?4/-//0,--0348:=>BFJUahmibhgddbbdivq~fOHCCBB@>=<===>==>;;:;?DMSTRQVcghkms~ДnRONJJN`bege`[Vfch     кч¤Ї┤▓ъ√     нЙ{И                                                                                                                                                                                                                                                                                    жcn~жє   у▓жаис    ╪РД╠                                                                                          ┴uРж╡╣║╢╣║╝пОЛ▓├кЗyy~ЯмНqqЪ╕Лd`xСПЙeYnХеДYNPrЪЮuQR[}дкСuaRKGNhВж░ХnM=7206;Gb}iOB;69=BEIPVblprfULIKNWdН╬ъ╨ЗsoiaP>;99<>@AFHHJNXdzОЕm[QEC=HИ┤╡ЗD62013622467:;EPU[[Xigb]WQJEEFEFL`ДАЙlI;67421000/1223456769:;;@<840-++**)(()+++*)*++++.244:>><:998984/0/16:=BEFDABBC@;==@EORSRRYax{yuv~ДЕZOJJKQfklhr{_XeИxg    ╕▀ёЁ╜п▀√     ╛П{u                                                                                                                                                                                                                                                                                    ╥eqЭш   є║зЯг╥    ЁФМШ                                                                                         ▐wНе╡╕╖┤п│╖нТДм┬нГonuЬ▒ХpnС▓ЦhfxИПНhS`ЕЫЛdQMgФЮ}[\]xЯдАaTGEDJ[yб╖ЩiVE>78>LcwnQKHIKOIQORW^ior_J?;8;=GTy┬р╦Тvj]N<;7658::BJMNWizДНuWJFB?>FP~│╗АE953445369@ISW]VWWPJHFDA><:9677;G\Ь▌╥ГI<100/0/..--..-//...003577;A@=@99741.,+++,++**)****+..28<=><<;769:521236:>ABEFFGECCGHEEIMKGIR\gsngfnqeZOHEJT`qndabcefkpdd   ╪╦фэ╩└╘√     ╟Ц|w                                                                                                                                                                                                                                                                                     biuС┘    ┴гЪЯ├    їЩР                                                                                        хyПв│╗╣кЯ╖┬лИЕе├оЖi]iФ╣ФqqЛвХuvxНжЫfLZuИЙtPGcМЪЕmjmКеЯА`LA??GUnа╢УuvxZC<:677<@OqЮ╝╞Оt`NC=:::<:9988644342037@]▒щ╓вP9/-.-,+*++,++,,,+,--,+,+-12237:8;97654/,,-,,**))***+.1455:<==;99<:842137@<;:9<@IRoЮкЩБiTGEB=D?ADDL\ЪбвРvjR=51.0145GQnЗw`OD;81//.0256:?NhАsdcg`TJD=8644312332215331/0012337AZбёю╖UA41/0.-..-,-,,++******+*(''()')++,--./05::;>:51.-,*,,./0//6:846:=CGE?974:CJOJB@@?ADC=89;9648=FLNPRSTRNMNMMKHCFJNRZc{{iZWVWX╖╜╩тў┬╗р      ┬О}░                                                                                                                                                                                                                                                                                    ║bdxЪЇ   цбЩЮп     ╙ШРж                                                                                    qРо╢╗║╢▓оноиБtС╢│YRXzЮЫq_ЙожКzzГЯУjLOlХХtYP[АжТ|j[aВЫ}YGEEBC[qХжЧwf`bxПХФЙЗДs]LHFECB?BJSsnTB;85567:>=\pxАЯ╤╘б`B735868?ITd~jTD;6650//-/38=?EQeД~_`VF;623213410242/047510/013567:BYЬшш┐ZE97553200//-..-,+**))++)(())(((**+*)++*,.039?::95/-*--..//26978:96@FEA>?AENNF?;8:=@FH?:<<;428?FKOQTVYUNLMOPOGEGMUcs}БiURSUXjП┴▀Ї╦╣╒      ╨УyШ                                                                                                                                                                                                                                                                                    Є^`qМ┘   ъгЦЭиЇ    хбПЗ                                                                                   wТн╡╣╖┤┤▒н▒лИgАп║С_OKlЩЯyYv▓╡УzstЫдxMC]ВВДhRVxЯШmZLRqСЛ_G=:;>KfКзаАknrnq}ИТСРsQ?:664315>JpЙuWC9020237:?TtwszЭ╧╙нlG:8687AP\hoYF<40////.0023=CQap{ДrXI>8420----//0431013522003578::=FXЪс▀╕lR=;:9753211221/-/-+**,,**(**(((())))*)&)+,/1479=<741-.../013579988><952:BJNRTSXYUONRUQDDINVl~Т}_QQRVZh╖▌Є▌╕╠      тЩzА                                                                                                                                                                                                                                                                                     _bmБ╞   ёпХаац    №зТД                                                                                  {Мж┤╕пк╦╬╩поЦr{айЩ|WNdРЭЖmoХ░кГfkР▒ЖZGQpЭл{^bxОЧЗaNRe|Ж~TB;:>FRАйдЖomtjglvЕЮз[B8441347;GiК{_K>544349>GYnsxuuТ╞╬╢vVKIJLPX[dkZKA8433312358;?D`|{x~zdPB84421.0...01455358:777889;>ADHRjХ┴╒╢fZXTPLIGGGCA><9762----.,,***(()*+*+*+)())*+-+.2589:>9433432117;=;6=ABABADA;8657=968:>BGD>==;77<;AEJR[fpooonmД╢╢╢wRIFHWfcb[OEA<88867689;ALYtР}kgosvN>7211/-...0157888:<;EJEB?=>>??>;64479;;99:KSWWVWZWTSQPQNJRdooobXSPNRVbqХ╧х╪╖└√№     ┤Иy                                                                                                                                                                                                                                                                                     }bhvЮЇ   ╨ЧЭЪ╞     ╡ШВ╢                                                                               бЖЪезввп╢оожЪЧЫЭп╝йЕqt|ЭнЬЖН╢└║ИАУгжЙobjКйЯАВИЩ╢╛жВ|zЖЩЬБVOJHKTmПКВscRE99@YyРХЛeH933325;Ng}В{fSPPRQRLU\bknmWGESrм┴╣rNEHYcc_RA8743343358??@B?C@>;52220.-.,,++*)()*)(&'().58<=??<:85<:636:<=:6348;<;518;AGGD?;989ALTVSV[\VONJNU]gnnkc]XTROOU^lЖ░═╬╡╜ю№     ╟Сzь                                                                                                                                                                                                                                                                                    в_euР▌   сШХШ╗¤    ╟ЧЗО                                                                              пВХджгай╕┤бЭ~wНв╡┬│ЪОПУе╣нЫд┬╧┐иЯЫблжЖzДСЩШЧМОЫ▓╜┤лзвзйгТ}l\XU^uЗЗЕlO@:755EhНп║С`G835668Mk~ЖИt^ROMJGFDN[fnjR=98A^Т╜╢sJG\id`P?530/-/0123A?<<97510.,+)**)))(&&')(*,.4;>@HB<@FGEA=8741006:;><737:;:73169@GHFA;78:BMXVPV\[RLMMYhvБГbTTUURMOT\ezЭ╝┤н╕р√     ┘Ъ╒                                                                                                                                                                                                                                                                                    █^cpЛ╜   ьЮЬЩ╡∙    ┌бОv                                                                             ╔xСагдвгй╡▓мПyuИ│├йИЕЦи╡┐еОСл╜▓аЮЯжпйУБЙТШЩТОРжмЩКЧзЮУРПМИЫСЕБОУЩЯjL>8548AVyб╝╤╟}R>8;?CUhПМoSJEA=<<=HM]jgN9645:QД╣╕w\agc^M:5211..0357>D`АВveTC?<:Fa{ПYB61.002457>IW\c^_d]TLDBB><<:879;<;;73---++**('&&'()*+-06:AIEGHB:867:94.0466:>B<899;842357>EHD@<8:NqФа▒╤═ЕaF@KVcrВТЗcE?86459>DNZidK941349Kx╕╣ВkkcWG:40/010148=FSmКx`PF=:554;QnЕ]G:76689?FOZbY\TLFDA?<;9884544346;RЧ╤ь╝]94/..--++++*+,++++++,,..///1369<>>>A:50.,,+*)''()()'+,.05;BCCB<5678:82-0457;>B<8:=<723258:8875/04521000129PР╥ї╙h:4.,,++,,,-++,,***)))*+,+,,,--./047;>94/+*())(('')+++,,4;>@@:6768982.1148;BEB<<@>954458=CGFE?:;BJPUSMLTZ_wКМ}]KJOQTX[\VRV\fqxЖЮ╛я     Ў╡ОД                                                                                                                                                                                                                                                                                     kcepТ    ─ФСл╬     ▒ПБ▒                                                                          |ЙЭЮЭабЮЬЬжн│Л|}Х╡╖БLNbЕм▒УГШ║╖АSfХйНhOKjЮЭv\VZЛ┤Р\DENzбРi\kxz║╔╥├ЪkN940028YОЪДzТ╪▐╗ВhaYYАеТfI:3100/3>Lb{fK93.....3A^РЯАgS@00----/024EXhxЛfF=62//.0/.18JreXHGPY[^WMGD@>;;644553/./..-*--.17OИ╥√щw<6/-,++*+**+*++))*((()+)**+*()**+-.158<@>;93.,+**)(&')()),.49;>@;7878874/./3:ADEA;;?@<42038<;CKQPNNRZgВУЖjVNFHLPV[\XVVZagp|Ф╕ф■    №├У}                                                                                                                                                                                                                                                                                     ОachД    ┘ЩТн╟     ╛РЕЖ                                                                         КЕЩбвгебвЯЬвпйxkЖп╕К\NUvз║ШИМ▒╢Уmksаз}XQb}ТКfOTzлХgKCIjХЦypz}rqв╣┤жЙgG>;86KkГjP@63011028E`yyoZE62/.-/0146FYequ\C;410///0/25;Nji`aheQUH>:;<97886444630///0/011469OБ╠ЇцЕ?931/.--,/0/-.+)*++*++,*+,+,***))**++/36899>953/,,))+**))+.148<>?>:9:<9951027=EDBA?>AD;41149=CKKG@<;EQTMIRZjЗЕjWUXLGHNRYd_\Y]bfkwО░╓      ╤Ъy                                                                                                                                                                                                                                                                                     ╝_^cz┘   цЮШн╞     ╔ЫНs                                                                        еФбеебгЭЬЩЯпнДdxа╕ЬeTMgЧ│вЕОЧеЮ{clЦ░Л_TeyИЪtSOkЩгqUFG\~ГЕВАtaUdДо┤ЭАeS?;7;JcЗЧЙ{vР┬┐║ЖYRlОШ\B840137>MkЗqSF:4324578@PdpshL<802/1467;NdhkbP@;63//0/147:>GS{Б|viVF=55557887644433122234445458;O{╚ъ█ЙD=6332222031/.-....-,,-++*+))*+)(')))+...137<:;83.,)***))+*-.28<@C>::;;:730148<@BEDA@AA;42149?FLLE<;@HPTSUfkf_YRPRPOLNQU]__US\flsЖд╦      ▀Эw°                                                                                                                                                                                                                                                                                    Ї^`cq┐   чЭЩо─     ▄иХx                                                                       ▌yНазлнйзЮЪЮм░ЙflОклЗQN]ГЯгПsyй╛СcdП╣Хh_j{Хп~VM]}жЫZDDQpЭкГyhTILYУ░Ъt\\`JA@F[ГЮН|qnИ╣╬╞y`b}ЧХ`B630114:PnБw^J?:8656:@HP\hotbL>977668=FVkhi]I<9321000259>FO\sНЕw`I:62/01348965533323344599::9:=Cnйж{^VPQRPM[}ЯКdULSrл╩╚~mwХЩpB7211247LpЖk[C@@@ABFJQZahkovcNA<;779>J[og`SE;752322234:?PfwЖП}neK84..-.1345653312234658<>ACGMSZdwЛепЮИp^]UWXSMHRJKNLKHFC?<;7420-,+)+**(((((()((*)+*.38=A973-,***)))+06;>?AA?@BC<4//08=@>>BEDDC<62039>CHLL?8;FUj{xu]RPMKNQQKKOTY[]]\ZZfm{Р╕я      пА└                                                                                                                                                                                                                                                                                     _^U_Тє  єЯНи╜ї    ¤╛Цк                                                                     yДЭвйп▒│▒▒вЯеиСegШ┐нzTKYТ╝гvjГ╡м|q{Ф╡жwuuВШЮTKdТйДOAI^ЗдПmXI?;A\МЭОhLEMRYcsЗХОrQC@Gaа╚┘КЖЪЯsN=765589Og}Жy`RGGDACCEQZafhgfk`I;73258G[faYI;53110298:=@D^zГЗЙxjdYC73/,.04577665432458:?GOV`hoghsruzЖВ{jYMHEA===<<>ACDDFIEDD?B<9774/,./,))*)*+***++)*-/1587962.-+)*),049<===>@DCB<63479BB<;@AFHD=70.6@<==ABB?:6549>>;9=EGGE<4348>BCDDDFH]ВЮЛ^PKKNOOPRSRNJUX[_a`bejtЕз╤∙■    ╔ЖА                                                                                                                                                                                                                                                                                     вYXb╔   ▓РЯп┌     ╒ЫИv                                                                   ═|Чжмл▒│╡╢╢╡╝┬иyapЫ░йvUWkд╜Ьoc~┤╗t\vг╡Хwie~ЮЬlMQmФбЖWKYpУжКT<989FgЭ┤ДWKIKTaemЙЮСkA;88:PЗ├┘┼лКkK;=ADIRbsЗЦ}XB:43345=JPerbI;>=<<=AMp└╫╧\F61/...+,+-.0/*,+**,0235668?<860--,.-,,+*++++,---06:782,-.-/26<<967:=BEFA:544:AC<7Qf[PF;20-.-,-.13AQhЖЫcP@:CM]n`E61-048=ABCINRWVVZRJGB><:83321339Cm╒х╒bK3/,-,,+-+++,+++*)(),,,./1479?:6310-++**)))))(+/169:=820/-/06<<6246;DGC=7246:>@=6;AFGE;4347:>AELb|МИs_SHDFJNPPQPPPQSVWZakppzГЦ╣х·    ▐А|                                                                                                                                                                                                                                                                                      UVXsа№  █УЬи╚     янШ}╙                                                                 ЗНж┤┤╢│╢╢╢╢╢╡╗│Бctг└еs[^xо╜ЬnjР╝лk^|гмРmbavЛМpLRzзв{`j}КжаvL855:8788763100135Bn╓щ╥iO6..--+*++,+-,,**)))+)**++,/12357:=CCB=60.,+,*))*))+++-169A@962/006>A8124C96:BHFB91147;AIQcyАhQSUPGDGLOQQQPQSRWYX\gt}ЗКТо╙ё■  ¤▀{~¤                                                                                                                                                                                                                                                                                     SVVlЧ∙  єЧЫе└∙     ╜ЪБЮ                                                                пДЯопм▓│┤╢╡┤┤╗┴ЧigР║┐ЗfZlЫ─┴vi~ЫзЦelЦ▓ЮwadfЙЫД]KeЯ░НwxyzЫиЗ]B557FfРнЯwegqiXPbЕРДysjYIB>BQpп║оЗj]YOFEGVzЯЩmO<631117@RqЛtPB7347D[]NM\g[JA941/0/003697:=LX[[`UKB:67773422321/111149Dn╙ъ╙pN82/--,+,-,,,+,+,***)*)))++*,+./125:?BDC?:5/.-+,,)('&')*.27:;9631048=?8147:=>:6645:=?<87:BGD<6568=DMWddZPMNRRNHHNQTUVUTSKPX\^akБИВЕЪ╗тў  ч┤{sр                                                                                                                                                                                                                                                                                     eSRcЛї   ЬЯг╝э     ╔ЧЖz                                                               ¤{Щз░▓п│▒│┤▓╡┐╚вqf}и╝╢r]iЛ╖╩╝mkС┤жq^К╖з}^SS|вОbNVy┤┤МxwswжжuH944CHR]]WPIA<743341/00120,.112469Bl╔ф╥}S;420/.-/00.--./1/+**,*('()***++--./148=@?A=72/.-)(&&&''()-29>;:62469>?62223;B>:744:@?8557=EA:644:Ectsi\MBGQVPIJOQRUVUVXRKOX\^byОД|ИЪосчр└Зqi╢                                                                                                                                                                                                                                                                                     ЛWV[}ю   аХЯ╕с     ╓ШМt                                                               }Тгйнкжмко░▓╗─└zjsС╗╜ОXdДн╚╠О^░▓Tpп╕МaKBdЪаqQSfз┼лИsihУ╕ПU9549Cmз╣Ъta^P?9E\НлЗXELR`odW^~а│╠└ЕTD972AcАПУ^>7432024KtОГfN99766:M]htraPI6310103236AUjko\G;61.--..12Ck┬┘╨Ц]=6330//011/0.//0.,++,*)(()))'''()*++-049>AHA93/.,('&&&&))*,16<<<9659<=8511258559Py{xePLIDKTUOHMRUY[XTWXURSVX]susuzБЦолбТ~a]И                                                                                                                                                                                                                                                                                     ║SVXq╩   вЬа╖┌     ъаХx√                                                             ЭРЬеизилпо┤│┤╣╝│i`}о┴еnrБд┬╚аgrв╢ШuwД│кuPIQvЭСgN\О╕╝ХtcfВобmG988>]ОЮХБbVH>;;9<@=843446;?A@<89<@;6357>GC<BSisyt^MH@>;:;:852000011345::<@90-+))))&''(*,17:?@<9;>:512125;BE@888;<:5258>DIOXxХАZFBBGKKMPUXQJQX\^a][WPOV[[Zclolgr~Аzuqj^R                                                                                                                                                                                                                                                                                      UXTaТЁ  ╡ФЧ╡╓¤    Ї╗ЫВЩ                                                            {НЯаггдкм│п░╢┴─Щe\zл┬║|nЖл╣└оhoй┬вwtЩ║ЫgICU}йЗ\O`М┐╕А`X`Б╕╕oH97=LcЬ║УbK=449AW|гЮeKFJR\hceЖжжЧЙ▐╪┤aF:AgФЫА\C9989ENY`gdhoenijsАБxkTNIEBBB@?AEHIIDECDEDB;510--+*+,--,*)(**)*,.-.48<@<840.*'&'&&')(-4:?B;5;=950/-27=CEA:768;85158>IVlШБcM@;<>FILMQVTOQUX[^c][TOLT\\\clogetxxwsofY                                                                                                                                                                                                                                                                                      YVK^~╪  ═ЦШ╡╙·    √╦ЯКА                                                           ЯГЧЯЭЮЭЮзк▒░▒╜┼╖uZbТ╗┐аo|Ъ└╘┼Ж[Й┬║ГqТ╣╝|VCHjЫеmZXuо┼ЦXPRnи╚ЬP>8;HZН┐еiD90129HkЪл~MLS\hnVKgПбФНСс█║hG;XЛЯКiN>>@CHQ_oЛйК^E@:7456?SgomfO<3,../028?VqjaTB01---.006;GUgСvqxeO?369999998442479;@HQZdlkid^YURMHR_xЦЮoB975541/0249:;9;=??@@?<>>;62/../.-+)*)+)'*)+-/25:C>;81,*(&'&'&'(.4:=><9<;83./049?DD=99;<:8325:KbvmeVG>97;AEGJQWYJLSXYX\\ZZVQMV[\]bhihmu{}ugiVо                                                                                                                                                                                                                                                                                     |WP]t═  сЭЩп╠Ў     ▌гСА                                                          ў~УЯмгвгжм▓╖┤│║└жcV|▒└┤ХКНо╩╠аosидХТЦи╝оdLHW{жвdUhШ└йeMJbТ╛╜uJ@BK\╖│}S?5147@`РйН^\cbcdTIXtЛТНМШ╓╘╛kQOoЧЬ|XCGMFJPTdЛйЛdI=97046>J[ovj]L>4.,057:DZri^P@611.-.2577EUgВП|fisdM>7:;:<>?><9679@IRX]\YWPJGCB>>??>BZ▓╦╤kC95310..///11//./4542579>>:=:98400-++*++)+**++,.17=<<82+))())'))*/6<=A>>=;73/026=CCA@=<<;9336BUekmYF=<;99=BEHMU^TMOW]]\YVV[ZRRY]`dhkgkzНЮХsiba                                                                                                                                                                                                                                                                                     зQIVs╢√ эеЪл╞Є     ЁйЦКї                                                         ЖУЭжебвжл░┤│▓╜╚╗БVhЪ┐┴пМВП╣╔╗ЕqЙ╣▒ЧРЯ╕╗ДLFNjХпДXfИзиМYFS}г│┤bGGQ`{ЭЬЫfE84059M~зЭytpbYQGCMiИЫУ|nЖ╠─╢pZcИаЖgVTQJDFHYвФjP=54336=HYmt]KMG?5//36;G]rm]N?62./-.049BUkyД{^LV_^YM>6=ABCDCCBAC=:4-,,+++*)**))(+-17:;<6.,*))'''*-265:?@@?:42/027>BCEB;;=A;7;L[aeWKD<9:;:9TrИЖ~SA74213;E[psVABMLA71048H`pkeL=652/.-.38D]yz~oSC>=IUWL>=FEEHIKKMS[YYXQI@84322/00000134C\л╥щМJ91,,-.,*)++,.+*,-++,..../.+06:==>?<94.,,+*+)(&')))+068D710+)))'(+2864:=@BA:3///48>@DHE>7322;71,.,+*('%&&'(*.26:850,*)))*-46758=?A?:1..07<>>CGFA?CEW{МqMHJGA=:=;78;AHMRWXTQQTSJMRTVWQJWlsg`j{Ле╢╧╒vojg}                                                                                                                                                                                                                                                                                    UPOY{┴ ї┤УЬ╣ф      ─вЬБ                                                       еЦдллдздим▓┤▓▓╠╬жk_x┤╨╬░КЙФ╔╧ЯБЦ┤зМОг╢б`F@SАкд}|П╡╜еmGJgб╢║д^VbvВФп│yF:5348CkЫаМsYE?:78A]ПеИ]D@FNrtvЕЧФДXD:7447?U|ЭЧfB831149@_}}aF;7TФ╦╝╢V;2//..-,++,+*++,+**++*))((&'*,,-/06=<<;8511,*('&(''(*-059;;90***+,/48637;>>@60/149>@?@DGGGSnАВiD=DGE>9;;:69=CIPUZZSNQ\OJMQUVYTTankeg}ХножЩЖyxo`х                                                                                                                                                                                                                                                                                   nOPUv┤ Ї╕ЬЯ▓┘      ╒егЕ                                                      №Убикйидвзо│▓▓┼╪┴ГanШ╔╪─ЬИЧм╟├МoгнЭЛТнпHFEhЪ░Ц{Збн░Т]CTЕ┐╬╟К_it}ДПЭЬ\=867:B]ОжУqVC=8777414;D`ЕДlTC9;>PSJBAPaee]I:73311139=Njuj^OA9410/27@MPLLZiwЕГq_N=854311-.//../////2257@SО╫Ї╦]>60100..,,----,-,+++,-+*))())**+,-/137<@:84.,+*()'&&'(*.38<;:2,***.254446:<<:64458:?@<>EMUc}КwQ:;=BFEA===98;?FKRW\[TLNQMILPQVVY_efejЫ╢╖пйЯЗЖvgb                                                                                                                                                                                                                                                                                   УNKPlв№ё┴ЦЧм╧№     уеиКє                                                     ТЮмлзеггвин▓│║╫╒лud│╥╪╡ДrП╞┼бrvШ▒ЮТМЦиШgBCSВбЮОЕТ│├мpNI_п╩═йuprfbМ╝╕sA667:CYwим~S@94458EeЩ╕ВXKNVfxjgВЯЯzSB<8446BiЦЬ}Y@7435;HbВЕzdNA@DMZ\PJXeijZG<8644349<@UkiYMB983211125;GLRiЕЗЗwaPG>8300/01/00//030034678;BSИ╓ю╞cA9434431100110/.-,++-.,,*)(('))(*--+-/16::>:4.,'('''&&&*-1599:5,*+,15653137;<985458=@>;?L\sОАY=747;AFE@9:98:=@DIT[_[OMPOKMRTX[Z]bfhl}б╙э ы╢ЬГxhY┤                                                                                                                                                                                                                                                                                  ├ROOeЦёЁ╩ШФд└ё     ўжеР─                                                    ╪ФжкгЯвавазп▒╡╗┼╬▒wmЪ╞╬╫гlrо▐╟tiИаЯМЕ}ЯйЗU=FdШ▓жНГФ╜─ЛXFFx═╤┐О{r^Lnп├ЪO;358DZsЯ┐Э_>94325;RД╢бe^``bnmk~ЦЦАjZC<635J^ugUI?741//00/13=K]xТКДmTFA:820.-/0.,-..0110468:;<>GVВ╬х╚cOHCB???><:987431/.,-..-,*)*)))*)**+*+,-0248<:31-))(''&')*+/49:=71-,,3650/148A>:74259<9:AK`Бs]K<1359>CEE@<:88:;@CNW\ZTRVUIEOX[a_Y\emryбт√  ь┤Уym_R                                                                                                                                                                                                                                                                                  √NKK^Лшэ╪ЮУа╢ь      ▓бЦа                                                    Лео▒мзйзкк░│▓╝┘╘╦╢иб▒▀╪╜АoО┴╪╚rnУ░ЭrlФ╣аmLDN~░░ЭУСХ╛╜zNI\Ч┘╠║КuYK[Жн░ДH<67CZtС╛╕~N;7466:KmУЬЕype\VPKiЕХИsibRE:6::41//01/112334467=ADIOXdhВлппnh`XRLQJLOONLIFD@=961100/-,,+*****)*)))+,,.14689<5-,+**,***+.2:;?:2./16873014:<=;8428=>>EYeheXK>7348<=@BDA?<:;;@DIQZ_[QUXQGGS[_aa`aju|гф№   ╒ЭwofTС                                                                                                                                                                                                                                                                                  UNIW|═щфлХЭ│ц      ┐зЭЕ                                                   пЫп│░нкййкм░▒│╩▌╥┐╡вз╚т╨Сyн╠╤дi~инГ`}▒├П[FDbЭ╢аЙ}|╡─Ь^HTu┐╪═иy\IPmж┴кfB>;I]nДйигiC65467D`Жда}ucQFBBOnПСtVMT\RC>HaКжМcNKIDHL[uЦбuK?96538<60256651/268?A=877:@GSgjm]SMD8526:<=>ABA?=;8;@ELT]cYMPSPLMU[bfhefs}вч¤   Ємxnf[J                                                                                                                                                                                                                                                                                  VLIQm╕уф╕ЭЮо▐ў     ═нЭЗ                                                   Не╡░йждееин┤▓╣╧с╨├║н╕▌ц╦~gР╚╚└muЧйЦxsР╞╟ЕNEQzн╡ЛgnЩ├╣vLFaЯ╩╪╣АZIHUР┴╜NB?N`ftЧ┴╗ДO:4235=NxекДtZE:6:CTЗЮАUADLSZTNZЕйНlQFD@ABJkЧаyL>632336>MoНЙbA<400//18>Ncl]N>4100/---03>VdqЗАiYNA@><:7300.//36688@>?=;<9531/----,+)(')'''')+/38>;50-+*((('))-49@C=45688733338@E@;87@NgЖУaPMLI?7346;>>@CFC@;97;@ENV^aQPQNJJOW_eedepАв▌№    ┐Бqe\RА                                                                                                                                                                                                                                                                                 АNELhЯ╪ф┐ЫЦк╫ї     ╫▒ЭЛч                                                 ЬбккЮвгдедлп░п╚▀ткvЗе╟тъ╝gpй╘╔иpДОХЕkr╢▌┐lDI^Ш╗Эj[}мдЪgEJz╗╤╫гaGDIi╡╞вdHDWkif{▒╨╜^A63239BgЬ▓РiS?965:FqзФaA99DLV]oМеЬnXE;73:>[НжИZ@31./04:CcЙРoH:5100..7>QejYH=2.,+./../3@XoyИpTECA=998641//00269AGMUUV^[XRKEB<:790126;>@BCB@<989=AEP_cSQVTNDIRZada\lБЯ╨·    ╤Мwf]YF                                                                                                                                                                                                                                                                                 оVKJdЦ╨т┴ЪУж╨Ї     ц│гТ╖                                                щЬоокжиимол▓▒н║┌╓╚to{к██▐МuЖ╣╘╠ЛsЧ╖ЪsoШ╦╒е_IV~╢м~eiС┼╛З\M]Ц╓╙║wPDGYВ└┼ТXJWkfcnП┤║ЮQ>778:?_ЖЯЧuRA:657D`УвT=7;>LTeБЯаКZE<976>QvОНrI741//2:@^ВЛy]B32./047><86645469@KXQTSOLHA?<;;96455:MМ╩сЫ[@31/..,,-,-,,.-*+./..01258=A@AB<71,+*))*))'&%&(,05;>982,+**)*(),16;@<;<;:70/259>FJFDTnЕЕ_E;;BIIE63358;>@CDD@;78>?@EVcZQRVUIFNV]decexЦ┴Ё    ╥Рvg_]Ou                                                                                                                                                                                                                                                                                щOFHZГ╬▀┼ЫОд╟ы     Ї╕зШР                                                Чо│▓илйккн░┤│┤═▐╨иl[Д╝▐┌╩НrЯ╬╓╖rЖппГlБ▓╦╬СWPoЧХТn\s▓╤├hXWu│┌╚В[HCOlм═╕tX`jcX\wи╟┐vD:8:>D\БФгМZ?:665=T{бШlK@ADHMPjКбЩuI>7459IjКЦ~U:62102:D[И~kT<511159@VpkXI;1/,-,-.358FanieP>;:=<<;<=DLSX[TNF?:8654433300258MС╧шмbA32/.-,++,,,+*))+.++++,,,/279=BC<;83/.+,*+*)'&''+.48;985/,*'('&',.09>==;<>61125;CHOPe{~tU?87:DKG942259<;>EGC>:8:=?CLU^WPMQNIIP[bffiqЙ│╓Ў   ┴Зyj^]YI                                                                                                                                                                                                                                                                                 QJESr╝│╢ЭЛЫ╝р      ┐зЬД                                               ха┤╖лЮвдзкп╢╣╡║рр╩В]`Ш╬у╥йИЙ╣╫╬пбЪзЬvlУ┌╓╡rV_Е╢╗А]dТ┐╞п^ShЦ╔▌╔kLBE\Р╟═Шvohb[UZО╞─ЭT=9:?H]{Ь╣ЭhE83359EeЪн}VKMQOTHKpШЭАbL?625?VДЯДX?730016D_|ЖЖr_N<32249CYsgZH7.,-,,++-49K`gcWB//.4:410/110//01.-047KК╙ш╟kD43/-,-,,-,,,+)*,-,+)+***),-.36789=;84/-,,+*)''&(*+,067:83.+(&%'(*.27?@=;;99;CLUYUSTQHFMV`ggaj|Ы╕╬∙ ЁЯtuoe`\Q}                                                                                                                                                                                                                                                                                MFELcи▌╨еЗЧ▒█      ╚дбК                                               Ым┤▒игЯдк░╢╣╡п╠эф╖^Ziнчш╥}yв╧╪─ЫЛЯ╖Рeu╣ю╙Кe]tй┼╣dZw▓╥╧КP]Д╖█рбRB=Iqм╖├ХumcYODg▒╙╞tJ8;CO`rД╢╢~N831/5>WЖ╢Ъ`[`ZMMF?ZЖЪЗk`OE849HvгР^?6//.14>Y{ДНg\S<:669E\snZK9.+(('(((.6Ogd]O:,*')09>@ABDGP]kquhXJA750/--....---.-.136IЕ╤▄╫zG42/.,,,+++--+**,,,,,+*)()*+,../138?B>:6/.,+)&%&&&&')/68::4-*'&&(()-18>CCB@:50/5?JU`ljVEC?92047>E>61049::9;AEC98789:CNRPPSUPBGR\gnierЗл╖╚┤бЗkjhhc_YM                                                                                                                                                                                                                                                                                nKDG[О┌╥▒КЦл╘      ╧мгОт                                             ┘ж╡╖╢▒▓о┤╢╗├╗╕╛уц┘С[`К├шц├ro╡╨╒оУ░├ж}rЦ╤ь╧}fsЩ╛├е^aЧ╤╧┤fdxи╘╘┼nH?DWН╩╟╖Иpg[LCVЕ┼╥└`EAEQ`nsК╢йnA2256OjУдЛqifX=>;@N`klcH:4/-*)+./08NgaXJ9.)('+5@CEEJNZjtp|^JA933222000///00/013468J{╔ррГK84220/..-../-+,+--,--,+)++,,-,,-./5;==?;74/+)&&&&&%'),07::5.+)**))*,06?EFE@9335@P]eeaVIAA?93347@E>3.38:=<:<:H\kmeI51/-++,.17CXlcYG7/*(''-:DHKS[hxzm`QC<941210/..0/0/01124569638A[uvaRPLGCC:3226=>=<616::98;>CD?989<=@ISTPPQMIJOYbgmp|а╪  р│П|yqhZ[ZR                                                                                                                                                                                                                                                                               ╠KDBOv╒╠┴ЛЛв┴я     Є┤йЩН                                            ═е┤╡▒▒┤╢┤╢┐╚╚╛╣Ўё┘ЯjcГ╗█р╟Жnдф╓╜Чм┴╗~oТ▀ъцАЖНз┴╔▒n\Н╥ф╤КoГ░тц╠АSAB[О╟р╦Мs\G86?QЖдЗY@;;LYbj{ЫжlK>;;9?>GhУб|M?7>JL?:FUjwiG1,))'&'+-3DZkcZC1-+)'&(2@IO\fvВu]LA8732/.///0/0224445668:?EM\xк╟╕ЙiZTPOJGDB@??>:76431...,,,,++,+*****++,..5<<=>6.+'&''&%(,/147;962-,)''+.06CMKLB9467AIjЩеАRH>:558DmйЭfB947?RlЗЮмБVC=96443VИаЛ]>,,3BJQZdlsw{РП~plaXPNKKLHDEAFADDCB=:841/..++++***+)****+,/48;=6/,*)(('(+,-/07@=82.*(&'*-2:BJKGHP\~Ы|UCCFGHGC=61027;<:7647=<73Lu█х┘гplrXGHbЬ╤╛ВR>9=DOiОзЦgD>:759C]ИЩГX?967EPlСеТ_H92///4HpКМqE2*,0=MONnЙtN7+'$$%&))-@U^\Q>/)(()*,-2?Vo~z}gPG@:652/0//12134459=EOW^a^jhfc`evЕ{pgRE=:989:;:799=BEDF??<97530---,+-+)**+)(*+-/18?:61-***)+,,+-28>><7.+)'),059CNPMVyгДcNC?CGIHFB;2/258:<;7559<:54>HB859:9:>ISOKPTKDHT\iw~Ы╒¤   ё┤Бro^TU[Yo                                                                                                                                                                                                                                                                              WIA@TНФОКЛХм▐      ╥нзН▐                                          в╢╣╝╗╗╣┤╡╖├═╤╬╘∙ шаl{б┼яс╛}xп╓ч╚ЭУ▒╖М{дь№▀ОХФз┼╘║hdдрЁънЧг│уярОLIJl▓╙═╛vK?:;F]аєя╩Н}pXCEQy╜╧┬dI>?JSdЛЪвДP9:;88X|ВrlZHD>:721002455747;@HPX`Z[[UPLHGDIUk│у╖jC<6523111231358:=<;<===A;=950-+,,+**)*(())+-/499970**)++++*-07<=:3/,**+-05=GPYjТТiZNF@:AHKLKA51028;>C<558:8659Feа╬╘ЭWEFMV`yк┬бd>77879Caа╡ЗZHCBCJM^ЪПg`I7/-/3E}ЭВR6-+(*.?_}Х|V;-)%$#%&*0DUddO6*&%$#%)-5Jq╬╔─АE810131-,./.....13322469;:AGMOK;1/.16;?B;76::746:?C?;8978>;:854013459>BNZXXWOJB94002./-/15Fq╟¤фФL9./,-,*++-,-,,,,.*,+,/1469<=;;851-***))(&&()*-27:;<6-++++,+*,.4:?:41,+*-/1=Pesvh@:=AFD=:@KRNF8///39;>A;67<>756?FA:99879@IKJNRRMJQ\hyУ║ю¤   √ЯБth]NJRZT                                                                                                                                                                                                                                                                             ъGC=ASkx{}ЛЩ╟ю     Ї╚лХ}                                        ц╖┬╟╚╦┼╗╕─┼╠╓╘╙ф ¤▌Л{Т╖╤уэ╗ИГйщц═лк╕мyl▓фЄ▌бЧЦЬ═╓╗}lФ √у▒ЯЫЩ ї╘БYM\Н╔▀▄╣YC;:=Ky┼Ё¤╬П_H>:A[а╥╧к]W\\^doУ╧─АG;8<;?MkПЪЧc]NC<:>fРНiLGHJMF=>ZНЦvK2*(*-1BeЗН|O5+()'&(,2@QftQ7-($$%&(/9G`Дr`ULC>>=<:9977::BLU`j`UIA;:840/00/-.025Ck╝¤угS=32//-,-./---....-,,+,,.001579>:852.,**)('''&)+-258@92000.,,**,/9=:60,*-27BZotiQ@69BHF;9;BMSM@2./268;??<:;>:64:AE@:;?=;=EKLKQVVPP[esЛ▓▄¤    иyzj_SKKXWБ                                                                                                                                                                                                                                                                             EA7?Iaqw{ЕЫ┼ъ     ¤╨нЫВ¤                                       п└╔╩╞├└└┬╞┼╙┘╤╫№ ·кЙМб╝┌щтйyИ╚Ё▄╣┤║╗Ъiz╙ыъ├ЦПРн╨╥нy|├  █аЕИ╞ ї╝oYS{░ц·щЪMA9:?UТшЇьмmLB;BKz╟┘╤Еui]WZe{└╤╖b=:8=>KaЖиеx`L=669OЕШxP:5=;<<=<3320.-...---,-...,*+**+--..027<;:940.,*)'&&'&'(+.28@95420.,+)+.27<;50//5=UyЗs_NB>;=DIB77;;=<545:AEA8;=;<@EQRTUUQRXbnБЭ┼ў    ▓wxi`ZUQUTP                                                                                                                                                                                                                                                                             HC<>DZlsvГЪ┐х      ▀▓вЗ╩                                      Ї║╔╠╙╫█╔└──╞╘╪╙т  ЇЬ|Пл┼юы╓З{б▄я╫гОй▓НkД√ЇтаЗ~Ж╞╤╬ЛiФэ √╠~rгю юпe`nЪ╒ЄЎ╠uF=8:Fiи¤є╨БXD>=;;>BEOUezmaZH:6420///./.00/..149E`еЇъ╖X?644//.//////,,--,++*+*++*+*)*,169;<972,))''&&&&&'+.49:852/.+)(*+,5<=9759LoЕЖpNJDA>;=GF<55:@FJ:3//16E<535:DG;;<=<;OД╘ ёЩkJ=::Jr┴ыъ┴{dVMAK~║┐├~B3:CO\uл┬бYE3/-.8MЕкБL0,*,1>\{ТдЖJ821127HoЯзБ]G4.,+-17D^{|[<5.+*+*,9JYokP=<;<;<=;=<@DN_p~ЛybPA640/..--/,--,--..148CZбюу╡`E676521300-/0/..-.-,,,,*))))()+,/139=995/+)'(&&&%&&),3;>941/,)()(*-5=?<;E`ЕЦАV=BCC><>CD?955:BE>72/03;CFKH@>====:6:FLPUZ___aeoБЯ╔·■  ╟sxrh`\QFQWR                                                                                                                                                                                                                                                                            ЦG;>>Phuv~Т│╫      Ї┐кРx                                      ┐╤╘╥╒┘┘╫╓╓┘▄┘┘т№  зоие░╒їтвqМ╨▄хПГе░УzИ═ є├|k|пх╒│n╨  ╜}oБ╘° ░|i{Э╛ ¤чТZA?ALjиЁ щП[E>=ATЬ╥усЯkVKFF^Щ▌┌░dA:@PdoУм╡ФH5/./4FrзХ]=/,++4=_ЙЯШpL>5346?fЦЯЖgWH3,)).8>_x_G4/++,.3:D[sgN<409;<>@@ADGUhzВКmUH?731//../03111/021369;EbТ▐╥┤iLB@@@=;975544430./.../,-++++))*+-..0268<7/+,+))'((''*-3:<=93.*))))+06>FKPvЩЗ^B9>?@=:9BINSX`ogcdkvН╢ъ√  ╬skg^\]ZLJU[Э                                                                                                                                                                                                                                                                           ╩C>;;Hdtu{Сй═√     ¤╟мЧw                                     ╠╔╙╥╤█с▐╥╬╤╥┘╓╒ю  ∙ТУЩа│ч·╓Гuб╪╒┼БИмиК|гъ э╢wj─ц╫ЯwЪЎ  иtrЧёєЎЭywУ░╨  ╠zUDEIdР╟є ╓oN@;>Gm╣╫┌┬Г[KAFQ|╚я╨XEFZmoГ╢╟╣m94//1=]ЦкyO7..,27JnУвПiOB6249SИЮНvcQG2,(*4@^В{_G8-+'(,1;K^ubJ;5.08;=>BEHJ_Жyy\C;7430/---/.02243479=>CHQ\lЙ╝▓ХyeSLSLJIGJHEB@=<765311/,-,,-,*)++*+,--/146751-))''((')+.5;?;72-+*))*-18FW\ОЙdI;38@EGE?:BHB8246=IC:4125;BCCECAB?8457:CCA@=:=CQГ▀с╒ЯgJ@=Geксё╧qUUalcdЬ┬╞ФO50--6HoйкbA5002;?WГжЭocUE:35HiЪЯsG=?@E?;751/.//.-,+***+,++)+/157791+*(('()(+-16;983.**(()-4CaegeQ=6154235BIA6/018BECBB@AA<6258@DECA<:941.-00.-.0158:>HQZfm_jgb]YXlzvwpS=:76668876668<>AC@B@:765210/-+())**)(()*.48995/++())))*-16;972.+)(*,7Mgic[E62047BHHECFGF?82/3DVЕ┼Ў▀м\D;>C]г▀ьфБspaSOVw╝┐в]>4116N~ивoFC9236<^РЮБ[MEMVTJQzлС]<05CK949NpНМZ:,(&&(,3Hhv^D3*%&(+38@GMXmЙ{hYK?9852000411469?GMVa^^`WLHCA@BL\У┴╔~N963102330233224579::99?;:8510-++**+*)'(((+2:89730+*+*++./26:962.,*-4CVhsWPE93136ADEBDOLKF:2007:>@>5039=AAGPJC@>845:CGD@AA=@GMSY]luf\`iИ╥ю ╓ХpaYYYXVUVOPUY╧                                                                                                                                                                                                                                                                          БI:9AKUapДФй╒      Ї╖йЗu                                  Є╚▀фчцчт├╤╘╘█▀┌╨■  сЭЯМУ┤р▌╚nw│▐█пhЙ│ЭwВ╝ Ўм~]bЩрс┴ЗЖ╖° щУwД┴  ёиФЗЛЪэ  ▒rSVfАЦиє хИaEADQtм▐¤╪ЕOA8@Kx═яф╢Вo\HDM]Т├╕rH<354BhФзЛXE:2./3H}НГdC6MeДШe>0*'''-5IivdI6)%#$&)3:FNZn|kZMC<75522026996:AJV_Xa\QIC<:87679?Wи║├ХV652/-.//010/./.00212458;:==:62.+*))))'&'&(+057:95//-,,,-.015:<830.1:525@DBAIQLHE;126=GMGB@:=EKRV[ise[_hИ╬ю  ╗ЕpZX\[VRSJIS\_                                                                                                                                                                                                                                                                          ▓E<;BHQ^lСг╔      °┴лНv                                  ╔╤хцф▌ухрс▌ру▌╒╘   ╞инЮв╦т╘дfЛ╔█╤аУШпПwП╥ ёЫkXmошсмwЙ╤° ┐ЖsСф  ╬мЮУТк  яЛhVa~Шк▓■ ▄yTDBPjЩ╠яєйfG?;CWЧъ·▄д{YC=@Ptп╖ЕWB<88CUзЯeA4-+,0:UСЯtH4/06BWwФЪПY<0-4DNKNmЧЮmB5-(&)*3NjtiQ8+%#"$&*6@L\otbQG?963220/14:@BIPW_cYQIB;655641125;PЩ╦╪и[740-,,.///..,,,-.--,-/13359;::61-****)'%%&''.368:752/.-,--./4:=:977LqК}X??AB?8247<>GNSWdqfXXeЕ┴щ  ▄ЬtaTTWXWZRFIWY╨                                                                                                                                                                                                                                                                         ЁL?8=EQ_i|На┬ў     √╩оР|щ                                 ┬╪щчсхъц█▌╓╪р█╪▄  ¤╗пЪpЯуш╤zjг╙█╛ГwжйДwиў х{_Yz┬ё╓ЖЕгх√■Щ||ж∙  ╚╡Оp~╩ ■мrb`zТЛz═  ╧dMALbГ░яЇяЪY@=:If╜■¤┘Г]>87B^Л╝вnH<=?KZpЭм|C5*((*1B~нЖO1,),.=;FfАВoI47>BA<8458=@ACFIKLD41.27=DIB547@JLCEIIGC;417>GOPFA><@LSX__^ZZbБ╢ц  Ё╡ЗgZSSUSVXLENXs                                                                                                                                                                                                                                                                          EA:Osн┐О]HDGRbeГгЦd9.)')-<@HUW\bbYS_zЯ▀   тФk`VTTTSUOIMSR                                                                                                                                                                                                                                                                          PD8;EUft|Ма╝х      ▄▒ЩГЕ                                ╗╨яэъ▌▐суффчс█╒╨   ╧▓еЦИ║фу╝sУ╞╒├ФЙХбЙ{Уф  Т`Vlо┘ы▓з╡ю·щ▓mnИю  Ї╢Аt|│√ яЩВГЕ{gmйэ єПUR\qЙк╓ євmK@CLm░у¤чЛI>4:GcУ└└ydXUY_fnФдГL0,'),6SКЬЗT6.,-4:QВвРjaVKB?K`rИТОrK6/+-08GfvЗfC3-*&$%',4DXpjXJC;844667:>@Riz~~eNB965430000//001346;M{─╥├h=:4422110.././0..-,,,++))***+--0467741.+*****++.28<@=;92.-+++,.5AQ^yАa@702:CFEA;848AGD9?HJHD7/16;BGIB>::CJB;CKQNH?57;@ITPHB<E[y█Ёщпc?66@[Д░═╛qb_^]MIВиЧc;-*')/Ahе│nA2/02:IlУЯАQORTKACXrЫбxJ3.)(*3AZИЬgB4-*'&&).3@_xfXNC<973/27;BG_{Аw\B<53112110/../22468:ALx╞╧╣rI><=;:971/./111/0/.,,+)))())*,,,/0149971-+,.,*)++/27;<;92-+**,/5AafaXI80/07AHEB?;88;EI<9;BFG=4139BJNF@<9=FI>;EORLG759>GTVPI@=BTba_`^ZYbzмЄ   ╧Еm]RPUYVQIBGV[                                                                                                                                                                                                                                                                         жH68BObqzВЪ▒╙      ·╗ЮМo                               └╩цЄЇцщр░┘▀сфт╪═э  э╣лliе╘с╬ОК╖Є╪лoЙ▓йrА█■ў╠nP[Р╧╫▄╠┐╚  █qdjи  ёеЫ]^Иф  ╛ИАЖy\Sx№¤·нlaxРОК╡· тvPAAPoЯ№°рГT856Vл╞╫иi`^UJC_Я▓АO5**),4RН║ХQA:646>[ЖвО[;BPSPMMUНпМR1-'&&,8UБбzD4,)&&'(+4F_viVNGB>;77449BOoЦДyhQ<941///110//.//225:>BG]wп┬мuXRKJJHHGB=;9888641-+,,+++)(('*()++.05::63/-,+***)*-05<=<82-++,/4OuqbUE1/0268447CxаПa?67CMU]kЙйЬlC/+()+3Q}ХT7,'%%&*,0D_mgWMEB@<:986;BQnУВoZJ<600./02222132235;AJT\dnpУЪМwWZQKJJJGC>A?BC?B<730..,,,+)())()*+-,-398862/,+,+++*-059=<:51.06F`ЖОhMD80156;AEBCHE?;?IB97;CLO91017FOLJD=:=JE>H\cbdjg\[jН┐ы№■┌ХpbXUTYWVPFBIQY                                                                                                                                                                                                                                                                         D;:/)$%%&-3DbpeYKECB@;89:AIXrИs^PB;61000//3565689?ENY^efdcdgЖй▒ФRI?<::9999;:FC68@LQWTNF@@Ohhfefdae~Ы╛▌т┴Дpe\VOUYVSMEBKU╨                                                                                                                                                                                                                                                                        J=7:DSg{ВОб┤ч      ╓еЫz{                             л┴▀ф┌╙т▄╤хчччц▌ся   ╥лwdФ╥╓╧Юа╨чє╛бЮикЙг╚  ╪sYVД╟т▄└┐мц шДahи¤  йvpnСу ■╓бСoUJT}╞  ╤ЦРЙrYh┤є∙сsYRbАЭ╡э цСRA9=`мчЄс┤ОЕЕДЕПо┴├НS;645D]Й┤нp?4-*+4J{ЧОZ5,*+1:SsСйдvQ7,'(0DiНХvB.)%##%*0IajgZJ?A@?><98EO^s|dOE;71./-./0258:>@FMUX]YWQJDDFTxз┐│T?752214110156646:<==<Daijhgb__pВФКВДrje`[TSVTQOHBDLa                                                                                                                                                                                                                                                                        Y=:;AOfs~КЬл▌      шиЮ~k                            √п╟шх╠▀юь╥Ёящщу╪т·   ═Эkiиф╪╝Ч┴щЁЁнЕПпк▒╣ю  ╟a[]Ч┘ъ▐├╜лх√▄v\q╔  ЎПdgtж■ №▓о^JEZХч №╛ТМВcQs▐¤ЄлkYiГЩм╗∙ ╧xG>8Jh░¤¤фвЦЗЖЖНи┐┴├АJ;=BQcw▒╞ЫN7*)(-<^ЩпxB+(&(+8QzвнМfM8+*+7[ЗЯЗS-)%$#%'.Dgnk]H7:===<;HRVZYTPHC>;766>Eu╤╓╛TA41/////-//01/0-.147:?<6347=<<>@@>@BA6137=CA7/15DPLGFB@DNI;49ETXM<59AIJOSOD8CZeeedcaY`jqm`faba_ZSUWXWTLH\kxЖЩк╤      ∙паГo                            ╢┤╥ёэ╤чы╓═яшющф╪щ   ї╗Аfy╢у▌╛▓┘ЁЄцСКг╕жЫ╟я ∙ЫZ[lктх╓░╚ьы╖ql|є  ╫y]c|╝  Є╖┤mQFKjпЎ тмШЗdWZЕы эФfrЕЕГХь√ вgHEIYА╣¤■┌ОuwА~П╣╓╦пgKHKQ_gД╡└Н@0))+1H┤МW5*&'*.>?AHPavmUF@:41/023367:@IUbXXRIC=97643113Bt╤┘╩WC3/...///110100-+.012237799520/-+)+,++++-./5:;82-++,+**/5=DIYr|~O90-/7?A@;668A?:;=ABACF>5258@F?636;KMIFFDDGG@76GJKOPJ>AMdke^ad\Y^fijf`aac_STW]]YRC?ITЗ                                                                                                                                                                                                                                                                       ╖A=95/,-0:BA>:86;B>98=GDACA:41485;FJE@DIHDEB<77A[ZF869BHJPTOBACYjjc`b`\]``[_^_``^TSTY[XRKDELO                                                                                                                                                                                                                                                                       Є>88ELUj|aI<74330015:@BReqzu_L@742.0//./2326?e┼╓╧gI41/--./././/.,++,-,+,+-../4757630.,++)&''(+/5;<961-+--,/9DZh`P?73.,+/4:AB>966<=947BFFDB=72/9BFB<99AHG@?GKHKH@757NXJ916;DEIQTI>>RbebacbYX_gc]\[]bcUOQ[]ZVO@AIP╡                                                                                                                                                                                                                                                                       A<8:BOWhzНб▒ц      ╚лУ~x                          оп╘ё ■№Ё┘╥ъыяЄы┌┌√  ў└|]z│╒ф┼═т· фН}й╝╝└╓■ ёеlNdй╓▌╙Юxе °┴rvТ╤  ▀ЖlSfЯь  ├{iQKIaЬ ■ ─ИZIDYКу  ╨МЖ}rgЛ▐ ЎПdYYguД╛ь№уЖYWS^oжтЄ╩~[J@88\йнвu@,*).8[Тлx=1-,.18U|ЪМbIHIOXbkt~З`=-+(()0;TеБJ7+'*06:AL\p|fJ>3./010249BMeВ{xjTB:1111.,-.-../.2;b└╓╧yM100/..-+-./.---,+++))+++,,-0469852/+*)(('((,/5;>;62/-,-2;Tor_MA2/.-.045>DD>67:<859?EJJID:2058:Gt┼╞о]9-,-3L|дСY;20169CrЧМeF;6>GVjАХеnE3,)'*,5Q|ЦЗc@3,),4:CJZu|aNA83113545;CRnМ}m[J=8444222002100135@b╢╧╚ДO<6420///////0..,,,**)+++,+,,/26798:2.+++*)*+.27;?;852128MkxoYEE:3/..158>BFE?99B@97;CFHIG?5.29BHHA67BHEABHHIKH?24Dh▒┬мЛZEA?=>=97533222/--,+*,--,+,,+,./17:8751.-,,+,+,049=;7655BcuГpK=?@:400159<@ADE?8;A>96=BGJKD:317>DHI>6EDDMUN?AQbe_bjkb`tУzb][[_]RNQSVUVT@>GNz                                                                                                                                                                                                                                                                      Ю;77;EO]mФЯ╚ї     Є╛бМs╦                        ги╓їўєяэ┬╙юЄЇєєЄщ   ьпs[mи╫рсщё√  ╠Лй╝╟╬╬╩ №─oZ[Цф┘╛{vнш ╫ХЬ┘  ўнfUZwЎ  ┴nQLTdrар ·мuTGFQpя  хжqPM^Йч  еЫЖo]XlЮ °╚kXdУЩж╚т▐╣oF837L}╟у╔v?502:OзШZ90-+,5GnЮТ_:/+,4F^}ШЮwQ9/+'%+;_ЛЮАH0,+*-3==<:94/.....-,,+)+++*++-167984/.,+++,,069BB@=BMШ~U=76;>;74456:=?@DE@;<>;62:CHMJ=416:AEIF:9ELF::GRSQH<338BFB86;DGCDQRDAK]mhZfljeoООib^]\[OJMQTVUVE;@IM                                                                                                                                                                                                                                                                      ┌:44=EN[k|Рб└э     ¤╞аТwФ                        Р╕Ё ї╘фшщэёЎ·єЄюю   ╧Б`Yu┤тф╟ьЇ   йО▒┐─╟╬с Єо`Zcкю█░pz╗ё ─КЛпщ  ▀С\U^К   вfGJM^|╣° ЁПdNFIWЗ   ╚СYOJbЬ°  вНw^U]{╘ ёи^V^Ж╡╗чю╪Н[:31:`й╓э╡_:643-*'+8TНк{E.,)+2KjМжЧmRB4,('.K{гТY.*&&&+5DfЙБhRA9764456;M`kz\E>640.00./.-.028;CLVblds}ЖКАsdPIFCA@??=>?@D=<:86310--,++*)*))*+.27:<<840.,,,,-23=EHGJiбУa@8169N^ivlVF>8674113243358AHS^^bg_YW]pРвzeG>:977555789989??=>:741..,+)**)*,-0269>B=720022136@A=8437;>BFDCCFE:434>IMJB404@GJC9?LSVRJ9439AGD78>CDCHTNHFPbssiilor|ШЙrib]\VILQTWVSRE?CIT                                                                                                                                                                                                                                                                      9449AGUfyНг▒┘      ╒зЮБl                       ай╪■ √фщ┼╤ыяЁ°їЄш   ЎИ_WfЧ╩ц▀ьїЇ  ЎБй├╥╫╠╗ё ╒Ж]iМ╨я╫ЯГШщ°ЄЬЧз└   нrX`Б╣  ╥|XCFMdЦ▐  ▌}YKHSs╝  ▄РgLMPyч √─СoYLQv╢Ё ╚zRRZxЩ═ўЄ╝[C67;Xзъь├ЖcQHFHbЧлИP0,()+:bЬкlG3-+,1?kЯл~RV]XMD<:UТЪrJ5*&#'0?^ДЖy`J=85577;CTchq^I>;8521125889:?;<840.-+++++*+--06;?B<54574269>CN]kxАiO@92348EOє                                                                                                                                                                                                                                                                     R447HTTQVgzОЕZ9-&$#)975548A]м┼═oB840..,,,-.-----/147:9;;:74-,,+*)*,,,169>A=989755EFDGMPNMUmygckyЗТвдиО{k`\DAIRUUTTMC<@MЖ                                                                                                                                                                                                                                                                     Г4369AL\oБЦЮ┼      ъоеОu─                     чв═Ї   єш║хяїўўЄъы  ЇЦmOV}╢╪уфЁ№  ыХ{╖╤╫┌╬╨єєЮka│╓ь╢ЙО┴ °╛КЖЦ╥  █Иf^Б╢ё √╗cLAHTЛ║   Чr]QRjЭь ї░bPCM`л  ыШuMFG]Х·ЎяТiY_fnХу¤ёКB93:NТъ щзqP?65[к┼Ь\7)(),7`в╜ДA2-+,.?lЯоЖM06;HVcmwЙЭpA,)&%&/NvЦЬrI@<95457E\jljS>7322233359AK]poi\OD>96521/02>\ж╚┘{C820..-,--.,*+(*+,.-126;<:94/-+*+*+--/279>?><:745BGKXoАiQLKG=30/15:BGA95358999=DHHF=2/06AKJ?856?HLMJCAGNG68@MWXL:426AJO=:;@C?BLOMJQeqjgjwЖНд▄┘оxq_ZEAIORSVXTF<@JS                                                                                                                                                                                                                                                                     ║3239BN\l}РЯ╗∙     ∙╡иУzТ                     пзр√ №┌я▐═ыЄў°°ЇыЁ  ыКhRYЛ└▐уш╫─√ уЙ╝╤╠▒ЯшєъМlkН┴рхаАФ╠ Ї│ИВЦ╙  ├iiЧ╔ї Є▒]KDJqну  ЇБhdbd}╜№ яЬ]PLYz╟  сИ_JHLkй №═Гojh_b╕шЄ┼o?67Ck╗є фЖXD87Du──РM3*)+3NЗ╝░d>2.07@PУ╗аi>205?Nd}Ч▓ЕT8.))).61/0/--.01257;=BB?953>N_wКz]MILJC70./15;FMC85589:8FPRJL^{reduЗУЫ▐ч╨}s`XJDGMTVZYYLA@IS╩                                                                                                                                                                                                                                                                    ў2347ANZjzНЬпч      └иШp                     ЧмЎ  ¤єъюшЄЎ°∙·Їщ√  тДbN_Ь╦т▐▌▄╩¤■▀ВЧ┴╝░ЭдЇё╩ДkoУ═т▐ЪШ╒ ЁиЙБЬ▐ ■▒m}░▐№ єЫWLGZТ╝°  ╦s^]^nР╫  ╫ИVNL`Уц  ╠mWDHR~┼ ·жТyfUPv▐ЁыЪ`=;EECIRc~ПpeSD97320/0000/2;SО╬▄ЧJ:31000/...++,,++*))*,,,.389:8642.0.144438FIJLKJII>99AO]ZF9249AFJF@AHKB?LQPLSoyiboЗЮЫ▀ъ╫ДrcYOHDIRTVWVNFBDKk                                                                                                                                                                                                                                                                     1126>KVdxКЬг┌      ╔иЯЗo                    №г┤  √яччкюўЎ°·√Ўї   ┌x\Ogж╤хях╩─ №═zб└║йЪл№ё╡irЬ▐с╦СБас ъЮВГгц °мГyШ└▌  ╥ДRMNjн╨  ∙кeZW]wвЇ  ╜wQLOcжЁ ∙Ъ]NEI\Ц▐ °мМjOESГ№ї▐}U??Mp╢Ё■ }Q<57Hx╩▀┐k90-/8MС╚╜|H8413@aЫлл|M7,*,4LmЛЧИdI:2.-7VГМ{aE<8756=KZkweJ<73001:GYc`_pИОu\L>75410---///-08NД╞┌жO<5231/0//01--,)('')))))+-//4789:7457532108ACEDCCNY~ЯОV78?GPN>2.///5@EHGA869:549AHLLA60/17414=FJFABGIDBKPLGNdlhbjВЭм╤▐╒ЪwcZUGAGPQPVXSE:@IL                                                                                                                                                                                                                                                                     @135:GS`rЕЧЯ╧      ╨меНtЇ                   ├м╧  ў╥┌┘┤ ¤√√№√°ц   ╘jVMoп╓шЄфл╘ ·╢tй┴п}y┐ ябyhwиш▀╡ЙЕоЄ сЛ~Ж░· щвЗНи╛╪  ├vPOYН┴╨  єКaMQ\}н   ▓lLLRw┐¤ ЄДPI?Jf│ї ыйxTCEWЭ ∙╞eMBPaЙ╓№¤тoA53;[г╤цоX5206@k╝╧╗[@0-,1Gy─╤аjI7+))5T}ЭЩm]O>412FzНКpL777638G\jzhI8520.02EpЦИtАСИfMC:510/--+-..00.29M|┴╪▓T>62333100//..-,)))*)''&)++--27:=>;972/0/159>BDIORmЦЭo=4/6CJIB7/..06YЛЮxP;666:@GVrЖcJ<5311048TЙФККЙy`MD<75200/./1125315=R|л┤╝bF:879:65433100/-,*,.,+**+,.,+/7;A;868@KTO?50016>FE;36;CEGLOOMNA739J]`L9357=JQG>BQN>@KTTNOjxketСжЯ╕┐иyhc_YKCHTVXYVRH@@PW                                                                                                                                                                                                                                                                    Ю5447COZj|НХ╕щ     т╢иФ|                   в╛ї  ўшт╜▄№·Ўї°·ўь  ¤ЬXTUД╛▀хюф╢хЄ▀ИЖ└╣РtХ█ фПqkГ╛ь╘УАУ╞ш·иyxТ╠√ ┴Гu|Шмъ  ЬdQeО╗о┼  т{eV\jК─  ┼ДaSdГг   ╗jLIE\Нх  ╝tSB@RГх їкe`]adе· щ|[;=E_вцф─{P?:7Fm╖╘╞|<4,/5H}╚┬УcTK;-06UПжАKJILONKNzЯЕT;84547310106=951/.,,.-,+)+,,+,.279=B=7330115;AFJ\hkkdTD73359AF@420128?IJMLE<<=:549FOUH92/.18BIE:6:EFDFNRQQH815@QbQ>545;DKJFHOO?;DMNLLeojckВЙРЬиЭyeec]LDGRWY[ZVM>>LMъ                                                                                                                                                                                                                                                                   █5346ALXexКСп╫     ы╛жЧДc                  ▀п╬∙  Ўш▀╫ъ°їЄєЎ·чё  ёЕSNZФ┼ру▄╬║сщ─zФ├┤Дtвъ ▀ЗllН╞ю╥Л~Ч╨шёЙqvХ▀  ЬyotМи  ёЙe]wй┬ж╧  █vbdyЛи╬  ┤Вlcsв┼  їЩcJIIhе∙  УaG>B_жя ▀Шh^UVo╕  ▌iL=CT{╜°ъ│tL<:9KШ╤╫н[5/,1<_е╪├|SKH=04IvХМe;7;FOYlИаНbB2.279AXyЖpT@62331338DYjsvbQC:6451..012578>=??@=94200-++*+,,./2444;>=;963129AIRaifaWOJ<41137BC<620158EGJMNB9;:634=KQO@4.,,3JPMJ\psfasДХШКГ}khc_RFDOY^c`\R@;ELЖ                                                                                                                                                                                                                                                                    4338?MUatЗФз╠     Є╟жЦВc                  м╖▌   ∙ъ▌╢цЎўэёЇ° √  ьONcа╠с▐▐╪┼р▀░{Ь╖е{w░Ё ╤{kpЧ╤Ё╙А}Ъ┘ффЗkyЧф  ПqjlЙ╖ ¤═|_fХ╝мМф  ╒kkuГФ░р ·еБfkП║╔  ┘}_GJMs─  №ВR?9Co╢∙ ╘УdSJVz┘  ─WD6FeЬ█¤ъЯaB538d╗╟─ЮN0.,5H╠ф╜`TUQC2:bСзЗN.12=L_zазxN4-,059UyН}^E73/00.34CWgrs_KB930.0../045;AKT[arpmhalЙЮБiYC975799::::=??><::972.+,,+,.000026:>?<8624:DP\gsaURQOE62./4;>@=52114@EDFKJFA=7335BRSD60+.0;FMI=<IUVLFKF?>DNRPSmwtkgБ╣нМ}{ghfaXMGJYY^]]SD?=EK                                                                                                                                                                                                                                                                    :544;LWapДТг├      ╥иЦБj▌                 б├Є  ьчщ┘─хёычяЁї╫   ╞vLOnн╠╪╦пГ═т┌Ш{п└Ыu}┴э лtjuж╥ъ╩~д█т═ВrАдя■°ВploО┬ √╣tk~жпЗХц  ╗ikР╡з│ё Їаzjzб▓╚  ╥r\KO\Б▄  ╤oK=98;F\yЧmVNNPQN;1//36;?D?8220;EGHIJKFF?6249IRK;0.12:CKNE>;GKD@KXVTI:315FME9337CIOOPiupjlА╟╤┴Тyqkgc]PEGX[]^\WL:;FL▀                                                                                                                                                                                                                                                                   Y5248HXgvАОа║      рнЮКpв                °й╚№  щщщ╩╧тутчяюё╪  ·бmJPy╡╔╚▓ОИух╬ДВ╢┐МrД╬Є№Шqk~▒▄ъ│yГ▒▐▄╢Вm~▓ў√▐БolqЧ╨ ∙зВАХ▒имйь ■жkГ│мЦ╣№ шЛnkyТнс  ╚u]KWjЭ№ √ЭgGA@WОЎ  жtQEGd▓ё ьJD@\Ж╞Ў ╦eF95;Vдёц╣cC58:NЙ╧╙╓rQORSJDhкпuH5,-,8JnЭ▓М[F6/07DdЖТ|U=844337:DUakeP@;75125779=AHUaW_THA>;:984444410.//26;BFB;<=LnХСbPDAJRP>61/017@BD@8338>CEHIJDDA9415AGKC4./17@FLNB:CKICBMSSM@525701:CHD90/05;CIKF?AEGCAGQTSF8107BHA81.8DPXXLILF?:?NQQZvГxqД═ч■╥Оrtkhe[NFGX\_^^XH>=GO                                                                                                                                                                                                                                                                   ├6/25BYku~ИФищ     ў╛йЦzd                Ч╡┘  ·Ёъхт▄╘╦▐чъш╒ф  ╪~[GUС┐╞░ВjЫ°ц╣~Ъ└╛ojФрююfkМ├╪хПqК╠ц╙Т{qЛЄ √▒onuвч єЯЗй┐Ьbg║° юНЗ░нке╨■ ┤pbajЖпю їоsu{Ц▓█  фs[BAJw╞ ■│uU@AMА¤■°аiMVatды¤ yF96=TЛ█№█ВG;38;v▌Ё╫rM52;KYnа╟ЦM.+()+BwжзБp`WLB?CoдШhG=631338CSg}iO=4./-./36=RjvsXH<10/0---+07LД╤╓иd;../.,+,,+++)++,+,,,.058;71./158>CDHNWkЙШnB823:AEH?50/-39AHGA:739AA<237CNTVUPRM=6=GOMSkГ}kА─ы  лrnkhf_QBEV\^__\P<:GO█                                                                                                                                                                                                                                                                  №9426>PalxЖНб╘      ╚лЫ~k                Х╜щ  хьх┐етутчъыъ╒ь  ╨|VJXЭ╞─еvrн∙х╡Бе┬╢ijЮфъ╥wflХ╠╘╙ЕqН╪ш╙Н{uХЎ їв~on{мє ёвСл╡Р]l╔№ ┌Нм╜ПvНс  ФУЖrkГ╜√ ╪Тv||С│ч  ▌uVFFYС┘ ¤бjM?EZЧ  чЛlYZ_s╗ё√▄hF:=Kl▒▀Їг_=639RЬыє╥iA21:Onж└┐u@.)),4VМ│Ь]NQXTPQ_ОЭБW@:4015;BQlЕjN?83000146@WswЗsVE=6/--.---/27Hx╚╥┤l>0011.-,-,,-**++,+(*,-/17:=AB@<4-/039=@@HQ^yМxTA:424;>DB;42148BKJC>8573.17@IH:2006;BMNB=BIF8:IUYRD3448BIE857@MWXUMOPA8;CLz                                                                                                                                                                                                                                                                   9635Hi╕  ╙Аk\SLyс єгdGHO\Д╚чщИO743Bk╟ёя╢R>13>YН╚┼░c;.+*/ArмоrAABLYgpzЕСmH865359ATvПsSA6321/149E]xxiO@941-,-/../147Ep░░░qD75440/../0.+*,-++*+,-/1167MWZZRKND;;ANURbxВ~ку  юУtqlmk_LHMUY[]]ZC>?CE                                                                                                                                                                                                                                                                   H7138DQ\m}ГФ╡¤     ц░дЗqЧ              │ж╦■  ┘ф╥о╢▌╬▌щяЁэр  ¤┼hNIj┤╠║ЙqЙ╥╪┘иР┤╣в^s┬ы▐вwfxй╒╤░vtйяю╥}zБм  ъП|nsП┬№ чУ~ug[]|√  ╡Щ║Яdiвя¤∙НйлАg╒  ╞Оhdoz▒Ё  г_OPbЙ╚· ёПS?>M}╫  ╬ГfLBLАы ыКcXZ\hЬшы╟nD314GР╓·ыЕG;35Cfм▐╠ПM5.*,5[ЧнИU81:BQhДЯ│yS>52125;UyН~`D51121037H_psrZE>830.-,..//146A?>95337AJWhpnfXIE?73224
73-1;FLJFE<49?A94?KRPG9.-.49>MVUK8216016X▒х№▌s<83>NБ═э═hB5..0F{ШЦtI224=KjЩ╢Э[H;22035MwФКmP61./0/58HcrnhQ<741.,.--,-/048>DRnПФФt\SPKIFDDB>:60/.,-+,*-57520/159>CDB;638>NgxКyYRNNG80//37=9;EQUL?2-.08CJF8313:FJKGAAFE=:GRUO=2.28AIJ:/8ENQPSLKGB>AHVZ[mКУРЫу   └ДsosukXIES^``b^RB9523:[Ц│ЙZ>4357559GgЙХ~UB841137>:61/,-/5=A91..04;CFFC=77BUБЭЗaLKPOL>310268?FD:648DLNIJF><=@>8:@IRSG40037@GL>6227CHJKGDEC;:ALUTC3/06:69CP_frzПа╦     ·╝мЧЖ_             хЧ╗ь   Ўф└╡┘▄сцьЁЁэ°  ёбZQXТ─╩Юqw╢сёлФ▒╟╣ВdЩэ°╒kdЙ┼┘╦Г~Й─ьы▒vГаь  ▀З{oАдё  ┤Вpihlzа  Ў╔╣{WPzт ў╝└еrXkж  ╓Р}oow}ш  х^iЙЯ┤э  У`OJU~┬· ┼{MD@S~▄  ╬u]FIWТр сГUB>@>:64127DQNA840246=DEA<37>FIGGHC=;@C?79BKRO>3116;BFE;328AGHIFEGHA6:EOQJ:103:EOE77AJzЯПfG845335@Uie`SD:61011379>CE83:HRQH6//28?HE?868=HGKMGDFG97@KUR@2/07?FJ=9;FPPPUPMIC>BKRU[mСЯамЇ   и}qspriYDGV___\`P?8JYbmzДЧпю    ■╤мЧМkТ            Йж╨·  ╓¤ъ┬╔▄╬█ыяёЁю   ╠}UXm┤╧┬Дf~╙ыцЬЯ╖┐нumнЎЇ╬mgfЪ╘▐┬suЬ╘ц╙Ъv}┐№  ═АyrА╬   Ю{lefuС╠  Є╩ФTPTРў ∙╤▓cSTv┐  лЦЛzowЦ  ёгВq{НУ╜Ў■їuQMSoг∙·ЎП_EELp▒ё їЛRJCMs┬∙ ╣dPIGRy╔ ЄлXA26:m╦ютЬ[=85:Q}┴╝|F20/47cж╝ПUNNNPMHJhЭЭtO=24443=UjiaQ?5320///18?LZckbSNF<856C_▒╘║xQA10,.,-..0025689GJD2/..18DIGGM[nВСxS=6.6=BDA910.19CILI<9:?HLA<@CDBCE756AOVL92005;EOH:459@AHNNIFG:8:EU[H5004;CHB<:@LSS\XQMF:CKQUXfЗХЦзщ■  хЙsunnlaGES_]]^aVC8=GI                                                                                                                                                                                                                                                                  d?775:HЕ▀°┌ЕR>;:Ekо┐иd?3018OДкжzHCEJOUbtИХЙcE9477:EVglmPA84210/259CZruubQF?97225?YзлоyO?30//...././00269<<=AFKJ:40/17>EEHR`qДucRC9439>CC=62017@KOOB;9;BHE@BDEEDC<66;GSQ@51039BJMA637=ADKOOJH?87AOVM9215;CUI:7;EMMU\XTL>CKRUU^{ЧЬз╠¤   ЯzznmljNFN^d`ba^I:=FJє                                                                                                                                                                                                                                                                 Т;57:HZdjr}Сб▀     я▓ЬОp]           яШ▒╪   √Ё╚─тс╬эёЄїє¤   кkR_Б┼╥╖zmХїЄ╤п╢╚╔Ъo~┬·Ў╛iirотс╜q}╡┘х╞Н~К¤   пА~zКю   УxmjnАдя  ▀еkLP^и  ы╝NNWЛ╫ ∙оП}ncsн  ▐ЛxehkЕф ЁЬgVc|Ю╚ №лtXMVdyє  ╔oNKJgаю ¤ГdOELp░Є ╓F94?Vпё№╪oJ9:838:F\outT>84322126;JhДrtbNA:5510/1;SФ╤╝wM?31//.--..+,--.169:6029@FMA9:DOOPUSRM@BHOU\`nПен╕э   оГvronnVNOU\Z_b_L??BGС                                                                                                                                                                                                                                                                 ╠=779H_fjo|МЮ╙     ∙╝бСy`ў          ╕е║ч  ¤їы│┴чухяї∙∙ў    ЩcQcР╦╬пvrд Ї─Ч╡╧╟РlЛ╬·Ў╢hhy╖▄с╗oy┼сф┐ЙЖФ   ·вЙДБТї   ПymkpИ░Є №╔И^KRf│  свdNN[Цу їлЗvmj{║  ╓Еqa[fНя шЖ`j{ВЮ╤ ∙Ыk\Z_gВ  №дgLHQw╞·№┌{XGCRВ╪■ ╢l?77Dp╥√·┬\B77Adм┌└uH7358MС┴╡vE5239DYvЩиSA;75;DUwНАW;73101226;LkАznWE:532200/08OБ╦╜wJ@510/.,,.0,-,--267557GLIDB;637FPM@61/49CKI@647BEHNPMIC636AVYC6137=AGD=:AONPUVTNC>HLRZ]cЗЮн▒ф   ┼Мsrqqt^LITda_b`RCNtШУd@71/./126>RpzpdP<73///0-..07Mz┼┬xH>41//.--,,*+,-/:976337:6249Mivup_NOTSI73/05;BGA5203?JGCC@=?EKC=;BKNIG?746>KTI:2015>GKF917BECEKNKF<34=NXE80/5;;BnЩХsO:1/0/2479QlsjbVC:63./121114830157=CDA>98AQwШЛY@BKRVO=2/037>GG=5139GJGHE?:?HNMJC;65;GPN@4004>FKI@87>DEFKOLHB96:FUJ9003;?GKA;?GNINUVOIBHNRZ`btСЬд┤т  ¤п~zxu}nXJOac[af^J;>NWи                                                                                                                                                                                                                                                                 R:85658BRSB61/1OO=2/49?GHD??DIDIW^VMHFMQV[\jЙЩбп╫   ═Й}vmwv^LM_mcdc_P?:GXf                                                                                                                                                                                                                                                                 Б<67;J`dlrzУзх     ▌евТА_         ▀е└у   √Ё╦▒ы¤ю¤        ║x]YА┴═╛РtвЄ ЇнЭ╧▐└wq╟ъї╘Йdvз▄ь╨ЫДТ ¤шаДЬ┴   Ї░мп▒╒   уМ{ppБк   ╒Хsnivзф юДSJFPy╩∙ ╘ВYNTnпё °┤{b]e{┐  ╩Иtey┴· ╠Жk[RY╧ ■─vc^q╜  тuXHITЗ╤  дdI<896:IdhnryОЭ╘     ЁебЦЕcЄ        ╣│╞щ   ∙ё╜┬°          ■иwXZК╦═╗Иv░Ў Єйм▐с╜sv█ьє╚Дez╢рэ╔Р{в  чЪЗб╥   хвЯк╢ф   ┘ОztsИ╣   ╠Сrmk}│ъ ц{LIFUГ╙· ▒iOGOp▒Ї ъ░АdXfЕ╓  ╗rh\bБ╠¤ ╛В`KH^Лф Ї│nean{╒  █lRDI\Ьь ∙Л[A9m║▄уЪH.,,/1QНнЙPMHOU^frЩгzN83//.05C]tkXQLVqБcJ>4259?DIQZdoyБФz_PGECBABDEBDB>;76?QK:0//.09HNNNTq~АqV@624:AFHA5/./8EHHE<76:GOHBBEFIUQ?7;ARXTH=407BHJA6029@GLHB95>EGIPRRL=325CQE7114;AMPF=>HKFQ[YPLEMQUX[]|ТЮк┼    йuxlr|kRIWqfabbXG:@SW╒                                                                                                                                                                                                                                                                ё<75:DZelryЙЧ╞     °наЩЙj╢        в╜╬я    є║╫Ў я        √з{^cШ┘╧╣Г{├√ ям║╔╤╕t{ьЎя╛БnА╠ыя─КВ▒  уЧЙгу   ╤ХЦЯ▒ч   ╘РВyxО╝   ╞Мppt╧ў рwMJH[Х▐√ Л[JGPu╝ў ╓иh_jЩр  лke^gР▄  лqRINgгъ Їеk`W[Й▌  ┬eMEOf░Ў ёЛV@24>z┘ё╓АL646KУ▐ф─t>-,.5EmУШuC;=ISb|ЦмД[D942235D\jf_QHZТ│СoRE?;>HT_ib\^_bЖЬZD=9:::;;;<@FDBB>=NOA60.,08DNRW`qАs`QC5227;?CD;1.06AOMJD:6:@HEBBFHGPRD99N\fouВР╢¤     ╕гЪМoА        Щ─╒√    ї▓сї          °еsYeдх╥╢}~╧  Єл┬яш▓tБ√№ю╣~iАуёЇ╜ЕИ╔  ▐ЩСжя  ¤╗Е~Сйц   ╨ЩЙА|П┬   ├ЗopuГэ  рyMJF_Ях· ~RHGS╟° ┴ЬБl^rич №бgaZkЩс  П^MGMk▓ё ▀ШaPH^Ьу  к]NDPs┬· хtL<ABDEMQG:41016BMT^iriYPOI=5346;ABA;537=JMJHD=8:KI@LNB954HUQLOWVPCGOU\ahlЖЪе░╘№  ╠Аjiizw^NPYbafjcP<>KSY                                                                                                                                                                                                                                                                 B<759HQcovК░ш     ─жЭПs^        ж╚▐¤  Ї °╡чЇ ¤        їзnZmль╓│vВ▄  ч┬╙ёэнvЗ ¤ьл}rА∙№Ї╡ВТ▐  ▄СЖкю  Ўм|wБЮц   ╧гСДБУ╚   ╜ИsqyК   ╪{VGKeжэ√эpNGGV}╒¤ кЙ}yqr│ё ўЧfSWpзц∙ўvUFDMr╛ў ╩ВSGJbкъ ЄЙYKESЖ█■ б_B;?ZЮц тЖG95?a╗∙·─W<48G{╧■фБM9104Dz│▒wD3/19NoЧ╣аgL?8415G\oufI;9@_СзИqZS^urt_NJFAIUЛнРeLC@=<:866169<;JD6.18CHMOI>BSRMQWVQGENU^blhДФЫж┬∙  ╫Зlhfw|fMETdfjjdT@:EZ\                                                                                                                                                                                                                                                                 m?738CO_qv}О░▐     ╤мЯТz_       Є▓╓щ■    ∙╡цЇ          єгn]w╖є┘пxМф  ┘д▌їьйyС  ыа{oЖ ■ї░Эщ  ┌ТМкї  явzlyСх   ╬еШНЙЩ╥   ╗Иtt|Ч   ╘ВaZSq╕їў┘iKEG[Гс ■Щp`pА└√ єНi_Ut│юЄ╙mMEESБ╠· ╜qLGJe░Є юВTIAXЧц  МQ=:Cg▓ї ╔tB:8Gz█  аH<5>Uдё сgF7349Yб├жh>0/0;UВ┤║ГdSA855@[kypP763EHJGA:7359KkСЫvVIILNN:52128>GG=667AOMJJG<;@B>:Tас щuG<;Hr╔ў к^E<9?Gr╝┼ШU:026Drм╝Тf[\NA>APxОxT?6449ER\actЙЙ{m_NNQV`c`|ВЖИx\QKLLKJMINKLE>689>DFIKD<96AVwбгcG@DKPUD93104;FKE;79=LMJKK@:?FD>9JhssyСз╚     Ё╢вЩГkк      ║┌Ў   №ь ў┴ы°          ыЦsnЫ▐ свyм¤  ├йц¤ЇЯБг  чЧ{vУ  ўиАмЎ  ╒ММ▒·  шХ}bsЧу   ╝ЭгЭШйр   нЗuyДк   ╞ДnmkОя ¤╗hONTw╢  ьМeQZnЙ√  тzabeЕ╨єцФiMKQhЬшїыС^DAJsъ  ╡{VDFk└Ї√╤gD<EKF;8AHLPJ=136CV^Q:4.29AJN>54:BGJLD@@BA:?\d\M=100?KG913ZЯ  ёЖZBCNsх∙¤╖nKONf╡ь√цlJ=79Ky─с╛k:1.3Cq║╧мVCDIPUdАЪУlJ712127=GXrЗzmkhgpwkbVJCDIdе│ГRA:98778:;>CINOJC?;52117DLNH@62ALIDDGJEFIG?9:CJOND403=N]XA6017=FLE637@FIPK?FNNHD?9?>?FX_WE40.9JOD647DLOSSFCGDBFVTRLEGRV^ckВРДv{ОЗ{o`XZUl}sXDTfao{r\D6>R_▓                                                                                                                                                                                                                                                                [<879ASbmuАЧп·     ╘икЩВg      ╞    ■э№√мшў           уЖr}═■ щУ{╬   о┐ў сФР╟  рУВн  євИ║■  ╬ГД│№  ▄КwhvРт  ¤б}ГНЭ╗ї  тЬЙz~Щ┘  ∙▒Еpt│   зn_`М╠√  ╞Бg[qЮ═  ўоЕb^iШї ▄xbV^kЗ╕  │rSACRЗ ■╓{XA?IПЄ сsR;==:8655;EECLJDBB@;@S]WI7/07GSL935BKOQSMHMJDDRj[NGIPTYahzЗomГУЗm[W_^kto[EOffnxubJ<>O]x                                                                                                                                                                                                                                                                Д<978>P_kr{Фйш     ьокЭИn▌    ь▄    №шїї╪Ї·           фДtГ╫  щО|╥  Ўо╧  ╪ПШ╙  █СБЕ╡  ЁЯМ║  ■╦ГЖ╕№  █КxfyУф  √Щ|v~Ф║Ў  ╪ЩЙyВЯч  їлВpwЖ┼   еvcqл▐   ╕}geР─№  яЮГnpqж√ ▄АcRZbЛ╠  йlOBEUХ ¤╚oNMЗ╫ ·ЦpSLUnк  ═qZFLWЪї хtS857NЧхш┬lA338Wм┬╙мX40-9O}║┬Ы_I:34571248AKNB:68BEGPOB=BD>:JZ\O=648EQN<64?KPU^SBFJIHNf`RCDNQVelwВАjhmnndUPXZbtw`HKeikpqfO9716EE=6327FQNHGA=@FJD>AHJLOQ?05:IVXF9457?GLD4/06=JXM>67CA>DWaTB758COQE73>IPTYXKLMHCIadVHFKPR_jr~Бj[_stcRQXY[nweKD`houwiU<9FZ]                                                                                                                                                                                                                                                                Ў>:66;FXfowИЪ╤     ■┐зЯЛyz    ╔°    ясщъв№            ╥|oТщ  ▀Е|ц  є╒·  ╤КЬш  ╙КК└  фЯЫ└  ■╚ГЖ╕   ╫Иzi~Ъч  °Ф{ci}▓°  ╒гХЕНдь  шШЕr|П▐  №гИtЛ╚ы   иwjМ╪¤   █КtkqГ╩  █yj`ckзЇ №ЧeK@Gd╢ ёоS>5?Z╢√√╡NB;D\йє фXLMZИф їм_J@Hk╧  ╟P>56?r╥¤эДR717MЮ·ё╟a>+,-Dо┬╞{_SE<88Kt}АБДЕjM=:7I\oДПМЙБ|ri`XSOMMLNQRW^XUUTRH;;JMHKNG617FSTN=2028DOI6204HOM81;FNUXYGIOMDD_iYFAJRVZbjtwm]TjsfTOTZYjzmLB\d_gukW<9BOU╛                                                                                                                                                                                                                                                                =;66P`\K@65;IUR:6;DNTX[HJONGA\d[LBFRUW^gt}taVgtjXQRUWh}wTAVfjlspZ@9?RaГ                                                                                                                                                                                                                                                                M=74:GUgrxГР┬№     ▐│гПДg    ╘     єыц╒б√            ╡zs╡   ╥ВАю  фм   ├ИЯь ■╔Ж~М╧  █ЛК└  №├ДЙ┐   ╙Еwj{Ъх  ЇУ~_dt░°  ═гЭЦб▓я  рРГq{Хр  ЄЩМvЕвч  ¤бАО├ъ    ▀ЪвЧДЧц  ┘xkcmГ╞№ єЮt\WeЕу ЁШL=6Gu╒№ЇРKEBNs╞ў ▓gPHNm▒Ё ╫ЙRFBVЭ▀ ЁC94?e║Є ▀fB46J▌ ыЭK5-5B|┘▀╬s`NOTZ^fБЭЛ}{|`GCBHZoИеШЗvcTROOMLIEGDDEFFGGADGMQUOLE@B::JZYOB45:ERX?58BKNMQJJPQF9HИ╒¤фzIBBQА╙√ Ц]LIRv╝Є ╛uKCD`▓ш ╬g=77Hz╫¤ бW;49Yжъ ╩vA40:\очш─]ECIRcАЮ┤Х{}ЙZC>@J\nКиФ~l_UQOMJIJIGGGEEEEHJD?ADFLRPOLKVqКrgYJ@ADPXK:42/04@ILI<89EQPFGFDEMQA38AJMPTN857DTWN9204:ERJ:215BKTTC8;AFDHQK>AH;7CZgUD648BLRE:8@KOQXRILRLDKihVFBJNL\fr|dZalnbOOUWbt|fIL`klmqgJ<;H\a                                                                                                                                                                                                                                                                кE;06BOapx}Р╣щ     ы┼иЧЛrг  їЁ     ·ь▀░и°ї           еuz█   ├~Иё  ╙к   ╖Жеэ °╜А|П▌  ╙ГК┬  ў╣АП╬   ╧ДshuЧу  ёЛ|`ct│° ■▓ЬФХи┐°  ▐Н~nzЦс  ыСГtЦ▀  ·зВ╖╫╓▀   °╬╝m░Є  ┼snnvЧ▀  ыбД{vД│Ё фЗH=8QЭ┘№█uGB>QП╪· ЗVJFR╟Ї │iF@Ce┼ё ╖_889QУф  ИI95?k╗є │b821Bz╘ўЇгG?7AOnб╞╛ИЕНГ_?;6H`xНЭЛxgYRRNJHJJJIGHHIHHHGFBA@ADHLQRRZz╡Тe\\SD7=FFFA830,3>IRRE98AIKFFIGFHMH75?KSV[S<64PPA638@LQVF::B;;AQcZG756?NZO98?GJLXZRRRJ=Cfl[JEEJI\jt|iU[ovgNOZ]`mxnME\ffkynNA:>ELOW^PMQK>;`m`OFIQL_osvwjTVlymOOUZ^rИuQEWcafysYD:BVdз                                                                                                                                                                                                                                                                IC6:CIKE;402:DMNIA<:BNN@?CGKPUC6:DMV]^B857@LNB63239EVO<46:HQTQE89ADBOXM>CD>:DZdO;75;I\bA<<[eaWMKNMZp{{{kTRgwjPPVYZmЖ|XETchjw{aH:?WvД                                                                                                                                                                                                                                                                LF8;=EVivzЙж╒      ш│жЧЕs  ▄       Ї▐а╦╟╔№          УЖЗя  ·ЧЙШї єнд  ёвДиё ў│vwЧщ ■╚М╨  °пДФ┘   ╬ЕshrЛ▌  ёПyfiz╕ў №д}prМ╗·  ▌ЪМ}Ебч  фКymЭч  євВ}ЗП└¤  ч╡Дguъ   е`[Ymиї  ═Гtq}Я·  ╞zJFIi╘ЄўлcDFFcйчэ╜fRKKbЮёї╚~ZFHXО  ╓vO9:Byт їЯZ@6<`п √оcD31?sыЁхЕR745Cq╜─╝Г|АlSHLaХ┤░Ы]NOORX]djjljgfed_YZ]\[YWUPNJJGGFLW]^ZRPTVTNC:9AKND5106DONHD?:@KKA>?DHMRN:8658DZjJ98@ILKVVRRPA;Slk[MKNOUn|xvkQN^oiRLQ[\hБД]OS]\`wВjJ>?Rsh                                                                                                                                                                                                                                                                cB998EVentВЮ╠      Ї║зЫН|╓ ╫       ё▐а╫я╒∙          СwЙЄ  чПuФЎ Ёдв  ыЪВйЎ ї│z~Эш ¤─~О╘  ўпДТ╫   ╠ГpeoГ╘  ЁР{dj{╡° √а{jjЗ╕√  ▄ЭПБОйщ  тЗyj}Ъщ  юа~tzЙ╣■  фб{dy   №ЧZTLk░√  ╣tebxн   ├vLJOqя№ўЯbCEFm╡эъеeNKMgй√ў░xXHL]Ь  ╩eI59CМЎ ё|R<:?o╠ ·ПX>59IТ¤°╦fH247QУ╔╩аИrg^ZUYЙ┬┬нКeLMKQW^ekkmjgedeb\[]]``]`^ZWNHIGJKOUZXLPUXURH88>FNPB3254=DEMSQJGG?8>QdXA835BT\P>8?JMN\[QMLGDMjqaNCKKSm}vnMHTaaVPNUZf}МfGN_hiu|qP;;Oqn                                                                                                                                                                                                                                                                СF;8:FUdns~Ы└¤     ∙└кЯТДн ▄       є▐брь═Ё          ОzСї  рЙvЪ· эЭЯ  цЦАп· ї▓u{гы ·┴{М╘  ЎоЕТ╘   ╠БnfkА╦  ЁТ}gjz▓° ·в~hiВ┤·  ╫ЫСЗШкщ  тЛzm}Ыэ  щЭyrvЙ╛   ╓Цwo{   ўНYSMl┤¤  жiW[w░   ╜wPLUz√ юУdFFMu═·ЁЯfTORp░ ∙зxYJOeк  ├_D57KЯ■ цlO::IЗр їДW>8AYн ў┴_C67?f░╬╛wZX_ekyФ╢┐╜ХkSPSX\afihgfbcaaa^\]]^_^\`dcb_YQMLNNNTVSUXYUROE<76;?J`]F945=OdXA8=GMPX\WROH?GfreQKPPRk}upPGQeqaRLX`fq~nLLV[`uЕwUB>Lit▌                                                                                                                                                                                                                                                               ╔B?::CQ`ls{Спш      ╦лвЦЛ| ч       Є▐в▌шь          ¤К}Э√  ┌ЕwЭ· ыШа  таР░№ Їнqzжь ∙╝yЛ╒  ЄкЕР╤   ╠Аnej}┼  ёС{chx▒ў ∙е{dd}▓∙  ╤ФМГЦлъ  сМzn~аЁ  щЧwmsМ├■ ¤─Дun~   ЇЛWSMl╝   Ъ_TXu│   ║xSP[Р  тИbHLSЛю єЧfRQXГ╠ √ЮtYNUm┐ №╢\@4:Rп  ▀bI8;Rбё хxM97Fm╤ юзU@6@LVQ?958CQMGFC@DQP>:DMQSVE>8;GY^]G8239FPG921/4BKLB75:JQXYL9;DECMZTKIE<:F[cL=42:J_^G::GOOW]SLLIBC^riRDMOQh{zqoRLQdvjRMW`frЙuOKYdfs|\B8A\д╬─ИJ@CPg~Ы╕╩╢Ж`QRZdgfb``b_bdc`^]]Y[ZXX\]^^_bbfh_WRNMORU\_^WDEHIECHXUL>79ANQJHHDDLSA:>ISVWK>76ASedP;226>LJ=6503;CQSWQB53=OcjW@322AB>EW_KIKA9?SaXF605CWkS>9DOLMOSROK;7K^aTFJNL[oxqnZPK]wvYMT\ajДБWKT^`hНЛlINЫ╦█аaA@CQpЭ╕╦╤Уn\V]fkifb__a`][YXWQJKHHLNU\]a`cegfiicZUQSSVY^ZJCCLNKLTXVQB:34EPX`^G:>CCIT[QMND:>PoeN925CT`VC:ANONbaTNN<;EZbZSMLJTnvo^NHWu}_TTZ^iГК_LR^beНТuN=BMh[                                                                                                                                                                                                                                                                zE=9>EUgqw|Ф│с     ї╣йЪЯ{Ия     ї№є╪и╓т┬я        ■▌ВЕ┌  №╩ytл  фОе  ┌ЩМ░· ЁбltУс юкzГ╔  ▀Э{Ж╗  ■╩k]doи№ ЁЦtefsйь ЄжzgfxкЁ ∙╝wki|Юц  рТАvЖвя  хЛrhoЗ─  ў▒wmnБ   єМljiБ╓   Кd[\z╣   жpU]Вт  ╘zaKZt╓  єВiVbД╬¤ ёРhURkля шИH=8MО▐ я~@<6IА┘· wC63>o╩фыНT?=B^╝╔┴С\@BE]Й╝фЁ╟ze\[ejhecdc`_XQRRSSQOHDFGJKPUZ]_begkkhcYPRTUXYXOCNloU>46BQhaH;?LNM[_ZSQB8BYg`SNMMQgБyl_LESqДfOQ\ckАОdVW\^cЙЪБU=>Jf`¤                                                                                                                                                                                                                                                               йC@22Aw╬▐├jG<=Eo▐х█АW@ALoй┌Ё¤│rb_ejjhgdca[RJIGKPTUTKFDDEGHMSVX\aeiihgaWQRUX]\TC>>GOSY_[YN@:?QPDFONJKLB<NhhM=@JPNbi[NNH>B[nhTGHKOdБj]H?NhxmSP\foБФoUR]b_ЕХЙ^>:Gcd╠                                                                                                                                                                                                                                                               шFB:@GWqДБ}КЫ╕є    ў╦иЯеИТЇ     є№Ї╨▓╫┘┴э        ·╙Гф  °╚vv▓  уЛи  ╘ТК░ї чХbhЗ┘¤фЭr~║√ уЭvЗп∙ ■╩~k_bjЬє ыЫ{cdnах юЬ|jhvЯш ў╣oc^lПр  ▀ЛАyЕеъ  ▐ОtlpК╝¤ ЎкnknГ   ЁЙkigГъ   МohkИ└  ∙аzfnЩу  ╧xgUc~┌  щyfZpву  цЗ_MSВ▌  ╧zF@A`╖э █h:77Vбц√┌b813DА╞вuW?7=KЗюэ╠oP>EUЕ╝ё¤ Рdadhjhijfd\PGEEFFKPTSLHDCFGFEHMRYaehikjf]XSTX[^ZN<CNX]][YTND@HQIEGJGCTSA6?M]a[F758Fbm`H735;U_P:42569HT_hhJ?BFEGSbMOOG>BaqiM:69IgrVA>FRR\gdXRI>@[xtXNLLJ[x~n^OFLfНГ]YdwМШвИbS\eeГЬСgIADZi}                                                                                                                                                                                                                                                                QJ:?DRmМУПСУЪ┴■    хлежШЮ°       Ў─╛█╠╡█¤       ї╞БРэ  ў└usп  тПв ■╙ФЙзъ сТejА╬ё▄ЧoБ│э ▀ЪuГйю ■╠~i]bfО╩яфд~hglЧ█ ьв}jiwЯц є╗rc\gГ╤  ▀vm{Яу  ╙ОwpuН╕ї єиqjk~ю  фЖifg▄   ЙngiЗ╜  ЁЧxitЯх  ╧|i_hЖ┌  уzpg|жф  ▌zZP_Щ°  └sKGPuЄ  ┤[<<>n╙ √┤Z948UЯ╓╘vP?:B]п¤чп^ICOsпЁ ∙мn\chkjhihbTJGDDFFIOYb_ZULGHEDEEFLPR[dedfgh_SSW[^_]LDAHVa`[WWSG8BZOBBLTPWSC:=G_gbJ:44A^jfQ;47:P`V?4319K^^F:7DT`jnR;?ILINUMNRK@AX}sR?::Iep[FACMJXrr]UM>=Xus]QLJGTvКq_PCGfФМe^hЕо╛▓ЪnW[hg}▓аoPGFYjb                                                                                                                                                                                                                                                                nL;;BNcГаЩФТЦиш    є▒йпйз·     є є╛┬▄╞о╒ў       є─ГЩЁ  Ў╛qoл  ▀КЮ ¤╨Йzвр■█П_c~╟ч╧Хlнуў╤Тp|вы ■╠~j_abГ╗чрк{gakУ╘ ьж|kjwЫф Є╜vg`fБ╔  █yiftЫ▀  ╧МtpvЛ│ю Ёдoim|ф  уДa]b~╨   ЖmegГ║  ъТujuЮх  ╬{i_jЙ┘  р{ngАлф  ╥tZScв   ╣qNKVЕ   бV9=Czу ¤гW95;a│Ё╘xN=:Ej┐ чЪSEDTЖ├№ єФiefhigghbYMEEDFFIMU]bc`_VKGFGEA@FJLO^bccceaWQUZ^aaWHADQcf_ROQL:43;VqqX>649IROD5106E[cN;6BSaieZ=>EGEL^SONJCCO{x[B99F^m_I;BURXgmbUR?=QmtbJGMIQltaSJLfЦХmakб╚╠├иzablmx│зyTEIYbV                                                                                                                                                                                                                                                                ЩF;=CL]zЭвЬМКЧ─■    ║ннил√       э║┬┌╜л╬Ї       ё┴ДЯЎ  ї╜rlк  ▀ЕЮ ∙╩ЙДа┘ї╓Нaex╞щ╒Тi|и╪Ё╟КlvЦы ■╦}eY\^z░р█░zcckР╧ ьд}jisУ▀ я╜yg_f|─  █wg[kЦ╘№ ╠ИxtyК▒ш яжnfez┌· уА\]^}╞·  ДmffА╢  тПrguЫш  ╩xeZjМ┘  ▌{mdyкх  ╟lWRfи   ╕uSN[Ъ  ЄРS6>HШ√  ПU87Bu╥¤╓zN<;Kv┘ тДICC_Щ▀  э~fhhjigfbYNECEEFCIR\`cfc`\UKEFGFEEGHMX]addgc[VUX^ccaTA>MdhdVOQO<;QTE>IXTNTJ=:?YmnXA4-8Oqv`E346DcgK5405AXhW>6@ScoБ`>>HMHGVVTSNB;PzВcF:7BWdaO=?SOXqyhTS@=L]hlLCEDPoС|dVKLiЦЫtlpЬ╬у╓│Дa^kl{╢░ДcUNbn`                                                                                                                                                                                                                                                                ╥L@;@IXqЧагПЙП▒я    ┐н▓▒п№      ■щ╢╦█╜и╠ё       я┐Вгў  ї╗rkн¤ ▌ИЮ Ї╞АvЬ┘ё╥Лadw├р╦Рgvд╙ъ├ИjrН╘ ¤╠dZ[\tд┌╫╡{e`gК╚№ъеkgpО╥ ы╗ziaf{╛° ╪xf\hН╚ї ╚ДwsxЙмх ыкskky╘ї ▌]\]{└є №Аjdd|п ■▌ОriqЦх ■╚yd]jЙ╪  ▌ze`oбс  ║mWPdж   ┤qOM_н  хГT<>Nп  ·ЗS>?NСу ▀xK=?UН▀ ═xGBGl▒х  хthnmmlkhdRIEDEGIIMX_ddgc`]ZUMGGEEEFIMR[`bdghb]WX\cfc\H>I^rkXQTUG9@GThЙдвНЗОд▌    ╧йол░¤      √ш╡╤┘╖е╦э№      э┐Чк°  Ї╣qmз∙ ╫ЗХ ю┴Б}Х╫я╙К`bu╜у╙ПdpЩ╨ф─ДelГ├ №╠АeWZYoЬ╣┐╣zcaeЖ┴їчжАjenЙ╦¤ц╣{kbix╖є·╫wfXcД╛ё ╩БolqАйс щмwpk~╬Ё ┌Б][[x╛э ∙hcaxйў°┘НodmРф ■─zd[jЖ┘  ▐xdYkШ▄¤ пnVL`б   │mNO`п  ┘yR6?V╕  Ї|S=C]╡ч ▌sK=@_дщ ╛pFEJx└э  ╙mrrqqplg\MHGGFEHJR]acc_]]\[YVOHFHHHEINR^effghbXUZafohOAFXnpaONWRIKQKEGRVPSOD8:NmwjQ916HlГwQ542=ZjY=747@UkgF8HPMMlo^XSH>NБТzXB9BTqxbGARUWpГy`[JDQtЧЗZILMVoПКmc]_rКЖГyvЛ╕╠╚╕Оwqs~╖╣Уmdypwf┬                                                                                                                                                                                                                                                                DC:;EP^|ЫЮМБПЮ╦    ▌м░н┤       ·с░╥╫▒в╟уЎ      ь╣~й∙  є╖rgЯїў╬ГО№х╗xrС╒ъ╥ИZ\o╖╓╦О`iН═▐├Еdhzп °╠Аg[\\lШ╨╧║yb]cБ╣ЁхиДmekГ┴ёр╢{mekuоэё╒xeZ`{╖ю ╠{c`hyЮ▐¤чнxqpД╟э █А\YYv║ч∙Ў|gdcuжЁє╫КncjК█ √┴xc]iБ╫  ▄ubZfС╘ї зgRI\б   оkHIb╕  ╙sO:AX┬  ЁtRBJi╚Ў рoI>Ek╛Ї оfEERЕ╬°  вflpponldTJFFFEGGOZ_b`]ZZ]\]^[WLIIJJEBHMU`efegf\SS[cjoYC@QkrgXRYYHGVREALb\ZWI97Gm{pV=47Cf}xY944:Uj_B438?QloL>?NaluqG?FQSQtoc[WN?J}ЧБ_H?DUsБkLJSXVqКДiaRIW|ЬУc[[^bsХСwqqqzР┤Йvo{ФЪенР|olwЕ╡╕Оj[Z`baв                                                                                                                                                                                                                                                                VE@=AJVqУЦЕЛЩ╡    эмоо╢       °┌п╓╙лд┼▌Є¤  ■  ъ╣Ч░·  є│paЮЁє╦Мїр║{wО╘ч╤ЖY[k▓▌╬Н_fБ┴┌┬ЕbfrЭ·Ї═БgXYUeСм╕╕xa_b{▓ъфйГkdk{╢ъ█┤{kaipзцш╙zjZaxпщ ╤v]VZnС╫∙тнxokГ└ч¤▌Е^\Xr╡тЇЇБe_aqбчэ╥ЛlbiБ╘ Ў╛vbXd|╙  ╪uaWaЗ╩щ√йaME[ж   жcDJb╝  ╬mL6AX─  ъlQCNt╨№ сjJ@J~╤№ жbCJ[Фр  √О`otrmkhaQFEDDGHNX^bb^ZVUVXZ]]YPMGFGBFFLQXaefii`VTWciq`MEGe{pRIWaQEOQJCE^[[]O;6Fmvq]A17=]ДИb;649QifH;57>PktZ<B_╛  ╦iK7?Y─■ хhQCP{╤¤ ╫hG@PХф  Щ^ENfЫї  ЁАgrrqomi\OHGDCDJN[aa]XTPMMNSWZ]XTOMKFHHNPW`echkdYWXdhrkVCC^wu[KSd[R[ZK@DX^_`UBLcvЗ^LLWdmw|yoie]Z|ЬСs_[_oАЕ~smjluВТХwmjmiжбsc]_i{ХЯzkeflВЫМmcekr|ОГfPMS[Э╝ЭnREH_cb                                                                                                                                                                                                                                                                пIE<;BMZlpnr{ДС╡Ї Ў▄йм│╝      ∙ё═з╒╧жк╞┘эї∙■·  х╖Цоў  юпi\Фхы╦БЙы╓╣yrБ╚▐╔ГXW^Ч═├Йadrз╩┐Е__hЖюы═ГhTUSbВ╖═╜w`^atбфтоГjcgsгр╘▓{n_inЧ█▐╨ВnbfuерЎ╘z]TT^y╝ъ┘Юjhiz░┌ё┌Пf_Zjе╓ууИg^\iЪ╥═╞Пf]dw╜·ч╖t`U`u└яЄ╠rbVa|╕▀ямfRHWРюў РV>B[╡  ╞dF4>Y┬№ тfRBO|╥  ╨dHBWз· №У^GSu┬   ь|mrsokjeUMGFCDGMY_^[VNIIHGGJOTY[WPNLCGCKOS`ghlkf`XU`gqubHAUrybNPdaLQYQBCYrnj]G9EeuzlQ8:Xо ·┬`B5>U╛ў ▐ePBM|╘¤ ╩aEB\▓¤ №Ф]HYЙ▀   ╒xqvrjhg`OHGGFDKScaZSJFFED?AFGKNXYXSOMLHLOT^hlkkjc\V\hv~kODKo~jQLaiPPSOECYdkjbP>C`{ВuZ?:DU~ШВVFADXvЕtSLKR_xЫЦfbfozИйГqdfkhЗнаzbbjtrЦЩАd^]epДЗpTPQXlРв}ZVJJ^РoPOSVeОлЕslmpsМНzdVVhkШФmRQdlР╛┤Р^=E\jW                                                                                                                                                                                                                                                                 GI?89>EIYelrxДЕг╟╙╜аи▒├     ∙Єщ╩а╤╦Ям╟╙▌ює∙∙ ■▌мОзЇ  щдcUЙ╓т╟xВр╤нqfm▓╤└БXTV}║╗Б\\bМ╛╜В^]by╓т╤ЖiYWU_xн╠└~a]^lФ┘▐╣ИjadmП╨╬▒}oeijИ┴╪╬ЕtiktФ╔ш╧АdVRZhе▌╨Х^YWiФ╘ш▌Хea[gР╟╒╚ДbZZeЙ╗╜┴ПcY]mдх╫│r_W`lосу╟p]U]rе╒снeWQ[Н╪ьюЖJ4;Sж√ё╗]?19R╡Ї■█bN?K{╘√ ┼]ECa╢■ ¤У\IaЭф   ├ueqqkjf[LGFGEIPY``WJCECECDEFEGPX]_]VOMEIKR_ehikmj]R\jyВtT>Jnp[T[rUPY[LC\ДqhYCO\yЖeLMMcИЮРi_V_izНЙzjkmqВйЯ{opv|ЗЭФs]Z_fyеЬr\\X^cТЮЗdJJIbЖТqILS^iЙвБ`UJDXЕкБSTX\jЙЭУzmghlКМuXQ\gpЫЭwXZwАЙ║║Юe;EXgX                                                                                                                                                                                                                                                                 KKD:79CGWemqt~ОГк┼║ед╢╩     ЇЁц┬Я╙╩б░┼╧╪ьЄєь ∙╪зuбЄ  шдeTД╨▀├t{╤╨еlajг╩╛АWRTu│╢А]YaГ╖╗В_[`y╩▀╪МkZWU]sе╔┬Гa_`kТ╨▌╛ЙkackЙ╦╬│~kejkД╗╒╩ЗxlkqО┐ф╬Жk`[^hЪ┌╬У^UT_З╩х┌Шeb_hИ╝╙╬Е`VV`А╖╩╚Пf[^gЫр╙▒sa[`hб▄▄╚q]W[kШ╚▄░eXU`К╩уъЛI28MЫэу┤[>05MзъЄ╙`L>Fr╔ё ╜ZAA_╡■ ·О_QgпЁ  ■▒roupigc[LHGHJNW_e]RJFGFHGGGFHKRY`ba]VQMJOX_cfhhihcYYm{ИВaGKkБy_O^zgWTX[Z\ММ~qja_h|ЖГypgmzСдЧrxfqu~НОwpghqГЯвtfcgsИ│ЫlVRWakЭШr_d_O\РжУhG=F\ЗШzOJYdjЕгМe\NN`Е░У\ZZ^nД╖Э|jbajКШuddipxЫзДca~БД╣┐иp@GZg[ё                                                                                                                                                                                                                                                                nHF?86ACQcmptАОШн╝╗йж╝═     ёт▌╦╜╥╠а░├╩╤щюЄЁ·ю╓жНдя  шеgUА╚▄┴pv┼╠Эk`fЦ┬╗YRQnк▓В_[_}▓╖Г`Z]y╛▐▄УlXVT[nЫ├├И`\[hО┴╫╝НiabhЗ┼═┤АlcikБ╖╙╔ЛxjjqЙ║р╦МqeaahЦ╫╦Т\SOZz└р╓Цdc_j┤╤╙З_VT\xл╟╞ОcWZbН█╥пsaZ^cУ╤╫┼p`W[gН╜┌оcVPX╜╫цСI38GЙт╫нX;/5HЧсц╩\G6@f║т∙╣XCAZм· їИ[Nm╖Є  ЇаnkoigheXKGGGIQ^daYQHEDDFFFAEKPTZ`dedcYPOW_adgiimkaX]nВРПtPVjz}thaА{yytmhrШУЗ{qmsvБМЖvqomlЙдЫvi[]arЙТpSMKVsЦзiXOXqЖ│ЯkLMaysЬбzcjhTXМобpFCE]КбДUSafiГдЦkca`gД│ШeXQVf|╕е~kcbeЙвБfezУЛЮоТngЕЕБ╖├┤FI\e]╟                                                                                                                                                                                                                                                                ЩMMC:8=BK\hjrГРЮ░╗╜▓а╖╠     ь▀╪│Ш═╬Я░┴─═шьёыэч╤ЮvЯэ  чеeSz┬╫╛lm║─Цi]`Л╜╣}YWVeвоБ^U\wм▓Б^Y\w╡┌▌ЮnZTTZjР╗└Лa[\fЛ┴╓╚РmeehГ╛╦┤Вneim}░╤╔ОzmmpЕ╡▌╔ОukeflТ╥╩Ц_SOUp╢▌╙Цcbbj{м╧╬З]SRZoЯ┼╞ЛbXX_А╬╧мt`X\`Ж╞╙├q^W\eБибнdWSXu░╬рСJ25Cz╤╤йV9/3FИ╓█┬ZB5;]к┌э╡S>=SгчїшЖ^So╢ё  ьЦkjoidc_VLCDCNYcecTMHEBDEFGGHKPSY^acec`\YZ^`bghhjga\`qЗХЫТy`oДЖ{tyВЕД}xvtЗЪзОtnmpvБРЖoeYT[yЩЯБZLHNgГЛkJ<=IeФкpQERsТ▓зlILiГ{б▒ГiqrWXЛйг~PBKaЛеТc]^ehАгЪsf__gВ┤Ы]HEEQw╣оВh`agИШИur~ИБЪ┤б{lИРД╢╟╛РMIWpkз                                                                                                                                                                                                                                                                ╧JPG:4:?IVbhoАЪж│║╛┴╝╡╦     ъ█╤┐▓╠╦Я▒╞╟╠хщэюыр╨ЪЛЯы  цдcPr╝╙╜hl▒╜Сg[]В╖╣}WSQdЩжБ`YYqгоВa[Zyо╪▐кpXVRYeЕ┤┐Тc[[dЗ║╫╨ЧmbbgА╕╦│Дnchh{м╧╩Сylknп┘╔ПwlgkoП╠╚ЪeXOWhм┘╧Ч_^\fvв╩╦К^USXkТ├┼ЛaVX^z├╦нuaUY]}╗╤╛q`TYb|░╬╡eVQWoЭ╩█ЦK34=i╝╩е[<29E{├╙║Y@3:UЦ╙т╢O=:KР▌╪╤ВYOm╡ю  фНddifff`WNIDJR^dhbOIEDDDGHGFHNRTX^bdghebbb^\ZdhhkicXctТо░ЮИu~ЖtvВСБunjjАЦмНpeXWVyУХaRBJhВНО_?>CZКиvC86@_Т╡xT@NtЬ╖пsKLmНЕж╢Мov{aYГпмГ^ZUeМиЫpa[_d}ЯЮpUTS^Д╢дWGCGTq╕▓Жe]ahДйУvnГЯТЪЭЯЪОЗМВ╢╦┬ЧRGSqtШ                                                                                                                                                                                                                                                                 HNI?8;@FP]ek|Чо╗┼╠─║╡╦√    ы▀╘░У╬╩Ю▓┴┬╩учыс▄▌╩ТnШш  ув^Lk╢╤╜kkл║ОfZ[y╡╣~WPRaСб`XXkЭкБb\^sд╒┌│q[WTXa|д▒Шf]]fГ╢╒╪Щoc`f|▓╩╡Зnehl{й╠╠Чwllo~л╫╔ТxnkmpН╚╚ЯocYZfб┴┐Ч][\cqШ┬╠Н_XVZjН┬╚НcWV[r║╩▒{d[Z[w▓═║saVW]vн╧╗iWRYjУ╔╪ЩO57=_▓╔дfF:Ckп╗╚ИRH_Ц┌·ї╥А`afeed`UHKLR^ffgbRKGGGGKKNPQSUTSX^aegfd_YUTWehjkkf]iН▓═▐╚~|iО}b]Еб~^PMKXОТЛАp_HJuл╣йБP>DaТ╜▓vE@CXЙ╡ПOC?HbЙдНhPW|а▓╖ЩspГЦШд╝зГqlhd~дж}XQKXБиаeYJYd}ЯоАojfkЕ╢╡rd_bn~╕╣РgURXyкЯАsАЯЦХ╜└в}ГПГ▓╩╚д`QUwИИ                                                                                                                                                                                                                                                                 [S[J76;@ELS\hЕз╜╧▄▌╫┬╞уў   ы▀╫┤Ф═╩Ш▒╛╝╜▀тш┘╤╩╝МwХ▀  ▀Ю[G`к╩╢lbЧлЙbRUoн│XONZВЪ_RXiРгВbZZhЩ╦╓╗tW\UUZoЬ╜дhZY_uл╩╪Яo`]brг╟╕РpfeiqШ┴╦в|lknyг╥╞ЩxlknrД╛╚лvf_acМ┬╠ЬWTXdmЙ▒╗ЭdTPS_А┬╟УdVVWhк╩╢Рvh`]iЪ╜╢u_UTWkЮ╠└pXRVc╜╤аX;9DZЬ─░sN?=?YШ┐м]=24Cj░╥╣R=:@_д╩╩ВQGZК─▀с╩~_bhggd`WKHNW`ehgcPIFFFJOQSRRRUVTX\aegc`ZUQQUafhjjhbdЮ┴тЎ█ГamЪйЕ[ZЖнВYGDFSУ├оПw`FJs▓┴╖ОRDH`Т╛║ЖPBF^Л╣ЬdMLRgТ╗е{joЦм│он░пбЧа┐нЕj]WYvФЦyT@AMyждiMOfk{ЫзТКД~vВ┤╜tljm|╖┐ЦhTNTqлжГrАаЦУ╗┬д}ВбЗп┬┴йeJQzФВ                                                                                                                                                                                                                                                                 ВR]P99904=`е╦╗TA;@YО┼─ЛVNc~╢╟╫┬А__fhgd`WKMRZ`eggcMHFFFISXXVUUVVTW[_ejd_WROOSahijjeagЫ╚щ ёНbtк╣Ф]WМ┤РW<;;:<=??HRkЙл╟▄р┌╖╖╦ш∙ √р╘╨▓П╞╚Фл╣╢╖╘▀▀╘─╜╡Й}О╔ёё┌ЮWG[Ъ─║p[ИгИeQOiЯнВ\ONWvЛz^QTeЕЭГeXS^Б╞╒║xUVRPTgТ╜║m^[[mЦ╟╓гqaaalУ┼┐ЬredgpК╢╩п|ljluУ└─бmijmz│╚░Бj``c|╢╔г^TRYbzн╠░l]UPXsо┬ЧgUTWfХ┼╔╣еЕk`fЛ╡╖~bYUWfР┬└w`WU\pд╡кoRU]lО╝▓~RC>@QБ┤нhC88DcШ─║aHBEZЛ┴┴Уrmo{ж║╧║Гb`hiheaZPNR[`abdbSKGGIMVZ\ZZ[XVUWZ`egcXQOJJTbgikmpuq╤Ў  ■Юhy║├Эb[ЦЫУ`>9=Oв╟┼ЛbLBHt╕═╛ШqedoЪ╞┼Фee_jШ┬╛{usquМ╛╢Тsln|Ч░лУ|lksШ┬╢|XRXRjЭ│П`HJVyи╖Кl_absЭ╣еЭ║кЙЛм╛ЖbSXf|╢╟еqVNPoо╡НtАвжТ╗╟оДyЫЛм╟╤╖wNP|еС                                                                                                                                                                                                                                                                 ЎNbYC=::=>?BOb{Ъ╕╦▐╪╝╢╩хЇ√ї┌╧╬┐п┬╟Ук╜└┴╥╫╫╥┬╝╢ЛГЗ╛ъъ╓ЪXBTТ╛╕xlЗЯЙePMcЦйД\LJToyr_RRaАЫЖgWR[u╗╥╗{TSNQTdН┐╝paYZiН╚╒еr`bbhН┬┬бrcfhpГ│╔╢}kjjrО╢├жБnhikzо╟▒Дj]adx┤╔лcUMU]rд╔╡o]UPWlв╛ЬlVSRdН┬╒═╡Щu`dВо╢ДcWVYfЛ╝└}cYW^kХ└┤|abenЕ╖┤Й\FGE\Акоu_JMUlШ╜┤oc`euИо╛ЧЖ~quМолгЖcZgkjgd\SSTW[\`fbYNIHLQU\[ZXYYVRTY]bc]PNNKLTdhjmrqwЕь    ▒q└╠гg]Ь╟пhB;;Tн╕│М]>AGt║╨╝НlhhtЮ╞├Оmd^hФ┼┴{eXZkД└╗Л\Q_qЭ╜оza`e~Ы│░Жbd\Tpг╢ЩoQSYyЬлШi[[[oЪ╗йвЬХМРк┐Жm\Zhzп╚кw[QNk░╕Рu~бйС║╔▓ЗvЫНл╚╘╝БOQyмЬ                                                                                                                                                                                                                                                                  I`_E<;9:;;=NZkГЮ╕╬╘╝┤┼▌яЇЁ╙╞╚░Н┐╟Пй╖▓▓╦╙╘╥┐╕╖Лx|╢ру╙ЮYFTЙ╣▒rW}ЪИgPN]ОеД[HHOjАxbSR]|ЫКjWQWjй╩╗~UTQSTaЙ╛╜wb[ZfГ─╥иrbeafЖ┐┬еughho~░╚╕}nllqЕо├йГoijmyж╞╡Йl`adv░╚▓eUOSYlШ┼╣vaVSWgЦпаqXWUcД└╫╫╦г~cczг│ЙcYW[gВ╡┐Гf\]bkЗ╗╖ЙljknГ┤╣ФoechsЕе▒ЖvssyГСаиleejuАРЦОВwqosЧ┤зВb\fihfca\ZQMOT[`b[PJIMQUYYZZZXVRQZaa]VMIFHMWhjimtzБЩ     ┬zЖ┼╫зm`дглm@9=Y╕╤тОS:8Et╝╙╡xeYXjЫ┼├zfQM_П╟├vZJFUГ┬─БTBLpд┤зqPPmнй┼┐Рfiqixе╕Чf[S[wж╜ЯeUORjЩ╝нЫИ{q{г╜Сvot{Ви╕й{^QLh░║Уv|ЮоС╣╩╖СБЪШл╔╓┬ЙOPwкб                                                                                                                                                                                                                                                                  PXWHB=<;979CN_oГб╝╗║│└╒чяч═┬╞пН║╞Ке╜└╝┼═╨╤╛╡│Йvqк╧▌╨ЮUAP}лзsf{ЙГjQJ[ЗаГ]LFMdtscQL[wЙДmVLW_Ф┴╜ЖVUSSS^Д╝╛|eYXdz╣╬мv```e║┴иt`ednzз╚╜ВjiinЯ╣лЕlegkvЬ┤нМl``_qй╞▓gXNOTeР└╗zhZTWcН└░wYVSb|╜┌▌╧о}dcqЧ░ПlZ[^jВк└ИtebeoЛ╖▒О}~~ВЕд╢ЫuqkwzЕОФРnonlrДСШi[SPU\vЫЛqaWPgБКРaUeihfdc`XLIIMU]`]ULKPSVY[YYYYUQT[__\OJHFIQYikknt{М▒     ╥АК╩▐пndн┌┴tD=?_┬╧╩ХS8:D{┴╒│[TFObЩ╩╦дhPGWН╔─kUA?SВ┴╬ЕP>MnЯ└░kGNnм░╚╞Ыogdauж╕Ц\VKUrг╛бeKKOfФ╝оtf^^pЫ│ЪАsvИз╠│АaRKeо╣Цy|ЧмР╖╠╝ТpШТз╩╫╚СSQqизЄ                                                                                                                                                                                                                                                                 rZ`JD@=:9458EUfrГй╣╖о╢╔┌ъ▐╩╝└нЛ╡┼Кд╢│▓─═╧╥╛│оЖviЫ┬┘╬ЬQBLwаЭmRrТЙlTMWЬДaNFJazyeSOXrТМpYQW]Д╣┴РZVSST]~╕╜ЗhZZbuп╗м}b``cz╢┬лxfegnwЮ┼└Еqlko}Ы┬┤КqkjlvФ┴╗Хmcdboб┴╡q]SQSaК╛╛Бn`XVcД└╖Аb^[`y╗╔┼║ЪxjdtХоШtmlosВб╗СЖВ}{МЪаЗ}В}|ЙЦТДrf_bhwЗСВ^UQRT`|Е_I?>BN]pwgZVV\uИО}e^dihffe`UMGGHOV_^ZVSRTTVWYYZY[VX^_[RJIIJLR^kkjmszО╞     ╬ВУ╧ц╖oh▒░╜|F=Cf╧хяЪU9>FД╙▄╖XNBHcв═┼┬uOCVР╧╔sRABXЙ╞┌НTANhЫ╢▒pINlн┤╠╦жu^XZqи╝Щ`UMToг┴еbSLNcФ└░mZSShЯ╝жЙy{БГд║▓ЗcWPbл╗Щ}|ТиР╖╬└ЯБУЧз╩╪╧ЫVPmФЪш                                                                                                                                                                                                                                                                 бQWOFAA=;859=M\ixЙЫн░▒║╩р╪╚╜└нО░├ЙЮ╣╜╖┴╔╦╒└▒жВtcМ╕╥╦ЭQ=GpШФl_oББlSJWyЖ}eNEI^osdOJVnГДrZQRZ}╖╔в[WRRPZy│╛РkZX_oе═╣Аa^\atй┐оzcefkrТ╛├Оmkjn{Ф├╣ПrkklxМ└└аrbebmШ╗╖{eWUTbИ║└Зxh^_dЗ└╜Оnljqxп─╜жИБАПжвvzuw|БРТХЖxoqtВТЫГmfa`an~x_MJHMUjАvP@>Si|Е}h\ajjgcb^WLIFGLPV^]ZXXVVUVXXXYWSX`_UMJEEHLUbjklpu}Т╦     ╦БЧ╙ю┐sn┴ь╓ДJCFn┘эїЮX:?GР▀ф╜WL>Gh╡▄Є╦~TEXЪ╘═xWAB\Ф╔цХY?IbЩ┼╗vLLgй╕╨╤кsXVVqм┐аcVKTnг┼нr]WRcЦ├╖hUKJbЪ╣зЙtpv}Э╠╗ЛeUJ_е╛Ю~{ЙЫР╢╧├ЪoФЧг╠┌╘бZQoал╪                                                                                                                                                                                                                                                                 сRaRBCCB@<:;;FQ`nyКднно╕╘╒╟╢╗нРо┴ИЪмлж╗╟╔╘┬мЯЕs]~о╩╩ЯQ@EjОПkOeДДjQMUrОГdOGHYnsaMJRiЛМuZOKVt╢╚│\VQQQYsк╜ЭoZW\jЫ╦╛Еa]\`oЫ╜▓defiqМ╢┬ХqmnoxН├╗ФxnnqxК└┼й{nlkoР╖╣Йnd`aiЕ╕┬ХВzxzАН╝├ЭЕИ~КxЭндФЙБ~ДПЬЯxlfdgnбКm^ZZ[cИЩАaSPPSbnhS@634@ZtpB6237CZu[>0-.4AfqZD:8Iaoyxm^^ejiec_YOKGGIIJS\]__[WVTUTRWXZ[\XQIGEBEMVfplloszУ╤     └ВЮ╫ў╠xx╥╙╨ЛJBIu▀Ї√гZHm└у¤╥БTG]д┘╤БWCD]Ы╬юЮ_>E_Ф╩├~NKcд╝╥╓йsTSUr░─йjUPXsл╚╡Аh`ZfЧ╚╗jRFD\Ъ╛лЗi^`qХ╬┐ТkZQ]г┴дzЙ▒Ч┤╧╞ЬoЦЬг╨▄╪й^Soг│╞                                                                                                                                                                                                                                                                  M`UFEDBBA>;9?HS^jЬжедп─┴┐╣╜лОл╜ЗУ▒▒д╢─╟╙└наЖrXvз╝╜ЯP;AakOZ|АkRHRn}{dMHJQiobNERfЖНx\NOSo╢╟н[UNONVoЧ╖вvZUZeС╦┼Йb_]ajУ║╖ИegdjpЕ░┬бwpqtzИ╜╜Ю{oqs~И╝╟│КttuВТемЫТЙЕА|И╖┬вНЗЖДНВ╖┐дЙwspДЯЩ{d_\[\lОЩpZVRV^gqzfVRQP^ГЧ}^MGIJXkjQ71..7NgiG0,,/8GQ\>-(),9YjV>31@Uerxoa`digeecZKJFCEAILS]aa^]\ZXYXY]a`]VKFHEFDKWfkhmrwАХ╨     ║Цлр■╓z╪ фПPGKxх№ з\@BSпё·╧ZM;Ht╚э ┬}THbк▐╓К\EC`д╙ЇжcAD\Ь╤╞ГTP^в┐╦╘мpPSSu│╔▓rh_c|▓╩╝Еqf`oг╠┴iPBC^Ч┐мzVN]gЪ╨├Шo_N^в┴кЕАДЯЩ╢╨╔вpЦЯй╓▀▄оeVqи╕║                                                                                                                                                                                                                                                                  Y[VIFFFGE?::;BKWfwУимзк─╙┬░╢йЙЮ╝ДМдеб▒┴┬╨╜маЕrcsа└╞бR?A]БКkMWwlTGMjДБeLGIOeoeTLR`БО}`QQRjз┼кbZTX[aqУ├░{`Z[fЛ╚╟Сhc_^iНн▓ЦnnnptВк─оВxvx|Й╣├жОЗЕЕКМ║╞╣ЯЦФЕНПе╗ЭФКЕ|Ед╛Шtpootо╝Щtc^^epwuk[YWVWcxuiXSPQWcwvaURQQXvФ]KEDCPafT8/--3F]aL1,+,0C\^@/++-3KbXA009KYgqqb\^ikgdb\PLIIJFHHMV`db^a`_^^`ddd[NFGJJLMQZjopvwwАЪ╬     жЕ╣ц■╠xГ┌ хТQJP}ь  к^BF[╕ї ╫\N@L|╬Ў жmRLh┤чуШaLHbл█№мjCG^е╘╠ЙSJ[Я┼┌щ│vYV^А╗╤╕|ogmЖ╣╬┐Мzx~Кп╥╚lTFKfЮ┬╢sVVboЮ╒╠ЯtdS_д├нЕ}З╕▒╝╩╟иuЧд░▐тс┤lXrк╗╣                                                                                                                                                                                                                                                                  ФTTIEFFFEC@<=?DQbsИбнмо╝═└╝╝жЖКГ{Жм▓вм╜┐╠╗кЯЕqXnЩ╡║аS;?XtxkMQr~nTFNcБГkPDHK`nfSGP\yКАcPRQgХ╖еh_[`hmvН┼╢Еf]`eИ╞╚ШqjghkЛ╢┐еvwvxyИо╟╖РМПОИК░╚оШХУТТТ▒└╢УВ|uzАЩ┤Э|hc`dtКИЖwhbb`nа┤Оi[SUUc|~fSTRRS^s~jUPNOT]pr^QLLLRinn_JC@=HbmV80,+/RrБjKMk}oUJL`ГqVEGJ\gbTJNYo}zfRTTdНнбvgivВВВЬ┐╝ПrkksЕ┐╔зЕБАЕЗС╢─┤ИЫОШТФп┴┴МПРМКУг╢нС|nln|Э╣▒Зqc_`mОмШg_]YYdВиКqfddafНйНfUPQU\msfSQOQQXhqkUNNNRXfr]PKHGK_}|bJB?EGHJMS^bfimnmli\SIADEECKPWdkpuvppБк█    щwБьїшЦtФт ▀ЙSP[М  ¤к`DPj╙  хeTCWЪ▄  ЪWFLw╩ √╒UOu┐Ё ─tKMb┤с╫ЩWOSЛ╙ш№┌ЦmppЧ╫▌╬xvQYЕ┼╒═oM[zг╩ф╫{xxlp░╞╟Р[RlВ┤р┘зЕ{fl╡╟║ОДЖ╜о┬сс╣Шк╖цёы├Ж`tо┬о                                                                                                                                                                                                                                                                   YKKJJJKKHGGJE@BM[}е╕╗╗╕╨┐даЦВyи~xЭ▒ЩН┤▒└╗пЭМq_eЗо╗▒b>;JatmRE`soZGKVqsXFHITbeYHMYeЕuj`dnЗп┐╣дд╦╪╧╔е─╜мЧМЖЗП▓┴лЙ{sqrzм─╣БlhgioИ╖╣АkfghmД║│ЕlgdgkБл▓КhgacfyТФrcbZUZnЛЖsgffchuЦОqYOOQZmymXTPOPT`nlUONOQRXojWJGGKSdpbK>;9;IVR:1*)*-;9:BFB0*'(+5QUA0+()*4HSF0./9EPW\]WW[aehihcYOLCCFE??CKS]cijjgZOIFCDCHHPZcfhlrrnБк┼█Є   ┐zП  ╠АВиэ ╞xOQ[К  °а`ISt╤  ▀bUH_оу  Ы[HP~╧ №еiSTА╠ў ╔tMOi╝ётЩXPRБ╙ю ▌~VlВлуь▀РН^aР╔с╪uUeЭ┬тїтЛдлШЦ╝═╨ЦcVqР╛шсмЗЗwv┐╦┼ЧЦР║░╦шщ╠СЦ▒└ю¤є╤Ъi|╡╔п                                                                                                                                                                                                                                                                   ч=BFHJIIGDFGFGHJNhТ╣╔╧╧═╜ЮЫЧlЯБnРкТА╡│║╣▓дЧv[_|ж╗╢n@9B[roR@VnqaJHOcrqaLJNTdomhejsЗЪОowrqzШ╖йsМдЬ~vzИдЦt]XYbР╛дxbZWZiЩ╜╡whaabf{г╢Бmfgknwм│ЛoiffisЧкСkgdbdkvtnea]ZY`|Вj^]_baiНХ{\PNPSdtt\QPONQZdlWNMLNOXko[LIGKW[baR?:88=FI@0*)'+2DVH4+&'*/EUH3+'&(.@OK8.,5ALS\cYRU]cghhf^UMKGGIC??GMT`fggaQLDCEFGLPU_ehhhopvЪ└╩╓ў■ їЭСЪ ■╔sw╖ё ╛tMN]Й  яЧaJTx╥  ╪`QHb╢х  ШZHPА╨ №ШaPVД╨° ╩tNOl┐√чЬWNO~╨ю ▌yUlС┤ъЄуФаgiЧ╠ч▐yclв╩щ цПж░ХЗ╛╤╓ЩgYsЧ┬эунРФw├╬═ЯЭЦ╣▓╥фщ╘ЪЩ│─є Ў┘гlА╖╩┤                                                                                                                                                                                                                                                                    5;EHGFGFFEDBDGJQZ|п├┴╛╞╗мнбgЬБlМиУxнлп┤│ма}a^yа╕╖q@:ATooT?QoxcLKK_uxgQRT_gpv~xroЖШЙh^T[fЖнбulllhb_╢еsWRO[БЭЦx^QSSbП║╖{h]^^buЦ╡ДnediktепМrjghgnПЯЛhgdbahr}nd`[WYYp|i[Y^bdfВУВ_QOMQ_jkaVPOMOT^dXQNMKIRfiXLIHQ[bifS?;88:?EC6+(&)/0*)'*7HOB2*((,4CNI3,-7CLT\ZVQRXfhg]\__YUMKIHHGJPRWad^TONJJLNR`ehfhlqooО┐═┘╬°  ║~Чч Ў│jЖ╥є ЬdIM^И  █ГbLT~╓  ╥^PHc┤ц  ЙVGSОу ■КZOWМ█¤ ╦sSYy╓ ёб[OMx╩я ц|Uqи╔Ў ьЬпxjд╙Їь~fnж╤є єЦз╕дЦ┼▌увs_wа╔√ы╖ЩиЪЕ╧╘▄ниг╛╣▌ЇЎ▐ее╣╩∙ №рбuЛ╛═╛                                                                                                                                                                                                                                                                    Я8EGHGHHEAABDFGOTfМ╝▐ъ┌┴п░иГ`ПЕjЖбОiЬего▓кгРngwХ┤╣{C?ETks^DSo~r\adoyААБlhghe^VRLXuОБZTORXrЪжsYTQOQWn▒▒}ZSMUqвзД_QSR[xНСНj^\Y\i{ВИseadgkОзТwjehhjvzpgd`__bgkjd`]\Z[apfVQX^aam}y`QOMPU[cgSOMKLPV`aUMJHHNUUSQPWxФЙ}p_I?878OK8,)'*0;JQ<..4HXioc_`sГДДЖx||{yl^YVY\YMAFRnЛЖ_VNMShИФxYPNMNReз│В\QMUjЪиИaTRRZpШ┤Шj^][\dxЮЦudbdeiАбХyjdbdejoqid`_]^`eld`]ZZY_heVMQY_`gii_QOMNPYgfQNNLJLR`_TMIIHJPTSOO^Си╣зИiPB9678ANI4.*)+0=OK:-(&(,4GN?/)&&*5@HE4/08AGKTXURSYab``dfc`XQONLIKHGLQW^bWONPTakjfeehnrikЪ┤╕╗╟∙Ё╚x└Ё ╗zfФцЄ╜sTCJ_Х  ╔mYKVz╒  ╝ZJG`кх  |OJXЯя №Ж[MWЩф■ ┌БU[Е▐ ∙з[RNx╨Є эWq╖р  єд╗Лqп▌■ЇЕ^gб╙∙  ЪЫ╢иЬ╥ь°л{c|н╫ Ў┼в│йК╫▐ш╢мм┴║ф№ сдв╛╦■  ч▓zР─╤┼∙                                                                                                                                                                                                                                                                    3+)*-5FOD5-()+0>JI:,('*.7BI@4..4=FLSXXVRR^eddddabeeb^ZTOKMPSZ^`bdfhillllnofdtУж╕┬╦▀▄д}mХ╘щ┌Иky╖ ёС]KEOl░ ¤╗cTKXГ╘ ¤ХPIGc╣ч ▄mII[аЁ °~XL[жч  ┴vU`Рр №е\TQ|█∙ цZr╗т  Ўж┬Щv╛ч  Тdlг┘№  ЪУкен┘ў ╜Бi╡ф ¤╠й╗▒О▀ыё├╝╣╟╟я  шйж╟╪   ї╜|П╚╘╦Є                                                                                                                                                                                                                                                                    КAEFIJIEDGPVVY_cjoТ╚Ёр╠мЪФzRiz\ZZNH\rzй╞╠═╔─└╜╛└┐иЗНЬЦДАwdgmtnRMHLSZVJFADJPPKD?G\tsWKJNXxжШ^RMIHLZЕкТlWMQZwЧНfNOMT^|амw[UTV]fБЪ}bY[\agsВze]``aaejjb`_][[Z_c`\Z[W[__WMIIQX\cgbWPJIGKUbYLKHFEFRd_PGEEEDJSUONiХл╖ЫgUG95349DJD6,(*+2>GG<0*+)-7CGD1+**,28BE:/-18?FNW\[VX\adfeccdefedc_[ZWY\`befiihfjmmpmfajК┤╙т▌┌╪║Рlmм╫╘РmfЙ╙ ъГ\JFRt╬ ЇоbOHZО╒ яLHEj╔ё°╝dGG[Ьё єuXM[зч  ╢nScЦч √з^XTАс¤ т{[r╗у  Ўе╞Э|╦я  Яjlг╪№  ЧС╡│▓▀¤ ┬ГkД╣ъ  ╬й╛╢Хуёў╚╣┤╦╙Є  ь▒н╬р    ┬~Т╠╫╧щ                                                                                                                                                                                                                                                                    ~EJKKKJDAHSZ^_bdinЗ┤ъ▌╚йТМwOVRLGB@?BReФ└╤╙╤┼╟╦╠╧┼оФЧРВyvpWMYlkREDEMX[MEBCGORMB?EVxПzZNLNUqЯаcQJFFKTwгЩvZNMUlxwgOQOQYpРЪ~\SRRWatЖ{dWXY\bp~ua]\_`_cgc^]]\\][__^\^^XW[c\PHHMQT\ef[RLIHJRWYLHGFGHP^]OFGDDEKPTQLRg{yiZPE85314>NN9.*)*.:IKB3-,*+2@LI6-+*,/2;@>5..18AIR^ginka_dgfdfiihgefcegghffeegjjjknpmd`dq░╫чьу┌╤Юqbs░╫═|^gаэ с|UHHYЗт ЇЯXLJ[Ь╫ ╒pKEFp╫°єЯYFGYШш шqTJZгх  иeReаы √м\UV}ш■ ▐w[r╗у  Ўз╔бВ╬Є  оolб┘¤  ШПим╝у  ╦ЗoК┴э  ╙о├╜Ыш°■╠┴└╬х√  ъо│╓ч    ╞ДЦ╨╪╘ы                                                                                                                                                                                                                                                                    uMRUUQLC9GXaccdcimАеш▀┼Эn]NKHC>:87=EZГ╖╥с╗▓╝╞╧╬╦╝И|xutqqKCP^_Q@?DKRSNB@BFMRPF@CPpОА_NKIPkЩбgUJGHIRiЪЭ|YHLOb|АgNNMNUiКлД[SQRU[lНАdVUUY\hvtcYZZ\Z\`a^[[XXWU[__\ZZTUUYXQIFINRV]a\VLGEHNTTLHEDEFPabPCCDDCHQVQDINQTSPMG841/37HUD2+**07CKI:.,+-0;IPD/,*+,.7BB93/+3:CNXg|ГЙjXW_fffijjgffghiiikjhhklnortoga^dЛ╦тёїщ╫╕vc]~┐█и`Yj╕ё ╨jNEIbЬф шЙQHGdл▌°╛hJHHzц¤ЁЗUBEXЮё фnUJ[гф  Э_Piйь ∙кaYYВэ  ┌vZs╗х  їг╕гЖ╨ў  ░poб┘¤  ЩР╢╣─ъ  ═КtН╟ю  ╘╢╦┼жя ¤╤└╗╘ъ№  щн┐тя    ╦ИЭ╒┌┘ы                                                                                                                                                                                                                                                                    {U`a^ZOA?IYfkhhekp}Ъут┴Пl]QHAB@<9878@QkЯ┴▓ЪЛЕЫ╝╩╞─УЛЕzrsqN@J_fS??CHRXO@?@CJRPJABMmКЕaOJINbЛЯkZNIHHOeТЭ~[NMMZr{hNLJKPbАгМ\TQQRXcБ}dUURTYblph]\ZZZ\ad`]\ZZZWZ_d`\WUUVXXQIGEIOU\baZOGFHJQYOFCAAFNYbSD@DFDGNVUFEGJKIFJJ<61018ENK:.*,,4LXbzмГbVRV^fhkkiffacfeeeikgcgkmowqkf`cwг╟█шъ┘║Уm[kЯ┼▓pTZ╬Ї С]IFOq╢Ї ╠yNHKq┼цїд`GDMЕэ■чwQBE]кЁ рkOI[въ ■Т`Shкы ўж`XZЖё  ╫vct╝ч  єж╬мЙ█¤  │qnв┘■  ЧРн┤╦ё  ╬МvП╔ю  ╫╝╙╬│·  ╓╚╞╓щ¤  ъ│╚ф∙    ╠Нв▄▀▌э                                                                                                                                                                                                                                                                    i]ccaZQA;H]ijihafmyУрс║Г_QJEBB><:868;FTd}ПЖlr~Сл╗║ЩОЙЕ~xrNGKU]XF@CFNTQC>>@GPQK@AKeГЛgPKHK]}ЫoXLFGFK_ЕЪД^LLHUjtgLJJKP\yЬЛ\SONNP[twaSPMPU[krfWYTUVYbmgZZZYVTYaa\WUSTSWZVNHFGKQZej[QJHGFJPNIDACDJQWRIEDDCHOSQHECCDDFHG@84225?USA2/-/28HQH5/,,.3=MQ?1+)**/5:B@7./1;L[bhkneXRTU\cgijhfdcccdfhhdeijjigddcfuКг└╩╘╥╛ЯgeЕп╡З_N\У╥ЁяwRHGUБ╟№ ╛qOKN}тЁыП]EGQЦє сgO@Ga╡э ╧bKH\гю ьК\Mhлы Ўб`VZДЎ  ╘rXp╜ц  Єб╜░Пх■  ╢qoд┘■  ЧП╝┬╨°  ╥НvР╚ю  ╘┴╪╪┬   ▄┼╛╥╨·  э╖╬х·    ╧Пдрф▀ы                                                                                                                                                                                                                                                                    l^eec]PB>HZionmfimuМ╙▀╚}UIEB@==:98767:>CVwsjdj{Ф░мРЙЗЕГzpVIIVc^MECFLPPGB@@ELPLA?F]zВjQNKLWmУtVJGHEFWyЦИ`KMJPcqfLHFHLXoПК\OKKLNSkr`RNMNRXgpeVWSSTXcrr[[ZWWTV^c\USSVTXZWOGAADLVag^SKFDDGOMIECCCGM]^SGCCBDJQUMAA@@BCHPG:33258KWI7/-,/3@OQ@2,++-4DOF4+***-05AIRMBACTxЧ}RKHJQ_ИyZIFEDGNpФРhGGFN_ohNICFHPdВГ\OIHKLQbn`QMKLNTajbTPMPRWcvq[VVURQU__ZTRNPPTZXQGB>AGRbqgVMHEEFJNJC@BCGHYe_MCB@DHMRRJB@@ACEKK>73568CML?3---2:85E[ebY^^cebZSPKPU[bebedhjggcb`]ZUR^fr~ИРЩео┤║й}^ekЕзи~RNKm╔р╓}[DDJc│¤■юЩcJN\Ф■¤╬rZCL_║  ┬PJBLn─ю ЛPBEb┤№ ╨АYJcеъ єЩ]U\Иў  ├lSl╗ч  ьа╨▓ЪЄ   ╗onд╪■  СН║╞┘   ╙ПsТ╩Є  ╨─сц╫   р╥─╞╚ї  ∙╞╥щ¤    ╘Сжфыу▄                                                                                                                                                                                                                                                                    Q\ege`RC>CTgrtwiejtП╗╫┘У[GC?<;99:8632015CaАla\hБЬмЙqjknrv_PHQbeLAB@>Phtth[Z]_adcYQPPPQQWY[\_acc_ZUVWY`gzМППУадо╕г~bYUyШЫГhZQR{╨┘╠kTDDMn╖  ╬В_INfе ■╞hVFOq═  бSFBR{╬ю·tJBGh╕  ╗xZLbдщ фРXPYЕє  ╢jZk╕х  сЯ╥╝вў   ┐qqж┘■  ПЙ╝╠р   ╓УvЦ╥ў  ╧╞ух▄   ур▌р═ї  °┐╨ш·    ╘Чзшёх▄                                                                                                                                                                                                                                                                    SZbca\QD=DVfnqqkimuКп╧┌ЯaJFB@>===<<97425B]xlc]awУОЗhRKQWZ\ODNciQ>;>EKPI><;@HRPCAALlЭХ^QIHJM[lYIEEEGKcНЮ~OHEIUaeYG@CEHRd^ZPJFGHMXbbWJGIGNV^^VPONOR\kj^URPPOS\a]XROOQSVYUJFDEEM\rs]WRNIFJQPFACEHIRejZGEDFJMPVSFCDCCDHNI@9899;ITP>0../29GSH3,+),/8HH;1.,++-07@IXeМ╢гaRV^_^]``ZVUONQPSRRQRRQQRUX\dmоаХЧбйкпЭxaUOaЙФИwkc_ZУ╧╨п[LAFRА╠  бnVISr╩ √┤bREVБ┘ №ОLD?RЖ╙ь▐lF@Ir┐  зlSJeиэ ╫ДRNUИЄ ■лdSh╡с  █а╘╞иї   ─toе┌■ √КЙ┐╘ъ   ▄ЧxШ╓∙  ╬╦ыЎ▀   у┘╘╪╠Ў  °║╦ш√    ╙Ы▒ыЎш▌                                                                                                                                                                                                                                                                    pWbcb_RDAFWhrsuoijsГг╨█кjNID@A@@A?@?=636B[ojc][jХ╣ЪbGBEN_]ODKadV>8:AGLJB?>HgЫЬcTLHHKU^SIEFEEH\ЖвЗRIEGReo\EACDFN`l^MEBBEHRcfZKFFGJQ\b[MLMMOUbo_SOOONNYgeXPNKMPSXXMFDCDIWmycYTSOIFKQJEFFIJM\iaLEEEHILRTMIFCCEFILD:667;AJOF5/,,-4@LS:,)'(*.FLI@;:FbЧбeUJEDDN^UFABCEFVВаКTKBHQX__G@BEFLYa_PFACCGM_h]LEEDHMWc^NHHFIPWa^RKJLJOUad]QNNMOQSUQMGECGSenh`[URNJHKIHHHKKMWa^RKFGHJNRTMHFEEFGGIF@9787=ISL:0***-7DG@0)&&&+3>HB5-+)*+.7FdИНЛpG6@IPVWVW[_][YWWVVWVX[[]^eoxГХШЯвклдЪДn\JJZlzЕyf]gtБС╣╕Ш^>@@Lc┤Ё шmYKLdЭч уВSJHg┤ц ▄pGEE`▓█чи]@@I{╨ №ЖYIJm╗ё ╝nIITГю ыХ]OaЭ▄  ╔л╘╨нЇ   ╧ukй▄  ЁАИ┬▌Ї   ха|Э┌¤  ═╒ё я   ▐╓╒▐╨°  ў╡┼х·    ╥Ь┬Ї ьё                                                                                                                                                                                                                                                                    ╬OX\_c[SW^kyДЕЖВ}z{АН╕░╡БZQNNPRTTTTUUSE;DXki]OKZВмеlA37AU`ODGWi[B:9JF4+&%&).8@@:2+**,0=XlzГyZ=55CWji`RJUwЪжvF36>RcTB?Ne^F:47@IKD=;@AWР╥Ёю}^NIXЦт· еdKLXВы№тМ_HJNц∙фwRADSУъ шuVGMz═Є ЯaGK\Т  рЛ[K_Т▌ №мн╥┌│ў   ┌zmж┘  ьyЛ┼ц√   ъиб▐¤ Ў╤уї ·  ·╚╚рф┌№  ў┤╬ш■    ═м┌  юЁ                                                                                                                                                                                                                                                                     DRV\i~Хл╛░ЭЫгоквЧПНТн▀╨дrkgghimqsw~jaI:?ThgaSJPmЗвБL23;O[WF?@EQ_bTC@?@CLY`YGDCBEIMYTOOPNPRZce]VTRQQTX\ZVTQLLS]hda`_ZVPOOKGFGIJNWbcQLLKNPRWYRMIGEBCFHGC?=958BJOE/)&&).7GG;-)'%'+4AF@5,+-9^Ы╡waWPG<63/049@EHKMMOQQV]beijmpy|ИЧСК~rg]SMJSXduw^HIS[`i}б▒СlSC>=A_┤╒см`REG_лє√хЗbKM`У¤■╙{^LMTРё¤сlRCG\зЄ ╥hODOД╓Є°М[CI`Ю  ьТ^Q_Щ▄ ЎЯ░╤▌┤∙   р|mЯ╫■ ┘yЛ╞ъ    юнБв▀■ Ё╧т° №  °┼┬█хш   ў╣╒ё     ╔╡щ  ЁЁ                                                                                                                                                                                                                                                                     POU^tЦп┴└║╢▓о┤╕░ЬТУЪ║▀╤░~slorssuvvohXD8>RlmcUNSbВЭЗO338H_[G;C[]J<208DHG@99>DIHF>;GaХЗaLFCBGLPJD@?@@GXxС|QCBBGU^TB>=?BF[l`K?><@CL_fXD?5,)&%(/8BH=.,.FБ┬╢r^SKIG=4/,+-/7=@CEGIMORX[^chkrvxtpiaUIB@BUfrБx\HCBLVbsПпж~bTH?ACp╤▀╓qYIEHm─¤¤зp[NTl╗ ¤╚l]IP[л  сaU@If╗Є л\GBQП┌Є╨zT@Jg╡  єЫ_Pcв▐ ЄШ▒╤т╕·   с{lЦ╓¤ ┼yН╟ъ    Є▒Гмр■ ы═у√    Ў─├╥фЁ   №╛тЇ     ╞╛ъ  ёя                                                                                                                                                                                                                                                                     mO[iАк─┬╛╗╢ол╟╣│ЫОХи╞█╤╡Вwnqnrqokf`UI;5;QnlcVLK]~РЙV726B\_K<@SZJ@735@GF?::=BLLIB>EXИЙfNGDCEHTOE@?>ADSsСИWHEEHPYTB<==BFXe]F?>ADHUdcLDDGIJJ]^VSQQRQT^gcXVVVUUV[]YXTPMNSjof__^bTOPQQLJLKMR]fePNMLJLNSXRLHFGEFIKJC?<<;?FS[@1*)'&*8EG=2*&&',09CF:1=bЧ╜з[A=AEHKB70-,.02369=BGJMU[^baedcc`\WNEB@CReuЗvXGB>?GTc|в╖ГaVUTNIQВ╤╤┬cSECOА╤ ўСeTMZБ┘ ■├dYLUk┬  ╪\SGQy╨№ ЛUCCWдуЇ║oPCLn─  їЦbTh│х эС▒╥т┐¤   у{jТ╫¤ ▒wР╦ь    ў░Вг▐¤ х╩т√    °╞┬═┌є   √┬яї     ┬┼ь  я№                                                                                                                                                                                                                                                                     ЬPczЩ╡╗└─┼╛мЮжпбПГН▓├╒╧╢Гogc`_\YUPGB;519OlicWONWxУН]>65@Z`M@AIPJB715;EKC<9;?KQKA=BLvМmPFCADDKMFA@?@CNgЙШfGBBEN\XD?==?@OgeQC@=?BETc`JCBCCISceOHHHJKJWYVSQQPOS[b`[YYXWUUWZVTTPMJPcje`]\]WRPPOLKJLLOX`eRONMKKMOPPNGDFEFGGJHB=;::@IOL:.)&&)0:GH;-)''(+3EHKD:40/022257;@DO[dgjie\RMKGEAAAGXnlГmRD?:::FSnХпЛ[RPQRS[bЮ╦═ХWKAEXбч шybONdЪх °бaQIYz█  ╡]QHXП╪■ }NBE`▓ЇїдgNBMs╬  ъР[On╛ъ цО░╘у┼■   уwiО╓¤ аqО╩ю    Ў▓~Ц▐■ ▄╞с¤    ∙╦╞╔╓Ў   √─эЎ     ╝╠э  ю√                                                                                                                                                                                                                                                                     ╥Tyв┐╞╠├╟┼╜д{БzqqШ├╧╕ЕeWPLIGD@<6771.3HhhcYNKUoИЛeC54>W`P@::=INHB<<@FQ`eRB@CFIR^eTJFGHJIRVUROONNPU`f_[YWTRRV\ZTSPMLKZjj`Z\`ZQNOPNKLLMOS\cWPMLJIMMLNMIEDDEEGHGDA@<:=710//0059ESbqГСвwYHA>ACEDJZflr\H?<998KH?9:;FMJ@:<@[МАWCA?@@IMH@<<=@EVyЮГOD@@EPUKD?<;>GW\TKE@@@EMXa]GABEHMX_VQLJIJKNRSRPPNOQS[ba]YXVTRRZ[YVSPMNTcibYZ]ZUMMOPMLMMMLN\[TOLIGKKMNMJEHEFFFJMHCA??=@KWN;.*((*,7@CD5)'%%*-8J\ЗвН]<,*+,,.5:=?ABB;4210134FUgvИеТ]D;;:DJUahgcRA=87769?V{УЗfQ>=>CObxгЬОrR>>=L~╧ю■С]LIVЕ═ў ╛mMHJg│щ яwJKMm┐ъ√└hE@Jv╦ ўЕZH@SД▀ °Ъ]QP}▀∙ ├Л╕╫ч┘   ¤т{jЦ╘¤ ЙfО╘ё    є╢yЖ╘· ─║▀√     ┘╤╤╒·   √╣щ∙     │█є  щ                                                                                                                                                                                                                                                                       R}▓├╡ЬЧРЖyiYU[^[VV[hй╬╠ТVA;8420.//--*).:U`d_UPRk}ПwO86?P\VG?>GJI@604:JJ@9;BGJID=:;@ERpЩСUGA@DP^RF?>=?DSd_ODA@AELZkfMEBCEJUgaVNIHJOPUVSPOLOQQ\ic\ZZWUUU]]\YXUOMR]b^Y]a^[UQRQLMPOKKOUXTQPOLKMNPRQMPKJHGGLLHDA@?AFQUI6-*))+28422IUcpЕо┤СaLGIQ\`d^WPKB<:888:=OiyАsR@:89?MeГзкЕ_G>=@Uа╦с─pSIH[Я▄ї°ПcIFOt▀ї ╜gKLPz╙°ЇЭ^GEPГ╒ є}VGF[Яф ╔w\NSГх■ ╣Й╗▐юф   ∙▀{nв╒∙■~dТ╫є   √я░yЖ╤° ║п▀°     Єё╘╫¤   ∙╕фЎ    ·оуЎ  у                                                                                                                                                                                                                                                                       gp~БГА|vpk`POQMJJNShг╨╘вU:620.+++,++)),2FZ\[XQQbxvqX:19JSUJ<8FMKB8437IKA:9:@KKD=;=MДОdGDA@@DKMF=??BEOjФХZLEDGMUXJA??>COabUG@BDEIUjqVHDEDGPdj[OJHGKMRWXSPPQQPXhp^YVVVSOV\\XWSPQPWbfa^][XSQSTROOMLLNRXUPNONPQQUVRKLHHHHJMMLFCA@?BLPND3+)(*-2>KI6-*(*.DcjiaRE9,***)'*+-0369?DDIJGEJOW]h~аШП}kdjmU_TF?<:99788;AMdqyoWA<:88@PjШмУmSG<@Df└╧╘ziMHJc┤єЇ░rZIJUБя ъУ_JNTОы ю}YFGWШэ чpVDFf╡ы ╢kQOXКЁ ■│Й╜▐ёю   Ї▌|pй╫ўшwbС╪Ї   єы▒yМ╨ї │г┘°     ўЁ╫┌¤   Є┤рє    ї╧ч√  ╘                                                                                                                                                                                                                                                                       Жdhe`\cihcXJEGIHGKQeЭ╨╫кW71.-+***-*)('(+:_phXPOYm|x\;33DTXK=;EJKA8104HLD;99986534468AS^nviQA<8768@ZЗкТvaRIA@Iy┼╬┬eVGDKk╜∙юР_PGJ^П■ ╨yWKK[бў чoWII_▒я уhOEKs╟ё ЮaIH\У·  ╡Й╜▀ЄЎ  єё┌{p▓╪ё╧p_С┌є   Єх▓zМ╥Ї йЮ╓ў     ЇЁу▌¤   ъо▄ь    ьзъ■  ─                                                                                                                                                                                                                                                                       зMOKIPU[_]RE?@BACGMaУ╬▄╡d62,*))'&''&&%&(4blg]PHObtxaA.3>NVO?5@JMB71.5GID=:8=AFGC;>CHXd`N?A@ADL^qdIDAADIYhaPHFEGFN\aYQPPPPR]lgXTTTURRXYVTTSRORY_]WXXVSQTWXQNMLKIMOTSSWZZ[YVUXUNHGGGFFLOKEBA?@AHWXH5,'&%(.7CQF5.1Bz├нuXUOF92,)&%(++**))-/5:>CFIKMQWajlmcXOHA>9631222447ASgpxeJ;956778JtвЯvi_VMEKPР╠╠ЦSJ@CLА╪№▐iUGBLi┐ ■│bYGNe┼  ▐_XINk┴Ї └`JDPЕ╫ЇЎО\EH_д   ╢И╝сЄ   фы╪ys╗█ь╖j^Т▄ї   эс┤yК╥є√гЪ╘Ў    №ЁЄяр■   рк█ц    ъиэ   ╝                                                                                                                                                                                                                                                                       ╓FEACDINRSL;8=ABDHO_О╬█╩u74+((('&&'&&&&(1Tih_QEGZmscG019IRPC5;GLF:417CJHA?;=AGIEA@H_zqWEBEDFIPPEGBEGITkМrVFDDFOVRH?AEPhГvaPC<97654103369FYjv}dM@855579C_ЕЧР_NNSVTUnп│РfNGAH]в╪фмcODDSВр Їй[QKWБ╪  ─\ULW╥¤ ХZGEVЯтЎ╤|ZFMh▓   ┤К┴х   ў╒ы┘}x╟хыеf]С┌є  єэ▐╡zП╪єщЬЮ┘°    °щюя▀№   т═▄ч    ▄жЁ   ╛                                                                                                                                                                                                                                                                        CD@===@C@:48;@BFMViМ├▌╒Й:3*((('''('&%%(.F[f`RDEReofL346ESVG78HKG>6/6>GHD@<>@DHGCBFQor\C?BBDFKLGDBDEHQ^В{[FA?AJXVLB>=?CN^dVDB?ABEOaePIGEGGLagXMLLIIKX`[QPQPPPUfe]WTUTSPKPUXWTTSRT[caZTTTSSSWVQMLLMJIS\hwДЙПk`][VMJIIKLLONHFGECACHNRQ:.*'&(+0@FKVf|▓▒{G469@FA>91+-.-,++*+,-.//03478;IcКеpJ<8557555457:Jdwyz]F>:76468?TuЦШiGCFMTdtФ│ЯwYGB=Jj╣╨сДQE>D`Ы▀ уЖWMJdЯф  а^QI]Ц▄■ ВSEF_▒ў·оmTGOr╞   ╢Н╞э ■ ·яь┘А╫яэЦb]С╪ё  ▀ъ█╖|Щ▀Ў╘и╖▌√    Ї▐щю╪√   ▄║сч■   ╨иЎ   ╢                                                                                                                                                                                                                                                                        @CBEMSLEBCEINYw~`H@@AESWMDB<:@GVd[GA?BCCKZaSKFDEEFYh_PKJIGHR\]TMMMMLO^gbWSTVRONPU[\WVROQZfcSSSUSQSYWQMLLKILO[nДЩ▒┤лЙj^Z\QKHHGJJNPOKHEB?CC@930.--+*)+*+--,/0136BaРжpH7433333457:Kcu}wXB=856545:FgПЧmF>;=DPfВз┤Й`KB<>LЕ├╔б_F==Ir├ы вdLHNs═є ыTJKg╢х■эtM@Gj╜■·Ы`KGVБ┌   ╢Р╨є   ┌╬ь┌АГуЎьЧ_\Р╧ю  ╩ч╪╡}дц°╚Пе▐     ш╓▀с╥·   эцфч■   ╦й√   ╣                                                                                                                                                                                                                                                                        I?<43433333:@IR[clw░т┌к>6,*'&&&''&&&'',=M\`WHFGYkjS842;MVP=.(((+-5@GCB;52/--+*++,+++.-.04@^Зе{L631234357;PmtzpT>=8311348>[ЖУtM>456=NiЮ╝вmME=;;Zм╔┴iU>;>OИ╫фтЛ]DGRЕъ¤ ▀rMKNt╙° ┬lHBK|╘ °ИWFCYУ▀   ╕Х╓°   ╠╬ю█Лё■ьЩ_YЙ─э  ╝ц╫▓А▓Ў№╣Нй▀     ╪╬▌ч═·   ўъьш¤  ■╚н   №▒                                                                                                                                                                                                                                                                        h?<400/0115FNW[`hmw}з▀┌╖H7-+)((&''&&'(),:HXc[IEFVehW>639IVSB9@OQI=658FLJE>>>=CGFAA@QbdS>@BFHMSSHCCDEEM]qmREEABLZWKB>?CEQ^aQD?@@BGO_ZLEFGGLN]aYRLHGHMR\\MJKLLNR`d`XTSSVQPTXYVTSSSU\deYVUTSPNTVTPMMKNQYoН░╚█╬╛xaWZWPMMLJFIJLMMFCAB@?AMWG9.'%&(.6Qis}БQ9.)&'(*-4BRfhk`O@;<632267:StzmYB8338@WЙ╡зБcPB;;Dkп┼д_G;;?TЬ╫ч╢pRDFXМЎ  лcJIRВс ·Я^HFVУц Є}WGGbою   ╢Х╒∙  ї╝╤Є▐ДФў юШ`ZВ╞ъ  о▀╪░Е╗  ▒Л░с    ї╪╙╒╪╚    ўхщх■  №╝▓   °╖                                                                                                                                                                                                                                                                        Ъ<:5320//14EPV\aeirzЯ╪╪╞R9-)'&&%&'&%&')-6FWc]LFDRgm]C617FRQF>=LRM?532>IKD:<=@EGECA>KckV>>?ABHRZKDCDFFJV{yYEB>AFV\RC>@@BLW[WGAA?ADJX^QHEGFGIV_]SKHGHHOYaQKLMNORVieZRQQQQRUYXVURSPR[efUSTTUTQTVVROLMNPTb}в╟▀╟мu\PUYTQMKJJLJKMLFC@?>?@DOTH6-*),/A^onnlG<1,)'('*.28=?B@A@;63/.././11016@WБмСZ>=:<>EMU[a[SLE?:7633269@Pnnh[G8504:Jqи┤МpaWG:AOА▒оuGA9BDFEDAH]gX@==>?GTZXKDBAACFRWTLFEFFHPZ[ULGHGHMTZVNIKNPNNbg\PNONPPTY\WWSSSSX`eXPPRRSQRYWSPONMOQYkЖйлпЙhXNJRUQMKLNKIMPQLB@<<<=AFQSF5,*-5PsНК]VLD8/*)'(+---138;>BDA<84221212/17BYГбЦfF@CIWfmlaOC>:886423469CSfjmYC41-/6A[Дп░r^ZXRHGgЩб|Q;:8;Gw╕╟╨lQB?Ko┼  ┐iZHL`лў фlSGQu╠√ г^HBNБ╓∙  єоО╙Є  ╓з▀■ц╠▄  їЦdZЗ╩ц№ъШт╫┤Т╓  гЛ─ч    ▌╗└╟╨╟   Ў╫╫┘х   эл└   я╔                                                                                                                                                                                                                                                                        ■8956973013AKU\bfimqК├┘╟j?.+))()((&'().3:DS^]UGAK^kfQ;23?NUQ@7EVXF61/4BKC579;?CFEC>DUcYA=;<=BHPMEBBCDELj{hOD??CN\XI?=;>FPUWOEA??BCMZXOHGFEDM\d[LJHGEITa^MLMNONN]_YRPNNOPQTWUTPRQQTVWXTQQQQQOQUTSRPMMPS]m|М|eZSMMPQPMMLIEHJNPQJA?=>>>EOQND6-1=p▓╕АOPQKA70*))*,,+,//59<@BAAA@?=;:9:9>JZВ╡ЩmY\`lxtpbN>:4310234157BWjkjVB40,./8KpЭпГSPVXWYpЗгИ^?244;OН╥хзVB=@QБ▄ °СUNALi╬  ╔YSCVЙ┘■ ПVFCVЪс¤  я░М╬ю  ╩аы чЧр  °ТaYБ┼фє╦Ъу╪┤Ьч  ЯМ╠ы    ╒з┤├╥═   э╛▒╫ш   щж╘   ъ┘                                                                                                                                                                                                                                                                         9<97=EA959ANV]cgjnpА╡╥┴uB5/-++*+*))*-8JKHR^cXMFJYfgU@22;NYTDAGNQKFDFGFI`wnUC@=AITXPB=<9ELLE>4-,,++*+*-/247<@BBBEGCGHIIKOZ|ЖЕl`ggkКиЗZB85332115:9c┤┼╕lI?>Ebмы └pTHEQГ╤ №ЪXQG`╡т ёzPFG]кэ  Ї╬ЩИ╞Ё  ┼бф хйы  ЎС^X}╦щь▒Щт┘╢лў ■ЫН╠ъ    ├а░╛╥╘   с╢╣╫Ў   щйш   ▀щ                                                                                                                                                                                                                                                                         C;=843561..016@KLLQY^\OBGR]aXG228GTVI7DJONJFEEGLWps]F???FYaUE@=>AGQXSFCCBAADPRKFGHFFIRYWNLIHFFMZ^VOLJLJLMV]\SPMLNQSY]XUTQOQPT[YRPSSTQPTVTSRPPNORV]b^XTQOMMRVVPKHHIFGGIMLG@@A?EENWXPCP}▒╢НO05:AHKG@8/---,*,,,./02469FSQJECBFJQjtcJBAAEVb\IA??AELUUIA?@AABKRPHFFDDFLU\TNIHGEHTb\SNMMJLOSYXSPOMMNQTYYTTSSSPNV[UOPSWROQVXTQPPOOPRZ[ZTSROMPPSVUMGGIHEEHNNKHEDEHIKQVZ^hЭ╡Ю`5**/5?FtХqF92,./136:>UqzwjO85200006JjxxhK<658C[М┤дyR=5238PК╡Ы`?65;MЛ╓ъ╬wWEDIi╞фЇ╢gIHQГч■ЇЩ\GBKu╟ ■Юxlj~╣ь Ў┐┐ч х╦Ї  ЇН]ZЖ▀ёсЗХр█╣╨  ЇНИ╟ч   ьеУл║╬у  №╩и├█    їс¤   ┐                                                                                                                                                                                                                                                                          л>G@DRURMINVWVX[_b_kМЯШКaUUODEVSAHT__Q844;IYT>;BFC@8.06:@=736:?EIC>@FPPJEB@ABCFKOMHEBBDGQ]]RHFFGHMV`WOKIIKLQ[]UNNLMLMSWWOQSRRPQSUSQPQTSRPPTUSQPQQONSVUQOPOPQPQRTPKFEDCBCIQNKGEEGGIHLWhu╣░rB,''(,4;DKIE>81.,+**++,-,+,,-/1112135:Q~МkH73>OJ?852./036;EaВ|wfN83.-,./3A]w~oQ75025CgФЭМmN<626;dЬдsA635:87:BLQQMHFFEJRgoYD@?CM\bSEA??@DMOLFBBBAACHMOJEBCEFNX\VIGFHKLNXXPKIIILOW^ZOMNOOMNT\VUTSSSUU\ZTQRUUVTPPURPQRRTRSVXTQONQOPRVZTMHECAAADJPPNJHHJNMMWpГБ\;.'))(*/5?IFC=93/-++,,+++,--.0/-...048JuЦxL727=<864103359E\zvn_J:30-,.38AKj|mRA6205;Msггu_PD=9;QШАT:44:Dj║у╧zVC>DRКую╙w]HNk├  хfN@F[вё ьyUNT|└ї ║Глш цЎ   ЁЖcdиьї╪uШ▐▀┼ц  ╧АЖ├ш   ┐РФз║╤·  ю┐й╘∙    ш└   ўЯ                                                                                                                                                                                                                                                                           ┼JKMRUUXYZY]^]_``]gyБ}vcQUWQNSZCAMSG=LcZNQ_h]HCDKVaVB836CUYH<84217AD<5569AHDA??ERaQA=98;AJTRKGFGHHPdn^FB?BJT_YICB@ADHOPICABB@AGPRNHEEECHUd[JGDEHJM\^SKIHKMOSWVQPNOOONPWWVTTTUTPV\ZRORUVSRUWUOPQPRRRTUURPLNPONPUYRJEBA@?BEIQTOIKMMJRduy|tQ9/('&((+/5;BCDA:52..0.,-,,-,,--/..,.16Fm}qR70367655457941.7DbСй{YSRME>Fg~ВhI755JTN>F_^TS[ieM@?FRYYG944?PXN@9:?D@4/05<@<4015:BDBA?BL]VC>;9:?HQQMGFGLLN]idMD@?DP[YNFCBCDFRQKEB@@?BFNRPGBBCDDL`aMIFHJHIW`XNMJMMOQV[WRNNPPQSZZYYXWVWSUY[VRQRVVUTUYSOOPQRQRXZXTNLNQOMNRWOEAA@>@BFMTUNKORYctИРmdVC3+('''(*.0:@AAB@=7210-.,----,,-.-,,/5BiГ{W7/044578::@HOZdWLD>72.,*+.5=Jg}dJ<530/0:YИбГULEFMRQUВЧwQ;415?b╢╚╬tRC=>Ko╩╨╘ТYNJ`йс яГTE@N~╥№ ХaLFVЪ▐°ЇТzйф ч   ■т|fv╞ў√зuа█╪╫ь  █БГ─ч   еЗЩ▒╚с■  ц╗╕у     ▌╠■  рк                                                                                                                                                                                                                                                                            чWW[[ZZZZ[]^_a__`bfgd`_OPWTIGOIFNUP?C]`QMZghPD=@N[\N=22;KRRF97?EC41/3;C?31007ACA@>AL\ZGA=;>ADJPTTQOU^yм┼ЖZV[R?-+&&&'),/37:=CD??<8520/...--+-,,++/3>czz\;01368IWlИгН]=6137G~п▓йfA;9?RВ╤№╔vJFJm╟ь¤тoD@?UХ┘¤ ВSDC\▓Ё∙╠Д}кт     ·┘xsВ╒ ∙Тnд┌рця  ═БК╔ч  ¤ШЗЫ│╠ф   х╖┴ц     ╫╧■  ╓╢                                                                                                                                                                                                                                                                             {_`]YVSPV[`ca^_kwj\XY[TNRSOJTNAFRQAAUaTMXehUIA?HW]QA538FSTJ?9@@HTUK@ACCFIT`TLGCBEIO^_TLKMKLOSZ]ZRQQOOMPU[\WVTTTWZ]]TNPSUUTQQUSSTUTQONU\\QJLMLMNMQSRIB@=;>BHOSWWV[rб╜╖vJGOSP<0+((&*-1//268:;>?=;9641./00/0/.-.03;fЙЖdA868;CLW_gZRJB<7430../038=Oes_J?3/.//2=]ДСwP:339E[zгЪvO:327;NК╝─БP?;:Bb╢┌ыР^CCO|▐Є·д]AAA^╣с∙▌nK?Fj╝№·░xyмс ∙   Є╤reШ╪ цБoз┌╓Ё√ я╝Р╠э  їФКЬ╢╘я   ▀▒╛ц     ╙╫■  ╦├                                                                                                                                                                                                                                                                             ■abXOJFLT]cc]YdБgWTTXWSTTM>LPIEEDCENWQOU`cYMA=ERXTF836?N\P<6:?@82./5<>95225>EQTME?<:;AMQOHFCFHKNXgeOFCEFN_YFBA?@AGOPKFB@@ACGLQOFBCFHJNVXPIEEGGJU_ZOKJGJMOVa]PNNNMMPTWWTUTSRUTUZ[TQQRRRPS[YTQRQQOPUWWSQPNMLJJMWULFCA??DHLR\[ZgН▒╡ЯW8:CIML?0-+*-./--/14579<>>=>;<:74323330245DlБВlM>GOZgg``QC<:75220.,-16;ATpt^J?40/-/09JrМ~X>6137C^ГФЛiG9519@bЯ║ФYH;99I}╦╒пqPCGVУяЎ╩uU<@Bn╪ЄёЭ_D@Kz╧ °Уrzк▀    ¤ы═pm░у сДpи┘┌∙  ╥╢АЪ╤ё  єСРЫ╕┌Ї   ╙и╕ц     ╦▌■  ┐┘                                                                                                                                                                                                                                                                              Лl]JBCIM[a_\[hГДeOOSYXOORLCP`XK;00;GSPA67;<@LYRF=:9;?HXXLCCFFFJT_`RIDDFKVYLEAABACIPPJC@@BCFKNMECDDFHLTVQLHFDBFOXXSNKHHJLO[bUPMNNNMRUVRORPSSSUW[WROOPQQRVZWROOQPPQTVVSPOLHFFHNUQIEBADHKJMV`auа╝╢l9.,/8AGMC;1--...00./121359:;=>BBCA@>=9::;BMkЙВoaae\d_UMB:7311/03/,,.5>E[vsaM=3.,,-05BfМ~X?4..17CaХЯtXE:77CHNSWVUnЖyYJMQUYTOOK<@OH==EIEHZ^YV\baTF?BIWZP>327CVSD97;=<6/,19?A:6335CFB=<@ERUJ@::;@DT]UF@CEEHO\h]LGEEHMRMGB@@@CFNRNC?BBCBDNTLDCADEEOWVNGFEDEMX\VLKGHJLOT[ZUNLPPOLQUVQPSTTRTX_^NLMMPPRQTVTQLPOONQUYVMLHFECFFJOOJCCDGJKMO]i|▓└ИE1))*.8AIQG;42/.,..././,046789=?ABBCDHIIGGKOgmmiaXSNID?712.-..-+,,+,2?NjНw^K=2/**+-1:YЗАZ?6/--17P~аБYNG@;9@XЖЧ{O4547>f╝▀═jP>=Kp╓№эЛL?6>LЬў¤сcMJJA;@EDDU^WO[ed\K>>FNVRC506>SVI:4;?>:2,.7@B=7567>DDB?BDKRND>=<QsТw^L?61/,,/2:Prj]G82./.3HqРЕaUMIJJFEtФВZ=413:NЗ┴╣п`F>@XЫ╫ЇкiI=9@[╖Ї·╟XJ>Jo╩є фsbmир   ├╧┘┴sЙё  ┼r▒у·  ї─░С╬ц√  ╡КСи├Є   √╗б├т    ъ╝ч  °О                                                                                                                                                                                                                                                                                ░FE?9<>HS[_hrp`MEJORXTMKJGCGH@IA7444;GD@=>?HZRE===>AMXYM>=>BGLSejULHFFFRXOGCCBDENWUJ@BDEDDGQTGCACFGJSUQNIFEDFKNSRMHHJLOQXa`UPNKNOOQSSRSRQSPPS[[URPQPQPRUVSNPOOLKNOVYSLGEBACBKQRQNGJMNPTix~{tY71,,**+,/Fj╜╫┌ВZB;9Dj╬єёЫRD;NД╥ї ╛n^lиф■ тм╔╓╗vб¤  ╡wx╗ц№  у├лЩ╦ц·  йЙРм╩Ў   я╢д┼у■   ▄╜щ  уС                                                                                                                                                                                                                                                                                 @E@<;BMSVax}jZLHKMLQPNLKF?CMG=>JHEJTWUXchePA??EUXM?84;JRPE766;:50/2:D@:6547??><<@EVUH=:;<@GUYSA;<@DFN\o\PJIHGKTSJCCCFFJQTOCEDFEBDPVNDCGHDDMUURLGDDEHLPQMJHILOPS_bXQPKLLLNRVTRQRPMMSZZUPOPOROLOTVROOONMNOSWWQLHC>@>ENSSRNPOPVauА~teT?/.-*('(*3:AIKGC<410..,,-...//0./5@Rep[G;746DZkkS72/.-....,,-./03=HTpАiPE61.,++,0;?EMNSgЕАdTHFMPNPPJGHGD?DC?AEF?DU\UR_khRB?>BQTOF938ENQJ:38A=620/8GE93128A@;8:@DSSJ@><<ISTWe~АbQIHMNMNPNIHIGDFF@:41/5EE<6548>D?76;BMROF@<8:BO\ZLD?==?CNffYQNKIKQSND@BCCEMUUI@ABCEHJYVPJGEDFIPVWPIEDCEEISTMJIIKMPU_^ULJNMNOPSRNNOPQRQTY\VOMLLNNOORSRONKLMIFRWUMEB???@BHSZUONVlа╣╢БYJIIK=1,*(((/4335:@ACBA<61031/.020.1Bo╛╙▌│jB73380.,-./29E[tsR710.,.18[ГБdH84029FaЧ╢М^@4459?bЩ░ЗR@89BeЬ▒╝eE759B_╦┘┌~R:9Br╫ы▐]LPpпь ўКЕ╜╞о▒ї  уЦuЙ╘°  со╝ФМпя  ╚ЙЙЦ╖▀  №°█╛╗╪ё   ч┐╤Є  г┘                                                                                                                                                                                                                                                                                 ХVPCGNOMTewu_RKHMNKHLMKKKG?=71-3BE@9758;?>:66<<=AGYf^ROLLLLQQLFEDCFJORPFCBDEGIS_WKDDCDFMX[RGECCDEJPSMKLLJLNOW`\OHJLLNORSRONPQPNQTWXSMJLNMMNQTTQOMKJGHMPTQIC@===?DKR[WS^З┬╗зnMAABFG=3-,,/31//16:>ADB@<84310..//17IК╛╤р╛rJ:35;Ss}c<5///023648=FS^WPF>9982--,.26?HZqpR>5,-,-07Jx~dM@5214;OyаЛkWB867>JxбЦd@:5:Jsп╝ДM=55:Gy╤┘╖`J9ESYTT^b_TG??EOROC437DPUL:5DMc`UQNLLLUXPHGFDGIOPOJFABBCGL\ZOEBAADJQYVJCBBCCEMYTLIIIIILRZZSIFHGHKMSVRLKLMNNPTTRNKHIFHKNRUROLKIHHHIMOMGA==>?BFKU`kzЭ╔║ДV@649@CH@61361-,,-..058=>AD;75311/038OВ┴─╬лrN<448SwДjA5323447=GNUYYNC=85201.+,-08DMa{mP=50,,+-5E^wqS:0///3FjЕБt[SI?::CiЧХmH=85;ZКб~Q=413:QУ▐╥жSC:@V░╦╔░THDSВ╒№ пtЦ░п┤с¤ Ў╗ДrС┘  ю┤▒╕ЗЦ╝  Їи{ДЫ└с  ёЇ┴м╢у    ф┬р  ╫                                                                                                                                                                                                                                                                                  ┼UZ]TLGGP`ldWRMJLPLDGOPKFE<;CD;7>C@AIRRT\aa[K<@AJSSH843=LUO?9:?A=8139AD@6157805;GQQE?>=?CKY_QB=<<=@Ka_TLKJMJRYXOHFDFIMPRNFDAADFKY^QFC@ABGNRQLFCBBCFJTXQLIIIGGNZ_WJHGHIJLOUVQMJMONNPTROJIIIIJLLOQPPNJGFBEJMKIC;;>@@CKS_lЕ╢╨к`F80./8?CFD>:60-+*+-,+/37=96418>OnСЪвЙjN<448S|МrH@88;@FMXbUOKD<60/0.-+*)+-8IZnВkP>3++)*)/>Rlu]?/-,..:Yu}АeKKLJCAVЛЯ|V?543DrШО_B4025A_┴ъ╠xD;9De╔ьфНGCCXУ┘■ ФoЦ╜╗║ч■ э▓КБУ╪  ╪а╡│ГЮ╘  ёЫzДЯ├ф  Ёяпй╗ы    э╚щ  │                                                                                                                                                                                                                                                                                  ╥_jjdH>BN\b^WVPIISTFDMSQMPC;?DA;>B??ITSMYac_R?@BGORL<00:HRQE48ADB;216AIB6137;@A<148>HNIC@=?BHQVTE<::;AHW]ULHIPNPZaYJCEGIKMPRKGCCCEIR^VLEBADFIORNIEDCEGJPUTPJGHGIKR\\OHHJJKNQWUQNKLLHKMQSUOJIIILMIHLNNMIHIEBEHJIFB@=<>DJS_oС░ЫzTA5,*+.6;@FG@74,***,,,.0017;==?@A=;=?CM[kwvi\K;65>W|П}WDFIQZ[XgXJ@:54.-//.--,-0:H[vПfH:3,*)*-/7Hdv\B5.,.38EmРЙ\A@EHOY_fЩЩlJ<55:PzХ}M9213:PЗ┬сШY>:CPURU`fbTB?ACOSNB407EORN;6@GD;433=IH:0378AE>10.8GPLB@=?@CMWVGA?==@DOVTMHGKLL\d\MIHHHIMQQJHDBCDEHNSPGBCBEHJR[PGDCCDFIYXPIFFGHJMQSULFHHHLNSTQNLJJIKKNORSOMKHHHEGKLNMJGEBAABGKJGB?>CGJReuАИКmO=0+)(+-4B@DCFLS^`e^UMFADE[}ЙymidXWWRJB:62/0/..,,,..03AUh~ЙdE;4.+**+06F`rX?6/,-/6>_КПdB=8:CO]sМжБU?836BeНИ`?7025@aл─╦zM=<@[╜╙╧М^?BFs╪єЄзnpз┴╝╥  ╬╞гw|йш  ╛ТдЭИ╦ь  ╬ЧПИд╨ы√ру╘Ян╧·        ¤Х╝                                                                                                                                                                                                                                                                                  ▓`olZ>FC3-.6CNNEA>=?AGRXKEA?>>?I[[PHGKIIS_]PKIHHGKNUQLECCBAFLRPIFDDGGGMYWJEC@@DCPXSIDFHGHKNSTNKGFGGJLNSQMHIHHGIMPSROPLHHGFIJMNLGD@=?@BGNLFB@BDI\p{|vl`K9/*((*,/259?FA;6.,.-,**-//.11469:;=@CHOSWWTQMLJTS_knnh^TMF=62/1/-,,.-,+++-/4EXj|~^@71-*(*+.4G`mW=5.,+,08VВКmK9744;IbМ▓ФbF9538VАЛmH73037Ds╟╟е`A9:Dl╪┌╩oN14;IUWH66417BHB4134=EB60.4>GKI@===@ENPNH@>==AENWUG?DGIMTWTNJGFGIKQUPFBB?BDJTVNGDACCELVSKGEDDEFIRSOHDEEEEIRZVLIFEFFHGMPNJIHFHJMPSSOLHFFFEFGKMJD@;;>?@CLPLDABFSiЙоЭm_ZK=0+)'(),./26>FC@:5/.----.-./0/0233367;>BDGFEEIKMNT[beZMA:41/-,-++*+,,,++,/6JjlztS<4,+*)))-/EdlYE7-+,-/4FtИyY@20038KtалzY@544AnАw[>00/27RЩ╤╞rQ;6@DHMMIC>>?ADMSRLDAABGQ[ZOJHGIJKMSPJFECFGIQURHEDCCEIPUPNIFEFGIRSPIFBDDEHOU]PKHFFFJJNQOJGDFHILOSURMIGFECDDGMMG?<;<>@BINOJFEM^Ф╗║Иf]VOE<3-+++,,)'+2;DEFC:220/-.///.../0./012246998769MАТnI61115Bi▒╧╜bG;9Dc╕х╓СN=9Ee╞  ╩b_z╜═ю  ╛├┼ЩpШ▌· ▓Нй▒ПЛш√ члЗЛПоЁ є╧реб└х         ╥Аи                                                                                                                                                                                                                                                                                  h\mbL74>KSTRQPMIN`[KHIMQOMJH?===?AHQKB>?CBBGSXOA?;=AJVaSKGFEGGNVTJFDDEEHOTPIHFEGGFIOPNGEEFFHNSSNEBEDDFIMNOMGEEEGGKQQMIHGFHIMPSUPIFGGEDEFHJHD?=<<=>DIKNOOTz┴╜гpSFLRJB:4/-+)(&&&-1:BHFE?841////..0/....-/./0355456465:I]jdC50.++*,,,,-/1215;DWg`WK?72.-*+,-29FdeZI;1/-+,.8FdАjG70,-09KpЫиx]QHEEIjУQ:50009LА└╩ЛM>7:QБ╔ы└nC<;Oz╪  нebВ┬╙Ё  д┼┴Оsпщ■°ЯПккКШї¤№╚иАЛУ┴∙ Ї┌▄ФЯ╩ь         ╣ИД                                                                                                                                                                                                                                                                                  hYg]F42;FPRRQOMJM^bNHINRQMIGA>?BA@EGA>HVVWZ]]VJ<9GE9225:>=51039BD<>==<=?DHHC?>ADBCNYSB=::=DP_WIHDDDHNQSOIFDEEFKTWPHDBBCBGINNHDCC@CFLSSH>ADCCFHJPQNHFEEGGMSULGGHGGIMPRRNJIHHEFFEHJID@=<cФд|UPPOOWpЙКcB50/-1=cз┐й]?97?c╝┘хКW=:=Wлр ЇН]^О╟хё·▄Н┴╜Кz╣√■╟ИСоеЛа¤■№├л~КЭ╫  Є▄╪ФЭ▀Ї         вДf                                                                                                                                                                                                                                                                                  xXcYB02:CLNQRPMKO[[OJGKRTOGE@?@@DLVb{╢╥▒gB<66:BIID:4-+))((*-28<<=CEDC@;6310/.,,-++**+,,+,/0/,-/2A^wqG2,*)++.,/159>JUZ]WH;6-+)))))*,0;TjfaL6,+)+,+,7RiaE:2-,-/3QИеИYL>DRe{ОЖ~X;1/003GВ╛╗БL646F╠▄└qH8:Ag╧э чЖU`Ь╥щ°ёгЙ┐╖ЕМ╙¤¤Э|Э┤зП┼  Ў┼м|Рис  ▄▐╨Фдь  ю  Ўч∙  Ш~b                                                                                                                                                                                                                                                                                  ГT`T>46FROE:44;JTNA?=60.18EE9558:@@GSYLB<:;=EV`PC>@ACEIQRMHEDCCEIOSOIIGFGFHLOLGDCCCFJOSQJDBBBEHKRWULDDBEHIJMSUOOKJMJFLQOKGEDCBBCFIMJGC@?@?@BLXh║зzT?83059>CEDB90-++-.0673148<>ACDCB;31/.02..-,--..-///..03Cc}zO5.-/22456:BJT^ZULB95/+)((+,-/2?TffeK6.++*+-/8IWRI<3--,.4EoЛНrI:6@NgЖЭоoJ70//18SУ╜йc>35;RХ╬╓Ы\@9=Ky█Ў ╒БUc░╒э√цКЖ╗░Йаф √Нvг╣нЮф  Є╚нГШ╕х ¤┼с╚─┬Ї    ъ║с  щО}cь                                                                                                                                                                                                                                                                                 ШNYQ8029GRSPONNOVagTKDFOTRNKHEBEE@AFIF:4/.6AC<73369=AFIF@=>@ADIPTE<;9:BNVTIA=>@BHOTSJDCEEDENZUHGECDEEFKNKDAA@BCHRZQDBCCEDGIPTPIEEFFGHNYUNLIIKJKNNMKGEBAAAAABIOLE@?>@AEN^qtx}fM=722258AFC@CIG=ASTVZ\\ZJ?:9C=4-.3>FD82/048<<@HWUOC<;::BIPSPEAABCDIS\PHDBAA@DLNJDAC@?CHOWXJDCEEEFHOROLGDDEFFGRVRNLNPMNJLMMJEBA??AABDKLJC<>>AFXm{vjaUG<310/./03ABA??=75555410201212267HhБВ]H>6239SБвТ{WA73005TР░ОX;1/6LЗ┴░ЯYA:;Ik╟°  ╣q_u╕╪ёёоtаЦЦЭ╘¤ │p|л║╡┬∙ щ╚║аУжтЇ ▄╚▐дл╙   ¤∙╗╛   ▒~vhЗ                                                                                                                                                                                                                                                                                 ЇFRI3--9FNQOMNLOY_[XNEEISSNNMHB=DDAABB>@QWWY]\VOE:7;AMOI<45:FSPD=BMK@;89;BE?6/06DOUQEB?@BCGMSTMEA@?@BGNOH@AABCFLRTPJFDCBDFJQSNHFEGIHHIQSQOMMLJEHJKJFDBA=>>>DIJKIE@@ALc}РШaUOF>70/,+,..3:BFLLF?;/+)''&*-/--016;>BCCFFDDCA?>=<986779;@OiГГdTXakprcbWKB<60+**)()(&''+4@`Зn\D/-*((()+3BO]XD//,+*,0:bУЖ]B6/23AfМЩНfWI:411>oадyG31-9ZЬ╠╦{B87OTJ>>HKA=:89@KF:325;BA:2-.6DIC8/,-/49EMKC;;AH^_O@<;;;AITVLD@AAAEHPROHDB><@BINME@@@BDGOYTNIFEDDEFKRVMDFIJGGLPQSPLHIHEHIHHJODA><<>@CDGKLF@GVД║╖АWOMHC<3/,***+,-7@EMOE;7.*)(()-//-./0359<>@B@@CGJGLHEBA>?ADITi~wj]^`^[UPG>9741.++*()*+++/5DfЙ~oWC6.-*)*+-3:SfZE702.,,.8YЖДhL<316;MxвЭjPMOG=9;JИнЙZ;214@o╕┬ЬX<89Ce╣р√√євaTx║╫члp}╞═Ч┬т№фyhЛмм╝ч  ▄┴нХЬи√ х┐┌╚И║ц  ъ∙эсЎ   ├А|p[                                                                                                                                                                                                                                                                                  =AD2+-2;9:D>2,.1>@BGRQHAA@>@BFJLJDBAACGKPUSLGEEEGGHMRSLGGKLKKNPPNJGDD?@ACFKKEB>=====@DHLNONr╡╝▒iF=@ED=66,*)**+-/8@FIKA?6/+**,.//0////012579:;>ADFGHDCAABBGNU\cjfUNGB?<96410..,))'()+,-3;JfЕnXH<5.++*+-17@Qf[E60,/--/7NtylR>5209DfЦЬsKIHHIIDEkеЧcA7/17PО║аdH88:JВ╧▀▄яъФ_YБ┼╓╬ДtД─╨афЇЎйogТ╖║╤¤ Ї┘├кЫк╠  ┘╗▄└н╔ь  ю·т╚°   щНБt`                                                                                                                                                                                                                                                                                  Z762-.3:CGGJGJP[lgWMHIPWZWSOH@>HKHBCC>AOWXY[]VM@88;EC=986:DHC81/6:989@HNLB?<<::=@NPIA=>;==CGJKECBBCEFHPSQJEEDDBFKPQNJFGHHHJMOMKECB@<<;>EIFB@=;97::?DIOVbШ╝╛ШQ7326;1,*)*+,0477:?EGH?5/011....-,,,.../--/02567:==;:::::>FVncN@876530.--+++('&').28?MftaM=2/-,))),17@XlWD70,,-,-5D[|БS;4003<_НФxS<7:?GQ^vНЫtL7102=bШз{J747>WЭ┘тщч╫А\[К▄╒╝nqУ┬╚жЁ№ЄЩdkЬ╢╣┘   х─зЭ┤ь  ▀╠┌зТтє ЎЁ√┴╒∙    ЩБyf╩                                                                                                                                                                                                                                                                                 Д58.),18?FJLKKPXdqh[NHHJX]XQLGACGIEBDFA<;;:;@GKHDBA>?@BFMRNGDDCBAGJPQMIFDEFHJPTQKJGGFEEGINNG@?<;99;@EHEB=;7779;AFN\yм╔╡k9-+,28=EA70+++/132.../:HIIF>77720.--,+,..,++,---/00/./0110/34=RsmI;3./..,+)**)))(((,1=JYjiTE8.+)))()+2:G\lZA7.+++,-3=Sp}^81/.16MБФА_B1209EVnКЛК`>1115DxвТ[53/6Bo┼чхт▄┬o\bк▀╒Ю^sЯ─┐┐ ■ёК`nи║╬■   э─ол╜ё  ╪╙╒ХЫц√¤ч∙■└ъ     йВ}jЪ                                                                                                                                                                                                                                                                                 з34,)*/8@FNMKMPXi}ucRIGJXXURMIGEGLHC@CCACPY\]a]WK>78;DOOH<118ENPH9?EE>778;HJB6.17?A;5/.150-,+/8DMG:9:;>BIRQF<;;8788>CGLJC=8369DKPKD=2//--,,-/.,,+----./1.,-./,+./1:OpxM:0-,-++-.,-+++**,3@NO]XK?9/)((*+-/3:LbkUF7.*))+.39Lit\?41/17C^ИНkH72328CY|д╡yK7456=bХХmD844;SХ═┴кт┘╗ebt┴╜╛Кax╢╚╬с  ф~`}║─ф■   ъ╝Ъз╒· ╙╜╫╘УдЇ■ўч¤Ё┬Ў     ╣ЕГmp                                                                                                                                                                                                                                                                                 ╓36.++07@FMNMMP[ku~lWKHGUVUQPMKFBFGFDCD=AMY]_a]VNC969AKPMA634?NTL::EG?889:1-/8CIE830-,-3AVL95547:CUVI@=;>?FUZMA;;==>DJKGB=:89;?EIIEA=>>@CGLNKFDBCDFFMUWPEFGFFFHIMNJGEDC@?ADGKM@=:99:<@GIJHA8679;AKZiwvo]B0-)(),.2=CCA=81.++**)*-07ELLKMR]rЭТv\MFHQUWTPNKFEFGGDEJD?HV`ai`WPG<77=ELME9249IVR@8AHC9468@GH@4/.4?D>5/.4@GF>64,)).:NRB3/017=LWRF=;@EIJC?9889::AEHHD<468;CTtКГteTA1,)(((*/4@DFGF;,,*)))*,017<=>@AEC>9511100../-+*++,+++*))*,,+-5LrБU;0,,-,,-/015:?EKUYNF;2/.-,)&'),4=EaАx]E5,)))+,.2K_^OA6/./03GuЧuQ<3/-+.8R|ЫНwZL@99BaЧУfB7457HБ├╟Э|с╙Ь\w║═╟u_]К═╒╠щ№Є└keЪ└▌Ў   я╒лС┐ь№ўн╛┘╚╕╤  ∙єяЁ       эП|t_                                                                                                                                                                                                                                                                                  4<2(+07>DJLLLQ^tеЩДdOIFQZ[WSRRLEFIJFAGHEGQ]\abXRJ?65:BLOH<715EQOH@?DC>969:DIE://0;FD90.09HLB30+)'*4DJG91.+*5DPTOA9<=@FKKH=9989;CFEB=<;::@HMSNGB@BAADKPQQKDA@@BDGJIHEB?=;;=@HNJE?;:99;=?GIGC>8:=JhРЯ▒xXLA4.**))*-23-/3AJE91.)().=KK>6/,+/=KRND<>==AFJFB;999;=FNUOFA:8:<@FGE===;:<<=CJNQND><<=ABGJJGC@>::;AEJPJA<:899:9@FGFC>>DZК╚┬ЯcOKIC=5.-0/0157:>BEI?61-,.048620/.15:?CABADB>:61/-/.-.0-.,+*+,++,6LubE50013:@KV`egYME;51.+*)))(&*-2=QsХz`G8/++(*,.7GZ[WG7/++.4=TpskG81/0/29L{вХfOLTUQXuкХcA5347Bk▓╞йvе┌╞Гlа╫╨Ж\Qaж╪рхшё█оhv╡╦є    ▀├▒о╒ √жг╣╕н├Ў цъэє√        жВ}d░                                                                                                                                                                                                                                                                                 xD9++.4:BGLNMTcИ╬х╣}YNEMSX[XTQPKIIJGCDIFBGV]^\YSOF=56:FLKF=017@KPE:?FG=479@GLF50.4@E?4/,.9FE=72-)*,6DNF:2/,.7AQSF89;<>AITF;999;;AJOOG>:99;>BGKC>;::;=CKONHA<<<=>DLVQD?=<=>AEGIJE?<<;:;@EJOIA<:9:;:=AEHHCFNu╛╠┐}UDBGIE<98520.0147;@DF@95677952./-0/379;EQ`hlj`VJ?820.-+))(')),/8FUoКkOA5/,*('+-5FZ\[K90,*-/8MbprN93-,.18CiЫЯoGECJYnДЪиzS<534:MД╕│Бm╢╥┤y┬т╓t]Sl╡▀цщъш╔Эa╗╫№    ╤░г▓Ё ёПм╦╥╠╒ў тїї·    ·    ░ЗzgД                                                                                                                                                                                                                                                                                 оD<,*,17AJNNPWgХ┌■╘СbVKMRY[YUSPNFEJLE?DEDFQ`_]\WRI?558AKOI>3/49CKH=;CGB617;CMM:--.8CA:-**1DMD;61+)*0;JI?62/03:JQI83314:AGJA98;<;;DOQI<;:9:<@CHHA;9:;;>EQUNE>::9:>EOSNC>;;:8=?DJKF;<;;;;:865422347QpТегfD60/4=iдйГ_g╗бАyг╓▐┌pUT|├цыя▄╙╝ПsЙ┬х    №├ШЭ├є ├╞╟┼кнт∙ ╘ї є    р°   ╛Нwj^                                                                                                                                                                                                                                                                                 щC@+*,/4>HNPRXiЭч єпgXGJNUZ[UOPRMFEJKEFE@AMa_\[VRLC815IJE=:9889>IQOD;957:;BIIB<;;9:;@ITUJ>;9;;=@GQVMB<;;:AGKIB;61147;@JQ\Ж╟╧▌ЩWF?=>@FNJC;5-,+-./036AEIHEEC530.--.,-.1111/469:;;=?ABAB@CEFFDCCDCDEPeij_WSRRLGC<62-,+*)((&(((')*/CXcqjO<3,+*))()+7JW^aL4/,**+/7T|\90++,,/3PЛаЙdB.-.9LrгпЙO>3/07JЛкКk[Yд│ЖБ╖с√▌oZZН╘эЁє╪═░xeЬ╔Ё    ф┤Яи╘° дМ╜╝г─є·├╓  ў   э┐ы   ╦Фwm]                                                                                                                                                                                                                                                                                  EE/*+-2=FMSTXhЬш №╞r[LIJTX[WSOPRMIHKHHKGBGX_]_[VPF=649CKNI<1/2:LNA9;CE?469>EJF>/-07=A<+)*5CIH=84/..3?NJ@840.0;JOB61//06CMJ?96557;DMSM?<9689HUjС└╞░kKA;889>;741.-*+))))*-*)*-3DU[aWF94/++*+,./9GVa_G70-,+--2Lpq[D6/+,--4CfФЪrK6./1:ZЖЯЛnQB736@ZЭжwPDQВ}qХ╠хю╫oY`Ь╧шцч╤├аnn▓▀°    ═лЛ│╫ЇфЗй╟╣Ю╠¤√├э¤Ё·   ┴ву   ▐Ьwqa■                                                                                                                                                                                                                                                                                 IE.*+,2:DLPQWiПщ  ╠АdNJFNUWXURQQKFINIBEFDFM^Z[YUPIC758?HNL@5028GJG@/+).=LK<531/.09FMH:3/,.5=FL=.,-/4;EMD822248?JQNA=:988;AGOIA;978<BEGMF>763225::5.--/00//10111335678899;<=>@EK\oV@765210/.--**+*++,.-039GYVTG;50,+)**-17CS^f]E31,,,-/4Fhp\H;3/*+-0ELNIC:3/,*)*((*/;JXfq[A4.+++,.6E\dcM800-,,.5IvбS;3/./>\ГРzcOPOE>IlйЭkH;6.,0@=:61//18@EKKJKIGC<72-.--,-+),++++,+,+,))*+,,.-.3>YgS9,+++**))****+,-4:FOSUOE<5.+((&$&&*,9Rjs}aA1-**)*+2CUafR:././,-1@gЧМYB1,--3JtЦИYM]Ъ├▄щт|POdФ╠▀─е╗в}wР╩№    р╣Рзыь╥sИ╬╟н╩Ї хфъї    жГКпЇ   ╜~ymn                                                                                                                                                                                                                                                                                 ┴F3+**.7CLOQUbЗ─  шУoSPFFLRW[ZVVTOKLPKHHKKCGSY[ZWQLC956;DNMG<526CLOD;>IK;028>FJB3*',8FB=3-.6CGA4./-,*.=KI5.-,,.6JU@.)(+,1AHA5,()(*0;FIE>:73236?FFB<89667=DMRF=;;9:;AGKQN@988778<@EKD;41./.05:FMB:6760//00038=@DGJIFB=861/...058=FKMTLGD:100/.-.--/,++-.,,,++++*+-/..4?UbS:.,,,,,,,/--148N`fP:0///0/2548BIOJB942:KOG>?CE>3/2:?FH<-)+0@D@6.-/;KF6,/2/)+6@@=2.-++2@DJ8,))).9CHA1)(%*-5AMJB<71..37AJJ@86567:>DGJD=;:;;=BGJKG@::98774/.,+)(')*,/3FcwАА\=5/+**+-4=L\eM82-,-./09Kg|wT:40039TОТnM=468E[xЪ│ЗQA86:B]▒┴║╨█п\GVzо└г{╗┴Иgzн┘Ї·   ╗лд╘х▐ШИ├▄рссщ╜╢Є     тtxЮ╪   ╒НАrZ                                                                                                                                                                                                                                                                                  B7,))+5AJMPXdАк   ╕rWQG?BMSWYVSSSPJJMLIIG?;GT\``VNIA834701FPK>8@IC5..3;DHB4++.7@A;2,,3HI;.,00+*/:A?60/,+.8FD?2+)(,5AEHJGE@;6200./.....-,++*+)(+/004Agr\A30113358>GRZ``YRH>5-+*)*)'())-05JfswnQ91-++**+3;M]^H51-,,-./5A]zyU730..6NuЙВ[<4/.3@dФоЫfJ:55E;/+/6@KI:-*'-@C=7/(1CE>5../.+,2@H>-,,-,0@UK9.*',09FKA4-)+.17@KPH91-+,,3?EE@:423444;GI@9501/12:J[YTLIHEA>;8532000-.,,,,++,.-/05?argK:8696,,1;IM?1*'*;CC>6,0AHE8-.--+,/:GG7--..1;JRE6-,.15AIG;/-/./3>ELKA73.,,.6CHD@6114768DIG@9430127AP^WLIKKFJGFHKKDA85433339DQbЕ┴├▒lJADOWQNJGE>85654233359=AGOB;75456=DC:41.0/378:<>?ABEEGA<98752200//01.-/06EZurZFBHNX_[Y\SKGA<51.,,+*))*+*+,0NPPTa}Ш   ЎСi[QE;hKPV[ZVTTQLILKGFEC?DT]]XVOME;516FMOI=535ALPH98CC:1,+3EFB7-'*6B=>?<;=>?@?>AELZzpd]YWWWRKF@;721/.-,+*+***,,-16@UtfYJ;5/*)**,/5B?:9DKKG>1-./005@KF81.+-0:GME7-...5>FGA5.-/39FJKF910/-,/7?LOF:1469<@BFLROOLHEEFHQbpvtsaRMMOP\PEAACGIA732///,,,.058=CDEGGE@962/..--/014342356658::97;=>AAEHGLEFDCEGY`d^TIB<;:61..,,,+**+,*)(*+-.2:EU`UK>20.+(((*/6?VjYH<0**)*)*-8G`]WF7/,*+0Cd~ueB4/-.3@gЬбyVONORZd|дебй╪▌гTTvгЦn]v╣лxnЮ─оШ╫Ў чоп╣╡┤Ф|к┘▌▌юя└а▌ы№   юvZQRYmб▀■  ╫НvjV                                                                                                                                                                                                                                                                                  >4,+-0;PSPR_xУ    ▓pdUN?< UR[[VVUSROONKHFGBBIQX\[VSME8138DOPH?805@IHD;8?C;/(*3CEE>820--,+*+.17;ACFILI<952/.-,-.04851001/.02367799:;<>ADCAAA@?@JSRQJ=320/-,,+)()('((*))++-1329ELG>:?A>5+*.5@F>0,+3=IMFEKOMLH>8200148@GH>3.-.29FOI9/-./3:HPE:798515>FHD><42/.3EIHG@843369=EGA9620//039AGONCCHEDA:54049:74221/,,,++,-.-,,///.00/./0//17P_ZH4-,,+++,-,++,,//0/6;FTaXOD930.+((+-038=Rrw^I<1-,))*,27COZ^G50.,,-4>ZywV:4//04@ZЛжP93/6>TВжеЗ{Е┴╥жpaО▓ЯhSnгиkvа╕ЮЗж√№тз░├╠░М}Ю╚╤├єх░Щ╩сч   ф VJAEO^}╖ь  Ёж{rfК                                                                                                                                                                                                                                                                                 t>3,-0:GRTSYjБ╬   щВw[RF:└ ▌PVZ^^ZVUQMMMHEGIFGNUZYURLC92/2;HMKC7/.4AII<8=EE5+)*4AF>3./5?GIHNQIABDB3-,-.03:61245797630/259>BEGC<<<<:71-/0.+*+*,--+*++,,+,,-+++,,,/5Md`I3,+*+*+++,-/01356=GR\_PB90--,*(&(,/5;B^Б|`J8-,+)''*/:@P`[E2.-,,-1:WwtW>2--.07NБйЖZ=30.1@\ИйЩusв╝═Гm~олЭiXzзЪХУЯЮЛЖ╝■√╓Ьп┼╟а{Г╢╧┘рє╔Эп╘тю  ¤ъ OFAAKZtиы  ·▓{qhf                                                                                                                                                                                                                                                                                 е>4,/18DLNQXd}╗   ёЕ_VG<Т  nTZ^^[ZYSLHJJIHGBAIUZZYUOH>7.05=GNF90+.:KIA==@A<1')/:DG=0.18BKJIID@CJH5/-+-027BKH9--+-4=IWH4.+*-1;KPG:3.,)-3=HLB3112359?FID7-+**,.5>HRSROIC=8<@DJMC73.,.-/29CJOUw╤█╪┤c:629AFJNSYB0,,-/058;BC?;:876840/--,-15:=AFHEGE?;60000.,+++++++**+**++,,+++**+-4L\^K4,**)**,-//26;DLU^WXSG;4-,*)('&().6ANmФ|[E7,*()(()+6DSd^E2/**+,.6Nyx[B5.,,.1BoиЪeG4../1DrЮа~co╜│ТnyЮ╛╬гd^ЗмКrЦ░Ю{Й╪¤·╖а╢┼╖КwФ╣╝┤ш■╖У╡╧╩№  ▌  b@:?IUkШу   ┬}ohS                                                                                                                                                                                                                                                                                 ┌>83426BMQRVbvо¤  ¤ЩБbVJ>d   OV\_]]YTOMKMMKIE@CQZ]_\UMB<3/38ALJ>4--3ENHA>AD@9,*-5AHI7//4:HILMI@2-,+.152-+-06FNK>31-,,09DKL:41135;@DGJD5-,+,-08@JPPQMIPJFDDEMLE:443/-17=IVdУ═╘╧БK7436:@EMUWB5/./.1159Vg[F621,,,08IcgeM9/-../<[АРЕR;1/128bУШy]_lОлХ{Дп╞╟ТagРе}ЛовБuб┘ ╧о│╢обzvв╚╪рю┘ОЪ╞╒┌¤  ъ  З>;@GRdМ╧   ┌ВsjW                                                                                                                                                                                                                                                                                  <61116@MRUW_tЯў   кcZL?C   КUZ\[[WVRMNOLGGFFGMV[]ZTLEA6113=KHB9.+0?LLFA@DG=.-,0:IK:3006DHKKMD;=AE91,,,.05@FD71,+-0;KLG<2../6BGKF;740./4;EF?821249=BGJF?30.00029CEEDDDINLLNNLMKD9332116:EXoП╟║ВYB42036:BJOSH8111113679<=@AB>:210/.-,-0369=EHB<=@AAECA:52110....--.-...-----...07]lm[A320248=DO\emkbVJ=952/-+,+*)*,-.9I[uЛkOA70,()+,.4;FYo\C61,-*+-5E\fjS;1.--08OrРП`?50/29MЗЪБhYOj~yБЬ╕├╜Е_oЧвФк░Иo{┤╫Ї╛▓│▓мРk╡═рэыЮД╡╨╒т· ё   ╜<96.+++-.9CE=0,)).4BMJD80038=BGFB<<4/-04=IF=621159=CFHD840....09>BA;:9;@EJLKMLKD:54568=F_ЖКv}fI7421248=DJNMF;66568875559=?A@9340/--.16:AJK>5658;>CHFGFB?;62///.12221000///01138]vsaOB;=BIS[bid\RIA:40,,,++())))*-1=L[q|`F<3/+*)(*-6?K_w[D6-,+**+3=QjqQ:1.,+.3CgПТe@60..5EfХЦnJAOg{АМЯ▒║├иn`{ЫПГ░л~iЖ╔▄█о▓╕│ЩjН╝╠▀ўрЛЗ╣╟╟тї ╓   °:::BMZy▓   ўЧzv^в                                                                                                                                                                                                                                                                                 O41127?GNQTYqКс   ▄МkZNC:·   оVY\\\ZURLIKJJNMF@IXYUSQKI<4.-3@HIC7/-.>QPICBED>8.-3:@E=4/19CW]_P<;AKG;2/,,-.4DHLC74/.--/28BD<6637987640/137:<:9875344335678;M`vФЗ^WXZUY^YUMGA:51-,*())))(()*+-3AT\mkSB5-*)))**,6CTl|^C91+*+*).9NerT80,**+07XКФnE8...25/.3?GJH=2.-4IQKD@EKF;4038@GG;316>PZSF<63037778@JQTTMLJRa~г▒├q]TNKFBB@BFHHMNNKKKB:652/--.02579>B=;865:?ADC=752.+-037:99:=@BDEIJIONMLGGFFFFGHHGGNY`syrfXYRLGCA=<952/,+*))**++,-1104BQS]YL?7.*((+.,-4@Vu}[C:3.+*+/14HdjS:2-**,.3KxАmT=4./18LyзЗ^F@Lx┤╢Чв▓│╖╕s\iЕЫп╝│ТsqЯ╧╤░▒╖пХ}g{║╬хэєМК╖└┤┐чъ╙     ;89?GUlгЄ   ╜{ГfW                                                                                                                                                                                                                                                                                 й755549EOTUYhЙ╢    ЩybTG:Ф    ╓SXZX[ZVSNMMMKJGBBQW[\VMIA:318>AJKC80,0CJKHCCJKB7244:8<>DHA5.,--.4DG;4244244@FF@5/.-./39?EIF>8402039?EG?53331257@NTPLLLXs░╚╙е`TPOLIDD@@BDEJNMHGHGA631/---./1269;===>AB@=:86420/./0266346789:;=@BDFJLIKJHJGJLMKMWY\`ff[JD><986440//-+*)'))+-///36?LYUPH?83/,*)),05>IaА}Y?91.-+*+05GdkT<3.+*,.3@eup\C30.13CkЮЦeK@AYХ╣╣╡╢░ЫИp[]sЛЭ░┤жdoо╥╨кп▓еКsiО╛╨фш┬}Ынйж╩э▐ч     \78631--,,-/1430:;@=;<<<;=CKY^Q<1/./.-..-.,+**((**,/35;AGLOJD=741-+*(').7EPjЖyX@4,,*)))+2IcbSC3-*+*+2>Oq|cD41.-2=X{НВP=9Bh╕┐╖паДwumecxОЮ╣╛Шm_xдк│╢╡мЧ~gjа┐рц▌Хpж╣┤┤╫Ўр      З78:AK`Ж╦Ї  √ЖsiVЄ                                                                                                                                                                                                                                                                                 ;96555@LSTW_|Ь√   ╝ДiXJ=?     ·TWUYYWUTOJMLLNOJDP\^WRNJG??EI=HLC4.,,+,2:AIB5.,,/5@T`TB91004=GE<7211459CIJE81+++,.2=GLQQIE?8756ITRLx╬▀╫▒iB<AFA941--,,,/3357:;<@B>;9631..-../7:741.---,..-,-,--.1244300.//148E_iO30,,,,+******++**,,-3:FSVUNF<6/.-+*))(*,4FZuУzU?3+*)***,1GheSD8+****-5JgАgF50--,7MoРПa:56E{┼╚░йР|wrjguДЩ▒╝нЗe`В╕╟мп░ЭЗr\y┤═ыщ╔nБ╖▓е╜э№Ў      ┬779@K\|╗ы  ■МskXп                                                                                                                                                                                                                                                                                 >85457=JSVW_xХў   ┘Рp\MA3      БX[[[XWVRPQPONOOIMSX[WSPMHGID??CGHA5.-5BKKCCGLKGB88;@FGC<:==AB>6/49DKI<0-+*+.59EH=3.--19IXXK;73038CKD<4/.037@GKJ@50/,,-19@GLLJHKIFA=95338MUI947;DJGA:62/0258898989;;;>@?:640006:=:7520//---.---,)+,,.//0-,-,,-06C_jT5.-,,-.,,,---,-./27>GTbYXKA961.-+++**-1;La{СrTA6-+(+-/07I_]VG70+++,02>a~eH:2.,.4@bЛСhB76:OЗ╩╚▒аСФХxadxУ░╝мЧq]gС║пблзУ}mbЛ╜╪ффиzЧШЫп┘эЄ       ў668?KWr▒х   ЦunZА                                                                                                                                                                                                                                                                                 Z;6453;GRTU[rОЇ   эШw^QD6       XZZXWXXTOPSQOOLDHMTZ[VQMIGRY:07CHC<3,/FHE6/+*+-04@B@:3..07CNTTE=9437=<=:6;AA<97751/.----,-,,+,,++,-,+++++*.3B_mX92-,,-./../011358DS^gl_TG:41/.,+++,-04ATgzДbF<3/,**+.2:I]^PC60,**)-2>YufI<3.,-3;WЕТnH=56<_Ю╔┬▓вМГГ~Z_xЯ╢░ЫМ`YqШ│л▒╕ЮДsffв─╪▌╦Н{Юее┬тцё        468=HTmвс   аxo^\                                                                                                                                                                                                                                                                                 Б754658DRWUYlИш   ЎЬzbRH:╫      │Y\[YXXZRMMNOOPGBFQ\\ZSMMMLA6//:EFA9,-5BIGECFKLF8000;ILC>738@A=2017?EE=2-+++,.9CD=60.16>GPRL=;8348=IND7/--04:@FHJAHMHGGGB<95331026F^}йг|hI8422127:BHGC=96ERM>3029=EIHB>;;:86661.-./34457:=ADDFEB;838741/.--+***+,,,***+***+*++,1A_nZ90-,,-/0012569CMWcfb[OC:40.---+,,,.16GWdquX<4.-+**+-2>LWZXA2-+)))*->Xg[M;2.,+,5Sy~nU:426Cr╣╠╛ЦqДиЮeRayЭ░гМБXYwЫ▒╡╜дЖwlf~╣╙╒╘ХwИзвЯ┘ыр         >89CLPH84.08AGHD967;AC7..08AGE61-,+*-3=GG>3227;BKTP<88853;FJH@5.--14:BGGC;50/.-/39=DC>78:>DIEFDDB=:754349EyДАyx]95200/0248AHIE=ADMMB5/14;ADEFDC@;74/0.-,-011//259;=;61/,-.,*(**+++**+,+**++*+,/?]o\<4.--/1256=EQ^k_g\QH?73.-,+,++)*+,07OjmoeN93+*****,0BYd`XG2,))))++:WjbQ?0/,,,.AozdC-018Ky║╩нrkФпЕOSfКйкФqO`ДЯм╡╢ИyoflУ╛▄╪оt~ЦЬЗ│ЁЇї         d659CN]~╚   ╟ДvhU                                                                                                                                                                                                                                                                                 є:96757BMSSXc}┴    жocYAq       шY]^^^_XTPQROLMKIKS]c\WVND?4+*.9BFA4,-6AHJB@FMJA8357=FII@:8:>@;3125;BK?73/-+.29DJI@69<==@DIIHC>=BOlЪЛИ~kYF7400110/6:AIKGDHVTE7536;<<=AECB@9330/--,.001/37BBA>832//-,+*,-.,,,-..,+++,--2A^oaH731348>EMY_ghcXJA;9420-,+,,-,,-/3IF;5/1:FIECCEHF=5237BJHFA96;B?74227DHIHLRTI><887898;=@@DC<630000/1127;>DH;78:;<>@CBBB@<:76421/0/1//0/10/--..24F`iaVJ@AELU[Ua]WOGA<6531/---,++,./159DYpf^N?83/.*+,062-+..19ELNOD>98:?BHE<2/28;@FLK>3/.-/14:EOQMEA=51125?@:30.1346689<>><><<BIUfy{a\UQLLPOMJF@:53./.---,,,.-,,018=HZdZPC93/,-/+-/4@Ufot]A3.+**++/;H]hV>0/.,,.4CbДlI93/..6HpЩЩrR\ЗФsPS|бЭЕul^^gВЬонЦsupakХ┴╩└ЫВААБЗ▐эъ           ■68:@IVgжЄ   Уtn\l                                                                                                                                                                                                                                                                                 e703250+'(5IJFA604;HLI<9?HE=7106<>;;;>@?>BFJLJA62//----/258=;72/---/1235689:9:;:>@DFAEBACEMPSSOPUWRbbjrok]PIEC?;96320.-++*++,,++,-.25@KU__SG>4/,+++,).3Cc}z]A2.*)()+1;I[lZ?0,*,*,0@[}rO=2.//39]НЬ{RMf}~fQ\РжХ~qhX[iДд▒Я{x}l`sй╬═зС|w{}иЎї∙            578=ERbЩы   бqn^O                                                                                                                                                                                                                                                                                 Ч=2556;FQTTVpЗ┘   Їе}ebUB╪         g\_`_c`ZSRRNJLONNVWWWUQKE8.((2CMKH=416AHIA9:FKC<6459>LMHD@@FDC;1.04@IH@60./259BLRF?;9745BKI?60/49>DIJH80,--/07@KRQJEEIGB;95BHE?62..../3;EPZhЭ╙э╓Х]D<:=BIMG>8997775458?FJKF;11....-.01479>BCGD><;=<;95111././342310//02456:<<<<=>>AEIMOPONMLOU[_dcI>8433311.--,+))(*,-../025;GUQURJC<50-,,.//38Ih~АY@40/*(+-19G[kXC6/,,0//7+(.:GNJC<629FHB>=AFGC81139JMGC>;AED>72/28BHG=312237?GIGB@;848:CJI=1/059>DIG>50.../38CKKIDEGJHDAA?HJF?43//./15@N\z╖╬ц╗dH;557;DECA<5412110046@HLIE<521//-.-.0147;?ADCAA>98431/000./33410-,,,./001234543579::99999KQNUgАзў   ║f^ZFt          Г\`\_^ZTOKLMNQPMJRY]\YQKD=1)+4?HJGC=42@JIA9;DGG>3..2BKKF?<HNLKRC95/--,.././338:=?A@A=96300101236883.,*)+,-,,.,--.-----.021/..,/5BTgg=2,,*)*+,+***,++-03579BKRWWPF=62/---+++.3:@Y{АziM41.++*(+08J`fO<5.,++,.:GZj_D//.--1>RЕЪ}VBFaХЗ}}БДГorxhOTrУ▓йМvs|liЕ▒╛нЙvwy~а▐Ё°              Ы:8:@GUt▓ц  яГqkW▒                                                                                                                                                                                                                                                                                 976653:KUUXbwЪш   ╠Жkd\JN           ^\Y[\\WRPPNJKQSROU[\UPLFA6--/9FHGD@88:ELJ>5>EFA90+3;FMKC9;>CD@6/-,3>GHC:/279;<;8NSMGILE92/--/12466478:=>?AHD@;513146;EJ:3/-,+,,,,--++,--++,,,.-,,,++-2>RlnC0+++*))+++*+,,+.4:@GQ[WWRG;6/.,+*)***+09F`М~n^E2.*)))**.8LhjP;5,,++,/9FWibF2--,,.6GuжМ^DAIxЧ{jzЦФkZqwaO[Д╕╣ТzsmhcqЩ╝╢ЧzewАО╗эї·              ╓579EHIF=8;@GKG;:DGD?954:BHJF;9>DGGA3.,.7BHGB<8=EGB:BHE;78;:BDEGLKC:7679BjСХyocN>41.---/26:@FG=5411114@MRK>:77?INF=61/,*+,,,-,-++,,+++,,,**++++,1=UpwJ3-,..++--,-.1149DOW]dYOF>85/.-,,++-..29HeГueTC4/,)(*+,.2NjfO=3,+-,,.6@YmaF4/,,..4CiЪЯsOAH_ТДktРШuUh~mUQmЧ╖▒Кndfluв╣пЗnuЕЗЪ╩їЄ                679AEGB83-.2:ELJHJLJF?9730-,,++,+,,,*****+,*+,++*+,-0?YvАS71//../02146:DNWbaZ[MA:501/--,.---/08>Kc|gSF;60,++,.17AWraK=4-,+,,.5^ЖМУjH@Pn{ouМЭГ_Yzy[M\Ак╡Э|jd`kЗЬ▓пХzuБДЕ┤т·                 678;EOaЙ╧√  ж|t`M                                                                                                                                                                                                                                                                                 ж60567:GSWU[mБ─   √н|j_R<т           ЄSZ]^]YVRPOOPOQPKNTWTQOMF?9/+.09CGFI;8?KTVXNKHGE><99?GJF;<>BEE?8/,-4=JOPRSRI603:AE@7359?EIOSD61/--.5;GNMGF?85336:HLE910///0/3>HLRTV\jЕ╪▐╦РbVQIC;41210/006?EDA=:8649AQUJ<:<>BFHGIA:61.-+,+,,+--/158Zx~\;53003379CDEB@@ENVVSNHEC@=44:AJMD8:@CFG?1,+.9DNQWZTC0..6CHD8415:BFJLMB6/.+--7CJMLJID<7327AGGB:1/-,,-04;HPV]cy┐°ы─}ZNNMI@9754220258?AB@><:;=ESYOC<=;:B@=CLQTTLHD;640/./.-,,*))**++*)*++)*++0>Vr~i@9779;ELYhqusg\OE:40.,,+***+,,-/15AMPX[OE;0-,++*,+4>OjАdH:0+++**+.52-,.3;DIKFFJIEB93>EIIE93/.-./12>LT[jб╨я▄нgUNLKHHHHC=<:889;=?@@BGLRPOSYQ>866667:>ADA<842/-.24.,/158;;;9:<>AFJFDDCA<87631//-+,,--/..,,--.023BVlБu_NJNSYb\jkcYQE>863/--,+**+-100049HVPQLB;82.-,,/147>Qq|]I;.++-+*-3AWdYK;3-,--.4?WxУжкnMDTtГ{ЛЪЪЖtv}oUSmЦ╖аЗ{xzzsxевСАtsz|Ъ┘шу                  б79:AJShат  ▀ТogXП                                                                                                                                                                                                                                                                                 >83426@ORQXavЯ∙   ╫ЕxaY@S             ▄WZ]]]YYUSSQPQPIJPVTQOJGC<621157005=O[\UNF?:358<@CA=;83101100156664213689;>@BEEEC=?<<===<;:9755666678:=AGP\pВpjgd`[XURLGA>975320-+**++-//238@GR[NIB;841/+,-/48?F^|{ZA81.+++,.1B[f\K<1.++-.5CGJFABIOKB;9:678;DI:/,./25AIHB91,,-/3:GLF::AFIPLHMPNF>5/-.///4:NhИ╝┘╓yT=55234:BFE@=5443221137;BGFENUP:0/00/-.0668<>AD<524565432/-+++**+-665556789:99>DEJDDDDHGGIKJJMPSNUV]knib[QG><:774320...,+)()*,-.157@KV]]QD;531//.,-.2;DJiЛzXB80--,+-.4F[c_R9.,,+,-19SluvВС{KAWxРЧЮЦМ~iayyXXxбмПtzwwvwЗлЬ}g^_gwй╨▀▌                    9=?FKQ^Ж╦   кun_L                                                                                                                                                                                                                                                                                 Н:0003:CSTUYmЗ╚   сР{_\C9               `Z\^`^[WSRPLNQQMKSVSMIIE?:5..3:AGHIGDFJOJ;6:@EGG@>FSTUL<447>DB:7=EUf\PF<5;?=769?CA7.++,17@HIA62.-,/7CFIC:9=BFLKMPPOG951///119NnХзРz^C6430.04:BGB98400/.0/015:@EIOTP;2-,..-,.2247?ABCEFJMMLLOQOMLKOYahJ@=951/..-,++*++))))++-.4;EQ]Z[UH:4--.-+**+-/:MbzЩ{WA3*+**+,-2GbghX?-+))**.4PspgrТЦ`?GkЛТЦОДЗrdpДhNgЫкНn{~|}|ГЭвЖubZ]iО╠╙╬                     8FcАeTLJD73:>>;:>FC<4-*+.37?HID;62./5;2,-.7BEEFGHHLMKE;5;GKPTZ_c\SKA724:AFHX|Ж_SMKF9538=>=;8GRdДКP8:GK@5316=A@@DHC90-,.,09COTID>853172//.01236=BC@;51.-,,,,,.2>EFIH?630.,*,-.0111.-069;>::5.*)(*))*-12/.,*))())((*+*****))(**,,,---.06FciM9/++*+++,-/14778;AL[_b]ULC:61/,+*((()+-16H]juuV:51/.,**+0>P_hkM8/-,+)*.9HYptXVvОvH7-'+9@EFD@CDJNMF779CLUalv_VRLD733=JViЗr?54:CH?3238?DCBFKE7--.,-1:JMOIEC<676=GIC94../034:@HOSRRUo╜∙°┌~`LJMG=54011/..49?ED>:6.++*,-,.1:BFIIG@952011./.-*'%&'+28:=::962/-,.0463.-****))((()))&()(('((**+**+)*,2FfqR<-)**,,--/239=DLUakfbTH?911+***)(')*+,19LfkpeL92,,+*+*-1C[jmhN4-+))+)*4DVju^HaКЙ]6=PrНМsbz|wАhV|зХoaqИВ}ХаОqdVPPZБ└╣╜                       ш77:@FO`Ж╟∙  вlmXT                                                                                                                                                                                                                                                                                 o90.018DOQT\mЙ╖   эМj[PC=                 ТWYYZYXXSOPPQT[RORTRJBCEB:2**3?EEDA?DKPRM@66=GR]g|kSKMK@8:BNY_^XA536=GG=5359=ABEHHA4/./--2AIKHEFGA=;8@GG@841011009CJRWZdд╤єю╣n^QJHIE@;8430.03669>@?;60--./-.0=MSPGDDEDA65/,**('%%&'()+/2357:9:99;<=;83.-..*)**+++++**)*)**))*++,,,,.5EcwX=1,,//0.17>HR[gb`dWLD;730.0,**+***+,-.6Kdc^TF83.,.--025EZfneL7/+())--2>RkrXBRxКrM=Ba}|kapБxnqpmДЮХufiuyt{ГТФaSRQR_К┐╛·                        689AHO[z┐Ї  ╢sq]O                                                                                                                                                                                                                                                                                 Э941127ASUTYiЙк   ∙Ъn^RE9                  bWWXYXWTSSRPNSUSSTTQHFDB>8/--4=AA?ADIORPI?36@LV`ДЯkLHJIE@UyАlZTF=538ADE:3135:?BEE@;4.,,-17ALJCADFBDDBDJMD8420/-039CNUaz╦▐э╓П^YTNKIGEDA=:8876589;@B?<865679;AHOSRF@ACD@;9.+)(&&$#"$%&&(*,,/6:;?@EFBB=97420--,,+++*++++**++*+,-./.-..5E\g\D725688@ISal_d]TLD<8320/-+,+*-,--..5>J[i\PE:62-,+,-07=QjonaJ62-+)*-17;RilUCEamvcGBSuzk]b}|bp||~НЮe]gvwx|СгСhQQUSTkг╝┴                         9:RVVXdАЫ    кs`TG:я                 °UWX[ZWUVTSRPPSSSSSSPHECB=6--,5=AA?@EKRUPI806DP_ЛСmRHHKO_vКШЕQOHB<64;===@?@?CCA><=:HNOPPE;57;=<<6/,*&%%#""#$%%())+/8888;:85210.,,--.,--..-.//0010/.17FcugNCCGKRW][^e]VK?71..,./-++)()++-034;DKWbQE=41/,+)*+.5BZutu_E62.,+*+/9@WogQC@IvТuNCQgpn]Tav{Б}u{ЩЭmY^nwruУкЬwWKILL^ЙЯБ                          U8;>ELTiЮш  ╨ГnaK║                                                                                                                                                                                                                                                                                 :74410;OTTU^yУ    ┼xgUH;╡                  ЪTY[\ZWVROPPRXUQPTUTIFEBB?6,,09ACA:?GOSSM=639EVgy`PKLOSiШ┬оkHHIFB>97>D@72.,,/48<@C=40-+,.2;BHG@8?EIOPPMMKC83/-,-03>PkЦ▀╤ТaI3433247:BIHB<;89887788;=@DDA:8789@MRC.,-/6;;?:2-+('%%$$$$%'*.0241.37:<:962112234433245578;=>FUemqg][]_W]WRMGB=752.+**,,+*)))*+,.5:FRW\WJ>6.,,+*))*-1DcГ|xaD3/,,-,+.6AZxrVB::\ТЙYCM`ktcNSqГДГБpsОбЙ\VepklБмеЕeOBGGPtХН╛                          69:DLSbП┘  ╪КobRЕ                                                                                                                                                                                                                                                                                 6665537KWUSZsЛ    ▌АoVI>Г                   bXZ\^YXUSQRRSWVSSWZNIGCCB@70.8BFHA<@HOQRG;55=MXWOIIMTYp╡╡~RFCGGDCA<9?GA820/./1685:=DKOKIKJB70.,/49DZzЩЪвГ\>2//.--.49@EB:30-,,,-/.,29=AB;.0/1:FMA,))+,048@A=83+)(&&''*,./010,*)0754379;=><><=<=<;CBBCCCDDGGIJLQSSSTU[cif_WSOKHDA=:85311.,+*)+--,*++-/3:CP\YVMA630-.-++,-03Ec|~{_E80-+,-/27C_АzdM==IsВrVL[uДaJNh}reДВЗЦЫОuXY]biuМЪПsZMJLOZ{СЙ                           ░59=EKP\А├  ▐ОneY_                                                                                                                                                                                                                                                                                 Y:41105HPRRXpЗч   цВsUL@X                    TVWXUVWWUSRNRVXVTURNHEDCCB:21;EFD?;=FNNOE859CGMJEJW^kzvn[B6;FGEBBCA=AC?80-,-.146=C?:630123;CED=668;BFDFFEA93328?VЛ┤Э|ubPA200-,++-49;753333110.-,+*(*+-.//033;HRZ_RF?950.,())+-06;Sv~pdO=72/,,.05@<9851240/*)''#$*0/+++.---,,,,+,+,,.366669==<==??>=<97;GRUP@2./.--,+,--+*)((*,,.1468:ESWZYOA810.,*(&&(+/5<[АГs`M93/-,-,/4:QotljaG;ItЩuY_xЕtPDFby~ЖННМООГp[QQUZkШ░ЗiXQOSUhГ}Ж                             229@EFEC@8/()('().7?GIFB:1005?HG:30--,.17BKPURP`v▒ь°╓pZUNF=5-*'&'&'(+5<>?8/+*(&&&$&'*-18?=:>KPB*&$$$$%$')-6;=CCDB=:;.+)'''%%)/0+)*-,+)***)*++)*,.../0012200....---4=Tm\?.-*+*)))+,+()))*+-049@JT[d_VNC:3.,,*)('&(*/8FaЗmZF42-,,+,-5;=EEA959>DMKD<52@MS[~─╩оvYJ@3/19@B@<>@DEFC;60.,)(**39CHHFHB;989CHD@72/,,/29BJTWXhе╬юЇ┤fLHHHFD6,('(((&).38=@93-)&%%%$&'*-06=?DPPF/)&%&'%%'),/88;@CEEC?81-))('(*/0-++-,++**,,-,*)),-,+*+,../--+,+,+,-0;VhaC1/+++++*,--,+,-./08?L[d]bTJC=73-++,+**)),/6C`rcSD72/-.0148=Xy}mbdj_RLO[oААБ|qZD=[jjmЗаЦУЙxi\OMUe~РЖuf^YX]cm{w╔                              \7:=BGMYv╟╪сУofePв                                                                                                                                                                                                                                                                                 =6....;IRVV]|Щё   нydUF;╕                      WSVWXYYTNPSTWZXTTURNGKKLMLD;=GGE@806;;:CHG>50,++-18DTVZ~╠▐хуБ]NGFKOJ=4-***(&(+/4:=?;3,*&&&&&'')+/6@GNRJ3.*(*****-..4216?:50-,-/121/--.--,+*+**)))*+*))**,++,--*++++-.19SsfE2.*+,-../0//026:BO\fombUG;731/,+*)**++,/6?J`xcQF;63/.-/17=FdЗwaRHAFKIGHSjy}th_WNCBM\`hИМСЕwiYMMN[sЖИАld_XX[ayЗ                               Ж93.04BLJ>25E^Вм╗╣lOIKH@71.17::7626<@??91.+)((*+1:ADDDECEE@:DJG;1,))*,09HWcЧ╫ш█Щ_UMIGILOG?70--*))+++.37.*')))((**,-6@FMND71../1.--,*,*+,-/0479:89:98:;;60/../--++**))**++)((***())+*)**+,--08PrgG2.+---./.1359CO]hsmeYLA940..-++*()**,.09DM[dUH@8431.+,/8@MiКvbN>7;@=<>COkslcVKC>:;AHQaЖЛБsdTKLLUcАЦОob\VUW`tЗi                                ┴;ALOMMP`О╚╠Ыn^_UN                                                                                                                                                                                                                                                                                 `521117APXWZlИ╜   тИjYK>c                       ФXYWUQUWVUSPOTTTUUTRONNKLPQH@DIHB71,0=HIG>4MmХ╢▒zGACFII?2/.18><42149<<>91,*(('(-3;A@9ADEFJMHC=;84.-.---69?DA92/-,,,,-..15:BJNLGB=:63..-,+*)'()*+,.1468;=>GDB=954210.-,+*)**,-+)))))*(()+****,,+,.5OokK51-./137;@HP[ejgcYPG@83-,*)**)'''(),.3CU\_XI<841-,+-,.6AStОs[K;478859>GXlldTC;8689=CToБseWLHMPXawХЦva_ZYY`sЖkа                                ∙;FLQRMLWr║┬аjW[VG                                                                                                                                                                                                                                                                                 Ф83/0/5>MXZZdЙм   √Оo]NA>                        tWXXUTUVTTRQTTRRTVSQPRPKMPUIEFIF=81/7AGNMTcГл╡ЛY@87?<46;ADJIHKLG8.,,-07H_ЖаггПYC:999:;=DIIKMKG@;;<<::<@DDE?=<9899;;=CGLNNPKICA@<51/-,+*(')((()())*059;AGFEEEB?;72.---,,--.,++**+,++,-,+++--//0:OsoT?658:=BKSX\[ZUOID>=<82-++))**+*)++-29I\VVPE<962.+)+//7AVuВmXMB?DC88:?JU_fhaK=78:79:Mhys_\OMR[bjvПЛwddc][^jxtc                                  ;BHJKJLPiд╣Яl^cYKЄ                                                                                                                                                                                                                                                                                ╬884424;LVVVaЗв№   ЪvaQB8                         aWX[XUWTSQQSUSPPRSRMNKJIKPONJIHD=6338EUVZЩ╞╚оjW?734;DD@92038:559>CIGFGGD;1237DXЧФНМqNB8521238:@GLNMH?;=>=;9;=?@CDBGA<;;<;;?AEHFMFCCBA=97545541.---..-/111123479F[|}_LF@H^aJ8:?Phsleb^O?8?FD@Hbtpg`XSV_kttЛНyiff_Z^emqd                                   ><;;<=>??ACFIKNPU[flm^USILJFB?<;951./.---+++('&&)+-.03FILOTq}yjV[[L                                                                                                                                                                                                                                                                                 98221/6FQRR[wРЇ   ─ДjVE;╛                         ▌SWWSWYWTRROQSRQPRQOLHEELORPONKG@:45BCC?828>>;83.--17;?E>831./049<>;3,-048;@CGJJGSwзЄ√╪ГUSPD94/-,+..249BJHD>72100./00138=@AB<54-../4AG@6/037;@>@<62-)(('((*---.03650/./06:978;=??BDGKMJMIJIFIEIEGGHMITVTTSRW\_YOG>:7420..-,,)*)))')**((()*-18?KWWWSH>9310//..-./7HYmЖpUD8.6F^vmJ9NksrhXM`tU?B[rgcflsw{uYZkwvzИМyf\YUYYj|vp                                    Н79?DHKKJ_y{dTX]QX                                                                                                                                                                                                                                                                                 M621017FPUSZrМр   рСrZLAС                          дTWUVWZ[VRQRRTVSRRQPNKHKNPQQPPMHD?>HbВЙбЯГbJEEG>6236<3/--19?CFD?;73216=@?;3/./147=FKWatЫс∙ ╗uNKLNC941/-.0116@A?;;==<<=>=<aЗ{\KSdsygSQhДfJFVlpiovpdfxlikqruВМ}h_\[Z[j{u^                                     ╟7=?BEHHJR]b]RS[TD                                                                                                                                                                                                                                                                                 v<50106COQQXmЖ╞   ьЭx_MC`                           |STUTUWVUTROOSSSRRQOLHHJNOPRRPKIEGXАп╘▓ЙmZIFEEB<7135?=95/..1:BDFB@<84537=A=85./0147?JTcИ╚  ъЦeHGEIKD931../0.159@GHE?701..-...0368<::75311//-/474.-++*,,+,+,+,,---/003321/02000.//01210015=QYTE6..-+*))+)))++**--//00059FT`dcTF?976210//10148EVfloVB;7559SАДhZaiqwePL^|xUHScmtwyl\_pwedjpvЖ{kca^\]b{xa╖                                     ■9<=?DIGEN_e^RT_XF                                                                                                                                                                                                                                                                                 к=;3216COTTVhЕ│   ∙Я~bNC@                            gUWVUTVXSTROPTVRPQQPHDHMPPPRXRQOUy╦▌┘╢~`TKFGHGC<5117?GKJHC==@A>;3-,/3:BEECDD>9857>A=:4101246CQgб▀ Ў▓x]IHGHKJC82/.0///123;FHGE<40,,-.../1359CFDC<99AOH9.+*+*+*+,/:;9::=?831..144/-,*((*)*))*)))*+,,----,++,-,,++)(++-,++.07Md_I5,++)('')'()**++01245:AIS^]WOD:7423100.-.0457JaijhP>71008Jkxrooqy`JGRf{mKHax~~}dRZovk^inu~Бulg_[ZZ_jvmv                                       8>?>BEGEHV`]RU[XH╤                                                                                                                                                                                                                                                                                ы?;/104DRTUZdЕбЁ  ¤ЪГfPE8                             ]WXVTRRLORTTSRPOPPOLIGKMMMMQTUTaЮ█ттйkXTOJEHKH@73,09BHLLIFBBDEB61..04@;6545870,+**(*)*))((''(*++++*((((()*))((('),*))),2IX\L4+)(('&()))*+,,-16;BM^mmlZJA:43////...,--06>QongYH:5/./3A[~БxrvЕКkF>G[sxXARsЖД~hNRhvm]eqv|}smhb\VVYbv|b                                        G::<@CDBGQVVRU]ZJШ                                                                                                                                                                                                                                                                                 ><01/4?OZYY_ВЧч   йДjRG:√                             XWWTSUQOQUVRQPMORTQOMMMMLMLS]aoд╤▄├{YVUQOILKHD=81.2:BIMJKIGGGH=710136<@@>>DIEFB=;CG=72013:KeoЕЬбаhRB><@FEDDEGB<<97411234;CIIKD:4/-/01356;BGHHGIKMLJ=510/.,+*-.-,,-.2:>B<>??=830,*+++*+,**)'&)--,,+()((()*())(*+))*+*)(+.I`fQ7+**)(***,,,-.05=N\ellaWMF>832/////-/../3:EUfaZPE:52.0450/3;CGHHJJGHHD<501037;>>:9?DDFFDBDC?6247DZП╢╝вМxYJ>8779;CEIJC95334256;EJIGHHJNOONF=742/,++*((((((+/58:=ACBD:641.,,-,++**))+,,-++)))(()))*((())(')+*,./I_jX:.,,-,,,-.059BKWdsnf[OD?97532/111110134:DO\cWLC<7401016FhПМЖПФЙnM?JhwfMK\vДЗwcPN_prmlouxwpg]\[ZY^m}aЙ                                         Щ7:?DHFBDINPNPWVOH                                                                                                                                                                                                                                                                                 c=20008ESVUXoЗ┤   ╤СsYK:П                              ║PQQPQUUSQNMORPPPRQPNMKMPSSh{АqoД_D;>CHJHCFLMID;4015:AEDBAAEIEA=930/27;<:815:?EHGDDE>99=OМ╬шы─r_QH>63214249@HMMLJIIBB>B@@BDFHHDB===<<@EIHHFHGIMQTQLE<51,)('&%%%&&')+/1479<=>@=?=9640/...,**,+-,*+)**)))*())(((('()*++-1G\m]@2.0000049BKT\aa^TJB<62/21112000//0367@INTWLA;543211/4C[{МЗЗОСП}WEFZjiZHMmЕЖmWJZklgfmqw{sica`[X_knZ^                                          ╥69?EFJFBCLSNLT[SD                                                                                                                                                                                                                                                                                 Ж720/15APWVWjБдЁ  уЭz[M?@CECA>6-..3;==<9579>DHEDDCA?Bg├▀°ЎдQONI@84///004;BIPPJDBA@>>=>??BDGHIIIFBCEGEDCCC@@>?FNMID<2.(('%%&$$$&(,,00578::;<=??=@@@;52/./00/...+*+**++**)(()**))++-.4C_pfI778;>CFJQYYXUPLD=730/..///011/.0/17>JXTSMC96210011/-9QtРЩЗГЕКБbBAR_jgRFdВДВyfLTjjedkouzrhb``[W]iobM                                            58<@EHGD@AIOOPURGъ                                                                                                                                                                                                                                                                                ┴;5./04>MTVYeЫр   й~_Q@J                                qQVTRRTTRSQPOPRQRUVROMOUYП└╔║bRG@73582014>DEA>=;>AA@;5/147:<=>94346;@@BEIQc}╗╪х├zHDFKIB;5101136:AHONE>946655678:;BIPNKGCCCBA?;79;;=BIIIFD?;3,)'%&%$%(+-./38754566778:=AACDDC>=<8787640.,,,..--,*+,-,-./225Kcnh\QLMNJJLJIFD?<9844//../.0123331348>FQ]TLF=75212111206A_ЕШОБ~|{lSBBcxn[Te~yxrjc`giiimtzrg`][[U\chcU╬                                            89:=EJHHDCGKNR[XLп                                                                                                                                                                                                                                                                                ∙;91124;JWUT_yЧ╒   ╣ВcTB=                                 dRTSRPQNPQPOPRQRTTSROMUbФ┬╔ж^QJE:434:EHGDCEFHD@;4137>EHB:;;=??><84346;<=;842257:>BJVhонЯЖbAA@DGFA9400/113;CGMKC8721100/105;EOPMLJECB?=9<==;8>IHEFGG@<70,*)'&'+--/27851/,.,./035:?@ABCBAFCAA@BA==:99986778779;=>@BENWamhYXRKIGC=9733222100//004113456788ALSWXMC<743012344439>UvГxponqm\HDXyr_]pГyoswpdZcllmry{la_\[\^\cfi[Е                                             K8;>CFDDABELNRTVNz                                                                                                                                                                                                                                                                                 :;-/039ETQRXnМ╚   ┬ДfWE>                                  ^QSTRPNPRRPSTROQSSSRQU_УгЛrQQKHA8321@BBFFA;4348?FKB8757=A@A<74338=>=82.0268GU[hАГБk[MA<<;@EFA74110/.-7>DLMF>62/----./7BIJJLRMF@;5=AAB?:;DA<88;=?B=60,*()--.028:60-*)**+*,,+0243268ECGFFIHOSZ]YQE<862.++,,+-..-,./00.133599;?@KYWTRE9621110154678:?Usvk`\ZuzcIEXuuejx|ndpvjXWkxnlqxxj]][\^_\[js`e                                              p6;@DHHEBACINQRUOS                                                                                                                                                                                                                                                                                 J<11136ARSSWiГ├   ╘ОfXHA═                                  SPRRPNQQPNQUXTPRVWSRY\lА{^DGJHE=6034>GG@:;<@FF?74/38=EIA6447;74147H[dedhke]SMIE?>>BIIB963/...16?GNRF:5.,++,,/6;5./34468;92.+(('()))(),-++-.//256798799:<>?>?A@><>?>==@?AAP[\Q83.,*)*)*)))*,++.03322447:CPY`i[PF<441//./14999767;DD@95349?HJA8447>GMRLC<83?CB@<98G\bloWQSTQNKHIFGHHHIH@:52/..138@=;9:;::4/,+))))**()*))))*)+-/0012///024556531002230/038H\eU90,*)*()(*,.01//2678788?GScibhXI>61100../1770013MQNKHDB@CFFFIR]__ZQJJIHFCB?BCEHHHIEGB:63123447;CFIE=63./0015;@<:@EJLOOROIDB@BEA4-,*,.149?DDHGDB?@A951-.-+*++**))+*)(*+**++,,+,+,,,--,++,+,+,+-++,+-1A\jW91,*+,+*,013454689:<>AO\gomaUH=84110///039@SibWZeneOGDGXtoVMJWrИПЩМБxmgjb\ahmqvzwogca_`_^ajteH┼                                                 5:AOMJHCCITTPW]XH╦                                                                                                                                                                                                                                                                                ┌:81/02:JXTV`~Юь  ¤┬~fLEG                                    ▓KOQQRSRQQOORWVSTW][WVQLJFCBCEEB?:66:=@@:2125=CBB=75;@CF?4/17>HMNNKILLKIJSgWOJE@93:@BA=947:<<>>=ADGGFB>95447<;EJFA:502313578=>CFIJMQQMGBEHIC91.+-//1238730/.,+***))**)(()*+**)('(+(&&'())((((()((()**)),:Wk[<0+)*./.-/148:;===DLVdtmfYOD<631/.--+./15@VmodbgkmbG=CPakfICSmЙЧбПБzognnYXdptw{wsia`_]][aij^RМ                                                  79BLOKIHFJUXUZ\VKС                                                                                                                                                                                                                                                                                 ;=0//19GQPU\vП╧   ╚АiNF8                                     ШNRPOOPQOLORSRSUUZYVRONJG@@ABEFDA:438>?>92/37>GGEA;8?CDC=5/37@JPQPVZUNHKYRMD<53///6>A<86221368:;>GMNNLJGCA@@BCHKIA<9552135=CDFFGINTSQPPQQQH=40.-/..//0259=@BDDDA<9641/--,,++*)('))*))'&&%'&&(('('%%&&&%&&''&(()*7Tj`@1+,-/001359<@DLS\higmaVL?84./..++,+-.00:PmrqgdhrrT=63:?AC=414:CGGJKEA=:510112036?JQNKIJHLNGHGIIHFCD@:779?@@==>?>:51.---,**))++,****)*(()((((''&'&(''))))),.7QheH433434668;CJR]fblkaVMD@:764.-.00,,./24;HYmwj^ajj_FADUmrWCHWuФЮЛu||xvp_LVhsvv|~l^\]_``bhhdXZ                                                    }7EOTTW\_MB=>?BB>842010237<@=5311/../16?HPMEEEDBACEEEDEEFJHB?ACBHHGGJORQTQPRWTSOB92+,,,,--...18;845367;=@>B>>=9630.-,--.-,++*)*)*+****+****+***+++,./:ObcTG:8:<@CGLS[\[b_YOHA<774431/,-//01236:CMV_i\PUbi`N@?Pip^JLWlИЛvhw|xqcRScmtx||q`^acbccfgeZV                                                     м5:@DFFFGMTX[\\[SE                                                                                                                                                                                                                                                                                 А?3.,.3=OSTUa{ЯЇ  фФ|XP=а                                       vLQOJHMOOQQSUUNPRTWXUPNNIA<>BDFGHH>7<@CB<628>CHKMMIHKNNLMT[WPOOPG>85566;>@?=9443236:40..---05:FOJEA>:644558:=CFHFB><::=BDHR[__SJIMQRRK@6/--..-,.-.27951..--/1369<>@C?C?<9645430/.--,,+-,*-,,,+,,..--///058JSX[]SJLS]aWA:Neg[UUUkД{f_nxrlke^X[kry|ofbbcefddggXH                                                      ь6<>BEEFGHOZ\_^ZSGъ                                                                                                                                                                                                                                                                                ╢:51..19JUUS]yХ▐  ьб[R>m                                        fKMLNOONOPRSURORUXZYTMLLHA9@EGHIKIA:?EHC:738@GINNMQTVTRT^\TLF@AA<622238:AEEFA<83258=B?940.-+,.05;DMKC=8/121../08@EIHA9:8>BL^ntx]LEA?GPQQLB:5000//0..5:92,,+***+,/258:<>ABAB@=>??=9775300221100213343368:<>CHTdpxxVUPQSPNLID@<9730/....---//-,-,26;AIWgaYRF=CIWcYD8Eak_X^dsДqYSbrnhjjbUUdqxА~occbcdeedhkXFЇ                                                       19>DDEGGFGOXZXUSJо                                                                                                                                                                                                                                                                                Є<7/,-/6EPUT]qУ└  ¤│{_SAP                                         YIMPQPPOPPRTVSTVY]ZXQMMNLG?CGIIKMPIABHGA<86:AGMPUZ`a[OLPSKB;::=>:400/37>:9ACB=82/-///269DJJG?520/-,,.269@FHD>@BRgvtzbOA8359GKMNLJIC>92.0/4:;71.,+*)***+,,-..26:?=98=;;75541--.//1/../1312/3:CMWcmj`RF>>AScYG=CUfijjjoАkXRYdlikneYVbmzБ{pgdecdefhnsXCу                                                        78CHIJIGEDFPVYZYNu                                                                                                                                                                                                                                                                                 :92.-/3AQROWlРп   ╟~bTD:                                          YINTTRRRQSTVXYWXZXVRQPOMLE>730037;BGFCDHIEFDBDEB<63/.00236:BJJD;720//-./058=CGEHSpxkfVE=62138?CFFHJLNKGB;58:;;70,+**((***+*,,--/12469:<=?ACCEDHIJIIQLOLNNLOJOLLNKIIILPU\ZP?:97756531//.-,.-//00346889@EQaecijjWG?>@PcYG@DOekmqsvt_MMR_mroreXWbp{ЖyoggfedegjnmZC├                                                         U;EGIHGEB@DKQSVWQM                                                                                                                                                                                                                                                                                 I=1.-.2@BCDBCCB@=:600233267;CGEC:20/--,--06;BHKekf]PB;51/-0381.,++)*)))))**))***++,.058:<;=>CDEEEHIGBBCEC?@@>>>?=>>EQ]]F732/.000/-,+,..//-.02569B@:878;>>=?AECDA<9875379>FHDA;40/--...27;BLU]_SA<220-./5::9979=AEKNMOKJF?:51.,+++*))))**)())*+*++.14789:>CDDEFFFFC@@@?=?;7556426>L^cG3/.,,--,,,,+++-.//028>INNSUR?∙                                                                                                                                                                                                                                                                                Ы<410009NTTS^xН   ·Ьq^IAе                                            UMVbcb`\Y[^^ab^ZYWUTSROLIDADMRSPLLPUZTSU[[MFFFEB>:58=>@@>>;89>?CF>830269=?=95535579;?EHJJHIIJE?>>BFDEGB:520213359:HJNQOD>:8799;@CLE9556:=@CFILKPMHA:31/.,++**,,,*+**++++,-.+/479<@BBCECA?<;;;996412110019J]eK52.---./0010..02457>FUfosrg]QGKRV]ZH>@NZYQC:E\ovzqkrxkO@NaihjicfkwИЛziihiijiipxs^J║                                                            Ї:>ACDFDB@AEHLRXSC┐                                                                                                                                                                                                                                                                                ═C<3.-.6JRQPZpАь   ╕udNE{                                             RPW]`_^\ZZ[\]a^_[WUVSQSRIGLR[c\TV^b]VQQNF@>7;?@=;7368;?CDFC>>ACEE@72348<>><743121257?CFKMKJIIE@==<=GD>84111257:?CEHJHFHD=8410.-+-,++++++,,+++,+.0247:;===<;976541100/....0/7FZhP71-,.//12243378;?ESbp|ttqbQKCCLUZYKHIMKHEECFE@832/59<>=8210//023;DFEBCCCAACCCA>>@FKHDBB@AC??>@BCEGIGFEB@>:=?>6./,..02344=@?>?CFDGE?<:62///-,+++,,,,++*+,-..234442.0100/.+.,,,..,-.4AS`U91.-/001347:>DMXeoqirkea_UC:ACO]YF9@JW_[NAM\dhhZPdtmVLT_acflnnmБСМ{olijkmmp{ДviT█                                                               ::<@EFEA?>DEJOVUM^                                                                                                                                                                                                                                                                                 A@4-,,2CMPQU`qм   тВpSG;                                               PILHFMKLLNPQQQTZ]][URW^fpuМаЙj[XTQMGBAA?;2014:><<94147AFJMPMLLLIHB922147:<<731.../35CJPIDA<998887778:AFFIIFC>7;>:5/-.--.-.39:658Wk\<40.2356:@IT`irlnmbYWS`cYF7=EPZWF6;ETabVN[gfdZMF]qjUKQ]cchlpqtЖЦКzrpnllmovЕНyiY°                                                                d>@>BEFDACIJKNUYTB                                                                                                                                                                                                                                                                                 XB500.0?KQQR[oЪў  фЕwVI<                                                MACIOKFHJIKLJGOWZWUTXdzа╠╙╙зoTOKDCAABAA>9437::<==:536;?EJPPMQONKIF:42/18<>@:30///2219DFA=:53330.0158?EKFA<:53021200439=CIOPNHDA>71.---..03697533269;<@DFBEFEDB@<9764/,,---,-,-.//..--,,----.0/...///4AZpaE:769@EIQ[imfmd^VPJIIXcXG>>BR`WH>>APbhaYbkaWQJHWldYRQXgponoptБУЖvrqqqopouДЙ{k`                                                                  Л=A?=BFECBFKMQUZZA                                                                                                                                                                                                                                                                                 А@6//./:HPRRWmЙё  ьЙ}YK=р                                                KAJJIIHHGGIFFJMMNRX^zж╧ш▀╒лdNKFC<=>?@A?><98856A@@<7589=HLJHNQOKHFD=75359>>@;40/-/.159?C?;8530////038;AFEB=710100/./149=CJQNONKH>210/10/0136740-/121269=ACFFHIEHHGDA<9442010/./00///-./0//0/00/113358FaugNIIKRUP]`^]ZUNEBAABETaXF??DRaWGABFXmolhhgeOHCGVgdYUSWgrrvuvv{З~tutrsrsvБМИvfj                                                                   ┴9<=?CB>:62;?AA=8448>CFC?@?@CECEC@;88;9AD>60/-.0025;B@;950/.--,,-69?GHGC820/.,*,,/0027AKNRSOIB<84311//37851---.,,---/3469=ACFHKLHKIIFB??<;;:96643233356557:<>?BCJVcklRUPLMLJGGJMLE@:56:CQaTF@>DTbTGCCI_utvlded]D@CFGEDBELPRTUUDе                                                                                                                                                                                                                                                                                ы;51/./3BPTQQcu╜  √Ш~^NA}                                                  VDJJJJKLJGFHJKLPU_|пфЎрУnXKKHD@=:8;@@BDFFFFA:>BDB>7/369@BA@?;;=>BFGHHECCCFD>6.-,--.26=BA>:3.-,,++,/25;BFEA910/,,,,..-.38?FLSTMJFB;742.005850.,++))****+,,.137;ADFGFDGKJINFJJHHHHECBABEFDCDFFFIGKKOU\_[UOGDB?>:BJNHA8223=P[SA=9BTbWDCCKbxuvmdbfcL:>MZ_aPBPhrqr{В}wtrptw{{|z{ЛЬР|fД                                                                      4<>EHHHFDAHMQSTTGn                                                                                                                                                                                                                                                                                 @;2/-.2ANSTS_wг   о}eQBS                                                   `BGILNOOJIIJKMQT]mНокбsbVQQLGED=98?ABFGGIJLDFDCEDFBCDEDDCDDEHOYYPC<;;:9@DILF;668BQXRFB@FXcYLOOWhsojaW^gcQ?BGWedQDRfnlp|Жxusrx~ВГБ~АНЫПАjг                                                                       @;?EIJJFDEMPRUVTJI                                                                                                                                                                                                                                                                                 @:60.02=KQQPZmФў  ┼iSB<                                                    k@EIKLLJIJJKMNNV_j~Кr[XTTSRNIGC><9<@CCEHIJNIEFGGE@;8679@FD@=836;5//.-**)*+,*+*+*+--..001.01245788;:;;<<>@?<::;;9:;==<<;?K[\M@867:?FIKH>778DRWOGECM_idV`jorncXPKWdcRDEKTdcRJVhjhlwДГwtsv{АЖЙЗВДРШН~i╥                                                                        a;>CHJIGDCGKOTVTM>                                                                                                                                                                                                                                                                                 c=6../18HTURVeВЁ  шГoUF;                                                     s=DHJJHHIJKKOOQVX]]PMKLPRRROMHEB<8:?BCDFFJJIKKJIGD>7355=ECB=7037;CHIEB???>AFDCDDB=:97ADCB>7///./02247?C?<>EKMMMKMGC@?:5..,***+++)))**+,+++,-,-----/--.-.03143323688776699:86:FX`R@638AEHIE:345FTSNIDAPbjmotypl_OEB@R`\PIDEXe]NL\libhs~ЕБwsv}ДКПООРШЦЛ~m■                                                                         У9<>CHGFAADKRUVUO?ў                                                                                                                                                                                                                                                                                Н<80//.8GQQPV^xь  №ОtZJ>я                                                     И>DJIHHIJJILKNOPROJEEFHORQPNLJFA<9;CEDDHKKIIKLLNID>9457;ACB>8148PcZKBBEVh\KJ[lnlloyЖМxzЖМУТСФЬЪЙ|{                                                                           ╦9BDDDDDCA??>???@BCCA=;:9:9898CFD=4111579=?CFILKHGB<61.-,-,,+,,+,,,,,-/.-,++---.//011354544243447<@=:77CUe]G@FLOQH?879GX[WTTVamt}xlcdg`UG>?QfYOFAGZn\LM\kquoowДЛЗ~ЖНТХЧУЦОГuЙ                                                                             5;AFIJGCDJTgoZYUEД                                                                                                                                                                                                                                                                                ∙=<30027EPPOSYi╖   мБiTCБ                                                       яB?AEIKKJKJLMPSTTQNIFFFIMMIHIHEC>;;?CEIHJHDCDDDDB?=<56899;=DIEA=747:=BDDCC>@CEJK98;BGGIGIDDBAA?ABCCBB@BAA?;997;>@;31//0244579<@CGGHEFFB<7310/0..-...,-/0.-..1/11112246556543455:CHFE:46?S_`[SPRSG><:?O^`_chkmngb[TW`]ZTKCCRbWLGDK\m[LN[irxqluДЙИЖЕИМРУШЬУРИ|m┤                                                                              8>EJMKIDDGU`_]ZVIZ                                                                                                                                                                                                                                                                                 6:40/04ANSPOTeд¤  ┼ИrYF_                                                         N;@FIKKLKHJNQSURQNHDEFJLLGCDBB>=;;>@DDEDCC@>98;<>A@@<:;HLKJE;776:?@?>8358;ACDB@87;<7036:@DFFEA>;988634489;=ADED>:87:=;30---.//131135:AAACEFEHIHD=941//..-../,+-/0.011122320220//25645=Sdd_ZVTO?BDJT]agcfig^SJGCOX[UQH@FS\TLFCN`j\LRXcqrh`tБЖЗИКИЛТФЧЦПЙВxoь                                                                               B>DJLIGCBCHOUZ[YN@                                                                                                                                                                                                                                                                                 L?6-..3=HORONcОч  хПu\ID                                                          n;@EHHKMLIILNPPQOLGDHKLOMF@@CA?>=;>>ACEHJD>9549=@DGJJFEPPNJC;5649>@BB;4535=CA?;65630/15:@DDDB:431320./1256;AEEEA<<<=:4/,,+,--...-/11338<852220/.3644564311//100025ANQIHC7549CRjyna[UQTXZ[\^`^[bgbRB?;HTYTND;ET[ULG=Ngl]RX_gopi`rГЗЖЙНТПССФСИА{u{                                                                                 q>CMRNIFDEIOTX\]R@                                                                                                                                                                                                                                                                                 u?9-//4:EOPMOfА▄  ьЪ}ePC                                                           Ы9BHGJLNLIHKINRRQOKIJNPPJE<==@AA?>??CINMMD<9438=CJNSWVSQPLHC=9758<@CK>9656:@>><974/..037;BCC>954320//11346:@BBDDDEHD:0.--/./1/--/0/.147:<=?@ABDFHJFIGDAA???<;;==<<964453244335AMRPGD<;;?EMYqspcYXW]\XTPOOM]f`TH?;DRWWRE8HTWUQKEUhpfZ_hilnkjwЖЗИЛОСРНКИГ}vrmФ                                                                                  Э9878<@CFD>:86:@?BA;63///0239ACDC<764100/.0/0348:AEGJLID;43111/0.//01213567787578:=?@CCEEEECHFHGEHJIGGFDBA@ABCBCMXUROMNPSUWWW\cgbZWUUaaUIDDFVc]TJC=HWWTNFALWVQOLL`vwpqstmmrryЕНЙЗНФЦСНЕ|tnihc╚                                                                                   ╓;BLRNJGBCFKS\\[UGЮ                                                                                                                                                                                                                                                                                фA<.--,1=LPNN[n▒№ √дВl_O╕                                                             d<@EIMNPNKOOPQRQQNMLMKIFA<:;>CHGJKOQQMLLJGB9779<@EGIIJJHFDEDDB=;==EHGEC;57:=AB<74///0027<@CC?<920/..00//1467;@FLPLKB9522231112144321101//-./0215:988:=BDBBCGIIHGIKGNGJKMMHMPQQNJILPQUVTPQ[TMHL^eXLC>CU`YOGABMXURJ??P[UPMJOhБ}}{xvlgqyБКПКЗОЧЦПЗ}sldb`d                                                                                      7>GKJIEDDFIQX^[VHo                                                                                                                                                                                                                                                                                 <9//001:GQPLVjЪє ¤еЗjZNН                                                              м>BEHLPRSUUSSRTSROLJJJJIB;9>DGJKOQRUQNNMKF?;677;AEDCD@@@@AEEGIGDDCHKHEA;56:=AD?;5/.../05:>ACA>;51/..0/-./035;@GLKJJF@<855546656431.--,-/--..0//24669=@?<<;:<>?A@@?BDGKKGBEFFBA@?ACS\XQMQ^\LJYdXLE?DUbSHB:>MVTOG=@P]XPMHSnЗКРГ{siwЕМССНЙМЦТОИ{mh]ZZy                                                                                       3>HLLJGDDBELSZ[XKJ                                                                                                                                                                                                                                                                                 CA410-/6DRQNSdЗ╪ ■░ЖmXJe                                                                L@CE@;842002477:BEDA=740/1//..1258>DHLGFHEFID?;77543110-,,-,-.-,-...-159;=;:76441357878:BDDC@;9:::98;;MYUNJNTcgde`THEAETZPCB>AMUTPICHWb^UQMYqДЗОИzv|ЕПШХМЙММНИБtkc^XUз                                                                                        PBHMNKGEDBBGR][[N?                                                                                                                                                                                                                                                                                 W;7330/4CTQLO]~╟  ╝ЖoZLG                                                                 ~FIIFD<7755343455:CJLNFA@ACFGEGD=:73420.,./..././1113788:8533211002456695434568;HXTJCAARgjkaPGFDNZZMBAAIUYVQICM\fb^aerБЕБ~~АВЖЕДЕОЬЫРКККЖЖxlc_\T]                                                                                          x=HLKJHEC@CHPWXYO@Є                                                                                                                                                                                                                                                                                В=912104ASQMMVs╖  ╤Мp[ND                                                                  ыE9>BFGJLNNKRTTTRRPKJIFA>9;9;?EDGKNMLIGFFD@;8746:?BB==935;CHKIEA<:?CDGJMQPQKGEA@@A@==>ACFILKIHECDC@>;879=AGOKB=978:=BGIID?;8410/.----./06879833641.---../0357:?;741//.//48;6228>BFE@>96:?DIMQQOJECAABFJHGFFJHKKJJKKJHGFB=87889<>O_^VRNL]q|ВВАДzncW\pАЖЛМКМУЫХСОЛД|sh\ZUPO┘                                                                                            ▀7AIKMJGEEJORXWVQE|                                                                                                                                                                                                                                                                                ў;;53211>BFB>:638:?BBCA;6:;=AFLOJA<;;?GIHFCBCEBB@<>ENKJIE>:64458>ED80...0048::;=>@EFDA><==>><944411111///./0079:;;75531/./.4:CKQIB=:>?N__[WW[gwxГД|xxmaU\n}ДЙККМРФРНЛЙВyoeVUUNn                                                                                               4>JPPNIEJQU\_XWSFS                                                                                                                                                                                                                                                                                 9A831//9PSNNN`Дш№ЄЭxaSAТ                                                                      Д68<@ADGKPRSTUSPNLJIGFB=:98=DDCBACA@@AABCBBABB@AFFCA=8477:99IQQOJJOX`f_VTSI:                                                                                                                                                                                                                                                                                 =<930..6LXPMNZv╞ЄьвwbVBg                                                                       ўH36;@BCGKMPSRRPLLKIJFC@=95669=ABEC>>ADEBCEHMOJHHGEB>9676:?CFLE?;;<@ADJHC=;8=96413132137>FJMIB><9FTXYWOLhqia]WFGIPZdfnhkh_ZTTifm{zeVfzГЕЖЖГЕЗКЛЙДБsc^ZUNF]                                                                                                  O=LVUOJGNZfc`XYWM=                                                                                                                                                                                                                                                                                 fC;20/.4EPQMJRiЯ▌цкwaUBE                                                                         ┤649BDDFHJMOQOPKJGC@<776:CFIHEA;869EKQLLIDDGIH<61/----13557688777578<@DFGDGCCDCBBAACCCCC:964335556CFHJE@?>>AEDD@<964568:=BGIQURPPRF9433455887767420.,/3356799:<>@BDEGCDEFHFEC@?AAABB@DKQRQPHCACMWZ[XTQTYemkgaYTOKHIO^]adXMLZilwq_XlАВВЖЙИЙЗЕКДwkcZUUKAl                                                                                                     к8I\cUNLLRVYZVWWSDЦ                                                                                                                                                                                                                                                                                ╙A@0/..4>STLFI[Б├╓│x^XG<·                                                                            R3:FDBCDDB@DGIHIIHG@=ABCDEHJKONNOMJIG@9;>@FJKKHEB??EIJKHC<8578:<=:8877756300/---/.0235777:<>BBA?@BDFGGFCEHHMGKGHKPRQQLIGHQRTVRPOPTXWVXZWPGCAGV]^aYORbsmle]btДБАЖЛОООЗАtg_]ZRHAGс                                                                                                      ю8D\qUNJIKQTWVXXUGe                                                                                                                                                                                                                                                                                 ?D10//2;PTKEEPjдЬгy^XI;─                                                                             ╠=58=BDDECEMQRQQNJIIEEBCB>;A>@DFEB@>?BDDGGHD@=<9;?CHKOQPRPNNJIGEFGINPOPOLIHEKMORQKEBA@ABAAFKOSUTVTOIFE@:73331/,--.,+,-..000447:=@@;:866676679<@EJGE@?ABCBJIEBACCRQPLFCDSVV[YOKD?ES[Z\VNVhsjfb_fwЗГ}ДМСТНohb]XRG?9Н                                                                                                         5@QTSMHHJMQUVXZUJC                                                                                                                                                                                                                                                                                 ;=1/0028IULEDHVЕ║кu[UI?М                                                                               Ц77:?ABCEHNSTQPMKIGFFFHJJGEDDDCDEBABBBCFFFDA><8;?CGINMOOLIIIJJNQQQQQRPNOPQQRTUVXLHHJIIJFIKJJKKTXQMIGGA;9763/--...,*,,.0258=A@A>:62001220227:BLNID;7:>>HQLFA?>KRRQJ>9FSVVTMHGBKX[UQRLZorf\b`lyВЖДБСЛГyoiieWME>6P                                                                                                           ;;L\NJHFFHKQTYZWN=                                                                                                                                                                                                                                                                                 WJ400005DONHDFOlВХw^ZNBe                                                                                 j18A?=940.,,/0012367?JPML?87@CFGGFC<=:>EJNRQNJCAHMPQSTROLNIJLLKJE@>;9;?PZO@9:<>ACHHCB?<831237:?DB??:7530/.-.022359=GPQNH@9@AEGHJNRTY\[QAп                                                                                                                                                                                                                                                                                ╢C81.-.2:QULCAFYв╜Лc^UJ;                                                                                    │@999:>FONKGCBD=BIOPPNLJDDHILQGA@?ADLQJ=42446:>BDFFEFC=<@DCCD>8722..//-,/5678BMKSQHA@;@EHNPH?JJLPRIABBGQUSV\\^_^]_VNS`koqropttpsqlnplqvnfYJ?:45{                                                                                                                ╗558:=DFDENTU[\ZREw                                                                                                                                                                                                                                                                                ю@<50/049PVLB@AS│╝Лf_XK<■                                                                                     ╕C;BHGIJLKLMLIIGFEEEDA>;=;<>?BBCBCEFDDJNJIHD@<8:?CGHFB?=<<;::7689@BGKOLKEABA@FNNNMLNLHKJKPRNQSJA:6679;AFIHIFA>>?BGHHHFGDC>:63237?FLQSKE?<=@DJRNGGFENWOOHB@GNT[YPGIKbyuga]YX`gkmic`]chjrzw|vh^RIB:76Qъ                                                                                                                    30//7DGHFIKOW[\XK;                                                                                                                                                                                                                                                                                 @B70/./5KRNGB@Fiong]YRBЧ                                                                                         ╜C<;AHKNOKEA>@?BIMJJHGEB?DAEJNPROMLHJONRTQKGB=@DINLGEB>:7587:;=@CGIEJFEFCBGLPTUMACAFNRRPLBEJPUWTHGCCN]]^XSONOMfqvp_]YUVV`ljgeimnoyrk_SIA;962K╪                                                                                                                      9/-/5?EFGGKLRY^YM?                                                                                                                                                                                                                                                                                 `;3/.-.2ITRHA?@Vkoe[[UBl                                                                                           ╜=4952//259@EFFMOOPRTZSOKGD@;BEKQROLICA@@CFILOONIFB>AFJNOPONNOPW\\ULECCFJJGB=79642231234559?C_ic]ZXBI                                                                                             ╗=9CJNQRRMMKHEFECDBA;4.0./17@IHPQNMPSVWTSQKGHHKLPTVQLIED@=FFPTTRQLHHGILOSUTRPNNUc`YRKEFDEGDB>;:955432012355:62.<─                                                                                                                          Й/++-7@EHLLPSX\ZSEП                                                                                                                                                                                                                                                                                ╔=;50..1?LPKD>=@[haZ\YE<                                                                                               ─A6:@EFFILKHHEAEEC?::841136;@GROJKPPRTTTRPPNPRSVUWNLIGGILQUVUUPOKMMOQRYVVPLLMPZ^[WQIGGCEFB@?@@==?>=;777:DMQTLEC@=BEHJHB@GJMNJFABDMRPPHEBEIKOMNLKMMKJS`c]URVPTUSOJDEDBA?;9751B┼                                                                                                                            ╛.,+-5=EHJJMPUY[UFc                                                                                                                                                                                                                                                                                 EA3,,,/:HQOF@??N`bZ[ZI?                                                                                                 ╤Y58:>@EJKGFFDDCBBB=9743578:>DGINLKNQROPPPPSSRRSEFEDEHKQRTSPMKIKNNOQTTRJFCBStoaXPJHKIIHE@BCC@@ABA????FRQSPE@A@HPOPNE@GMRURHEBAJV[YTGBEIORWUTRUTQQNVXXVPLHEFEDBBA>><98742G╬                                                                                                                              ·1-+,4@FJMKMQWZ[XJA                                                                                                                                                                                                                                                                                 AE6,,,.6FONGB?>DV`Z\[N?╙                                                                                                   s4/259>CFLHDDHJDB?=:6441226:>CHFGIIJMONNPPOOMJFD@?ABGLMOMIED>CJOOPNKHFGIU|лКTCAAACEGHGLJHFEEECBBDEHOQNGEDEGOPOMIFKQTYVMFEBHX^][PEGHLQVV[TRRQNIEEFDB=97<>>=<<<:98532K╫                                                                                                                                 0+)*3?HLKKP^a__ZN<                                                                                                                                                                                                                                                                                 UF8,,,.4BPSIA?:@P[ZVXPEЮ                                                                                                     а;.26=DFIEDFIGFCB@<633/12589>BCDGHILMMMOMILNKIFB>??BFIHIGHDCCEAFDDFFFKTД}kWF??;>@ACEIIJKJJMKOLJJNPOHHGFHJMOMLJKOQVSOLJJIPUWVPLIJKMOMLMNKGEB@A>?A@<:989:::887521M▄                                                                                                                                   =**)1?GJJMT[`a_ZRAё                                                                                                                                                                                                                                                                                ~G9.---1>LPKB=;>M\\[^SHs                                                                                                       ▄V./37>DDEHHGFGE@<<:99988:7?>AFJJLKJLNNKKNOMJIIME>ACCDEEEFIKHFE@ABAFN[^[TMFFB?AAAFJMJHFDHLPONORRTPOMIHJNNIIIHLLPLKHFIGLJPPMNJJKJIHFBEAA??@><:;;;9789::;7421Vщ                                                                                                                                     `+*,2=GJKKPQU\_ZUCл                                                                                                                                                                                                                                                                                оA8000/1DHKGGHIHEA@CDGIECA@?=AHJIJJHHIGJLMLKIIKIHHEB>BAADFHJHIHGFB@HLLJJKHGGFHHJURUPHEEDMPPNLKLOQROMJMMONPOMONQMLMMMKNPVWSSMJHFFDAA@@@@@@;98889876787520_Є                                                                                                                                       Ф,,+0:DIKNRSTUY[VEw                                                                                                                                                                                                                                                                                ъE<2./-.9NWPC?99H\cZ]YJ;                                                                                                            ╣P./37=BEHJKLHDFEFKLLQQQMHGHFKMNNMJGHHHHIGJIJJJHDEC?ACBFFIKJJIDFJKLLLGCFHILORTSQNIKOSUWTKGJLQUQJDEENOPPNNJNIKNNJELKORONFEA@ABA?==>?>:555455775651/t                                                                                                                                          ╠.,+-8BGLNSVVUSVWKQ                                                                                                                                                                                                                                                                                 >;520/-8KVQD?9:HVWSY[O?                                                                                                               Ш;98998766554665208Ф                                                                                                                                             .-,.7AHMPWZZWVVWQD                                                                                                                                                                                                                                                                                 IC:30118HRSHA<>FS]XZ[SB█                                                                                                                ёy3027;@EJLNMJHIIIIKOPPQVZVROMMGDDGGFEGGFFEEEGFFIJKSSVSPLEAEFINPQPNQSVXTVRNMKLWTSONKKQSSSQQPPUYa_^\Y]VUTQNPOLFEDEFFCB?;::876776755334524`╘                                                                                                                                               /--/5?GLNV__YTW]VH                                                                                                                                                                                                                                                                                 eD=1///5BNPMD>=AJSUY\TEд                                                                                                                   ╘c3568>DGJIEEFCFJNMNO^]SOOIJDDGHJGIGGFDDDEDCCDFHKOPQNKIFDFIMNILHNQSSSTXUTUU\VQOKKOTUUUTRPMSQWWUVUVRRRRQQNLFC@BAB?>=<:;9778876442/.Aи                                                                                                                                                  @--.3:ENRV_b]WTYYL╬                                                                                                                                                                                                                                                                                РD>1.,-0;=FQTUZTEy                                                                                                                      пU//368:=BGEEGFEILRVVWVRSSRRTSSRRPKGEFDDCBA@AACCCEGGJJQRTVMNMMPROOMPOOOPRTPPNMQWdZ]YVTRVUYWUTTUPNOPONKGCA@@@A><:8566557762.0=У·                                                                                                                                                    i+,,/8BORUelcVUZ[OХ                                                                                                                                                                                                                                                                                ╚EC3---0;HOMF<;:ANUUZXGO                                                                                                                         └g010218@DFGEEHINPSRTW][[^_`ab]XSOJHEDB@@>?@???>@6/1/08GSRG@??BKTU[[K;                                                                                                                            ъt7.025;AFCDEDFHHOSVWY]`_acea``[XQHEDB@?AA@?<=?BBDBBFIHIKPQMOOSPQSPPMNMMNPNPOOMKJMMMLLKKJHIHGD?=<:98677764300103h┤                                                                                                                                                           █2/.17CPOTakmfXTSKD                                                                                                                                                                                                                                                                                 AF8,/.07DQUI@>=COY[]^N=                                                                                                                               ЄПG126:?CECCDDDFINSWY]^__\[\[Z\YUQMFECBA@?>?AAA@ABCADIMKFEEEFFGHJJIIILMNNKJHFEEFGGFDCEEEBA?;9877643654310LСю                                                                                                                                                               1-.08DPPRY_bb_TSD7                                                                                                                                                                                                                                                                                 NF:-0..4?NTLCBBGQZ^__O?у                                                                                                                                  ╞p7.048<@A@AABCHKLOOOPRTVXXXY[[WSRQNIEB@C@@@?A@ACGJHCAA@?>?>??@??>=;=A@A?==??>>>>;AEGFB;644210122YЩъ                                                                                                                                                                   1/.3:CNMNQTVSNJC92ф                                                                                                                                                                                                                                                                                wG=,.//2>P[OB@?@BEFGILNPSVVXZ\\Y[Z][SOLJFDABBA@DGIE=>:;::;:;99::;::9::9878:;:;::@Ofb^]TF|                                                                                                                                         ·оk:036789;=?@BBCFJKMOQUVWVXYYXTYVURRPNLNSSRNGC@<;;:;:989:;;:::9988:<>?@???ETWPD7:Б╬                                                                                                                                                                            А=BQir\RORYagcWL@;s                                                                                                                                                                                                                                                                                хFB0/-.0:M^UD?;;I`bXYUJU                                                                                                                                              ═ТaA4569;<><;<=@CFHJLMOQRRRTWTTTSUPSTWWRPIGHHGECCDC?=>=;;:89;=BDGJJHFIMKIC9y                                                                                                                                                                               к=@_zrk^Z`sЕМПu\QGP                                                                                                                                                                                                                                                                                 EC3.,,-7G[WFA<;BX`Z[YL>                                                                                                                                                   °├Пk[335888;;<=>>?CEFGIJIHIJKKLMOPONKGIGGFDECB>=?<;:98;>AHLRX^`[WIB;O∙                                                                                                                                                                                с06G]kh^`k|й┤ЦРlh`R                                                                                                                                                                                                                                                                                 @>60-,-3EWXIB=:?NUTWZP@                                                                                                                                                           х╔ПА[P789;=ABCA?@AA@?>=?ACAA?====<;<<;889;87546:?HSUbh`YK@?╢                                                                                                                                                                                   .6BP[eahh|РЦЩЖwoi^                                                                                                                                                                                                                                                                                 cG9.,-.4AUYJC>:;FVTWXRDю                                                                                                                                                                    ╥╤ЧХf_N77786678:;;97767655321012.00026QSKE@;:>OQW[UG░                                                                                                                                                                               Ў╤╥бОНe[X;0001/-.////---./27:=Dx┤·                                                                                                                                                                                        _448AHQTW]eqА|wrneе                                                                                                                                                                                                                                                                                ┬BB.-,+/:N[PG?84B70+*,6GWTKB;98>LT\_Q=                                                                                                                                                                                                                                                                                                                                                                                                          52-/:CMRU[_a`glnlb                                                                                                                                                                                                                                                                                 KJ<2-+,5DUVMC;86?JSZ^T<                                                                                                                                                                                                                                                                                                                                                                                                          :0.07>LOQW_bcfjlldў                                                                                                                                                                                                                                                                                mJB1,*,4ATUMD=98>IR[^VBЄ                                                                                                                                                                                                                                                                                                                                                                                                         ^1--6;ILPYdeegkmlf┴                                                                                                                                                                                                                                                                                ЯJE0,*+1=PZQH=95;HRX]WE╖                                                                                                                                                                                                                                                                                                                                                                                                         К0./2;HMPV`ifehlleП                                                                                                                                                                                                                                                                                ▄IH2.,+0;LVUI@;89FSZ\YJО                                                                                                                                                                                                                                                                                                                                                                                                         ═4104;IPSU\behhiide                                                                                                                                                                                                                                                                                 II4.,,08G[XK?969GPVXUL`                                                                                                                                                                                                                                                                                                                                                                                                          10/28JNPU]djmkjhcV                                                                                                                                                                                                                                                                                 GJ5/,+,3AV[NA;88CMTYYQD                                                                                                                                                                                                                                                                                                                                                                                                          50/05GOSW_fonmjhcZ                                                                                                                                                                                                                                                                                 \A5/,+,-GPTXUB                                                                                                                                                                                                                                                                                                                                                                                                          P1//5DLQU^hlokhfd\╠                                                                                                                                                                                                                                                                                ЗK:1--./8OWOE?:7=JRX[XEё                                                                                                                                                                                                                                                                                                                                                                                                         Г0005ALPT[bihgfhe`Ш                                                                                                                                                                                                                                                                                ╖G?5.,,-8LRNH@<:>GQUYWG├                                                                                                                                                                                                                                                                                                                                                                                                         ┼00/3>EJNT\_]bgie_q                                                                                                                                                                                                                                                                                єBC5.,+.7ISQI@;:NUPD;;8ANUZ`XA                                                                                                                                                                                                                                                                                                                                                                                                          1/02>HMPX]^^_afe^░                                                                                                                                                                                                                                                                                ЧB<521/0:JSPF>>;@KRW]\D№                                                                                                                                                                                                                                                                                                                                                                                                         ╖2.-2=FKMU^^[]ade_З                                                                                                                                                                                                                                                                                ╧IE60/.18HVUJ><9;GQW\\F┼                                                                                                                                                                                                                                                                                                                                                                                                         °0./1;HONPX]\]^cea]                                                                                                                                                                                                                                                                                 HJ;10016GTVN=:99GST[[IЩ                                                                                                                                                                                                                                                                                                                                                                                                          20019BHJPZ[[]cgedS                                                                                                                                                                                                                                                                                 FI;10.04DTYN?<9:JVWWULq                                                                                                                                                                                                                                                                                                                                                                                                          D1/07DJLNTY\`beeaW■                                                                                                                                                                                                                                                                                ^H<1/,,1?QWOB<:;GTWXYQM                                                                                                                                                                                                                                                                                                                                                                                                          m0.06BILOTY_acdfdX┴                                                                                                                                                                                                                                                                                БJ=2/..1;6@NTX\XG                                                                                                                                                                                                                                                                                                                                                                                                          Ё4103<732228GRQIA<;BLTXZ]N╙                                                                                                                                                                                                                                                                                                                                                                                                          5203KOME=:;DSX[_Ww                                                                                                                                                                                                                                                                                                                                                                                                          o315:AIKMNOPS\bdbQ▄                                                                                                                                                                                                                                                                                lG>3//./:JQPH?99AMTY^[`                                                                                                                                                                                                                                                                                                                                                                                                          ж3028AJMMNPQSYchcUж                                                                                                                                                                                                                                                                                ЧFB4/003:HSSI@=:?HSX^[U                                                                                                                                                                                                                                                                                                                                                                                                          щ4016>INLLNQV[adbYx                                                                                                                                                                                                                                                                                ╦==500/07EQRJB?;JRMC>;>GQY\\Vм                                                                                                                                                                                                                                                                                                                                                                                                          m446:BHKLRTSV\bc\P√                                                                                                                                                                                                                                                                                TH>/0/14=MYRF@;;COW]^UВ                                                                                                                                                                                                                                                                                                                                                                                                          Ы0137?FHENRTUY_c_S╗                                                                                                                                                                                                                                                                                zIC1./.0:JYXGC>:?NW[_W]                                                                                                                                                                                                                                                                                                                                                                                                          с2004:DFGNPPQX`b`UЗ                                                                                                                                                                                                                                                                                оGC00///7GYYGA:7>LRSWUK                                                                                                                                                                                                                                                                                                                                                                                                           2013;DFDINORV`ebX_                                                                                                                                                                                                                                                                                ыDC320./6EVXHA;8;HWW[XM                                                                                                                                                                                                                                                                                                                                                                                                           82128CHGHLPRX`cbZL                                                                                                                                                                                                                                                                                 <=545104@SSKC<9;AJSXYOу                                                                                                                                                                                                                                                                                                                                                                                                          _2/16BEGHLQT[_c`ZN                                                                                                                                                                                                                                                                                 CC823101:QZMC<97>FPW[Qн                                                                                                                                                                                                                                                                                                                                                                                                          Х0/05>EFGJMRY_ab]R╪                                                                                                                                                                                                                                                                                bE;541/09NRLE@:79GMU\TА                                                                                                                                                                                                                                                                                                                                                                                                          ┌002712//09KWPIA:68FOW\V]                                                                                                                                                                                                                                                                                                                                                                                                           /127;CDDGKPT[aecXt                                                                                                                                                                                                                                                                                ╔CB343009HPRJB<87BNV\XI                                                                                                                                                                                                                                                                                                                                                                                                           50159@EHINPR[dee[Q                                                                                                                                                                                                                                                                                ·==445337FSULD<87>MX]YK                                                                                                                                                                                                                                                                                                                                                                                                           V1/28AEEGKNQZdgg_O                                                                                                                                                                                                                                                                                 73:JV]]Pх                                                                                                                                                                                                                                                                                                                                                                                                          И./27?FHIKNN[fkibRЎ                                                                                                                                                                                                                                                                                H@;52125?IRQG?846HW^_T▓                                                                                                                                                                                                                                                                                                                                                                                                          ├//04RUMC;64>Q]_[O                                                                                                                                                                                                                                                                                                                                                                                                           {0/27BEILPQUZflj`O                                                                                                                                                                                                                                                                                 ?=2/0//4:PSLC;66MWYWN                                                                                                                                                                                                                                                                                                                                                                                                           y0./8?EHKQPQ\gmjaN                                                                                                                                                                                                                                                                                 =B4..--0?JNKE>66834///2;GRSKD<7752/07EKLHD?;<@GGA8V                                                                                                                                                                                                                                                                                                                                                                                                           p0.16AHHJKJLXgpl`L                                                                                                                                                                                                                                                                                 @?731.47DIJGCB>@DFDB<>                                                                                                                                                                                                                                                                                                                                                                                                           и10/6BIIJJFJUbjkbN                                                                                                                                                                                                                                                                                 :;;979>ELPOLLKLPY`aXMC                                                                                                                                                                                                                                                                                                                                                                                                           Ё0.06>DGIKHHRalkdP╚                                                                                                                                                                                                                                                                                M9=BEGPX]_^\Y^crГИАwfWє                                                                                                                                                                                                                                                                                                                                                                                                           40/6?FFEHHLS^ilfSТ                                                                                                                                                                                                                                                                                v6@FKRbvЕКЖАСз╜╝╖СВ_┬                                                                                                                                                                                                                                                                                                                                                                                                           >./6DFFHLOXcmiaOц                                                                                                                                                                                                                                                                                <:<9;?CFNWZTNKFPaomi`R                                                                                                                                                                                                                                                                                                                                                                                                            2006?EFEGFLT`jlcRл                                                                                                                                                                                                                                                                                _;=8464=GMQQKCCHTfre_T╔                                                                                                                                                                                                                                                                                                                                                                                                           9.05DKPPLGDEMZ_d_VХ                                                                                                                                                                                                                                                                                                                                                                                                           i203:6569@GKNLJFBFSbc`Xi                                                                                                                                                                                                                                                                                                                                                                                                           Э4129BHFHIKR]ehhZF                                                                                                                                                                                                                                                                                 9@;8547J]`^[I                                                                                                                                                                                                                                                                                                                                                                                                            3216?GFEHIPV]cd^K─                                                                                                                                                                                                                                                                                RLL9445:AJNMHF@>G[ea\Nс                                                                                                                                                                                                                                                                                                                                                                                                           ;114:CDEGJOU\cdbPК                                                                                                                                                                                                                                                                                }JK;877:@GOLFC=;FZ`_\Pж                                                                                                                                                                                                                                                                                                                                                                                                           ]1/2;FECFJPT[aebR_                                                                                                                                                                                                                                                                                пFJ=;526;BWca\Qy                                                                                                                                                                                                                                                                                                                                                                                                           О--19DHGFJNRYcebTE                                                                                                                                                                                                                                                                                э=C?9214;ENLJE=;BS^b_VU                                                                                                                                                                                                                                                                                                                                                                                                           ╓2039AGEHMOQV`geWB                                                                                                                                                                                                                                                                                 ?HA6104CQ^b_XJ                                                                                                                                                                                                                                                                                                                                                                                                            4249BJHLNNNT^ef\D╘                                                                                                                                                                                                                                                                                BHC:348;BLNNICAEN_eaZN√                                                                                                                                                                                                                                                                                                                                                                                                           9118ADDHNOOQ\ef^KЭ                                                                                                                                                                                                                                                                                fEC<767:@KKLGA?AJ`db\P├                                                                                                                                                                                                                                                                                                                                                                                                           W416=DEGKNPSZbfaOp                                                                                                                                                                                                                                                                                tEG=989BL_a_Wh                                                                                                                                                                                                                                                                                                                                                                                                           ╩646:BEBFHJP_cecVB                                                                                                                                                                                                                                                                              |QQNG9578;?EJOJD@=DKOJE?<:;;PZ^]Vu                                                                                                                                                                                                                                                                                                                                                                                                           ╗4007EEEHKMPW^baUA                                                                                                                                                                                                                                                                           zykXPOLMRTI=:<@MNIEA;:NX]^WR                                                                                                                                                                                                                                                                                                                                                                                                           ·3015BCDHKMNT`cbZC                                                                                                                                                                                                                                                                          ∙c{gSJJFOh`OB:9ALMIEB=;JV\^YI                                                                                                                                                                                                                                                                                                                                                                                                            6314>CEGKMOQX^aZF╘                                                                                                                                                                                                                                                                         йLRSPLJHL[w[?97?HLKIG?>JX_`[Lў                                                                                                                                                                                                                                                                                                                                                                                                           L502=ADGLMOR\`a[LЪ                                                                                                                                                                                                                                                                          СG@<<@AIMHB:1/:GJIGEAAGV``[Q╜                                                                                                                                                                                                                                                                                                                                                                                                           |3.3=BCGKPPS[bd]Oj                                                                                                                                                                                                                                                                            Ф<:ADLJE>3,-3CIIHFA@BT`b`VМ                                                                                                                                                                                                                                                                                                                                                                                                           ╢314:ADFHMNR\cd_SF                                                                                                                                                                                                                                                                              JN^dcZ`                                                                                                                                                                                                                                                                                                                                                                                                           °4047>DFJNOR\dfaYB                                                                                                                                                                                                                                                                              Ь4;:94/-+*0?GIGFDCAIZff^M                                                                                                                                                                                                                                                                                                                                                                                                            6116?CCCJMS[bdc\HЄ                                                                                                                                                                                                                                                                              ;<9:0+)()0=EHIHHE>EVceaQ                                                                                                                                                                                                                                                                                                                                                                                                            C.15AO`fbWl                                                                                                                                                                                                                                                                                                                                                                                                           ю2-17?DDGRWZ_bdaX<                                                                                                                                                                                                                                                                               )+10*&')*7?HKGEC=BOZ_`YK                                                                                                                                                                                                                                                                                                                                                                                                            4007AEEFPV[_bda[?                                                                                                                                                                                                                                                                               8&.2.)'(+5DDENVZ^bfi^HЦ                                                                                                                                                                                                                                                                              Е'+12.+)+2=FJLHGDDKU_`]Q▒                                                                                                                                                                                                                                                                                                                                                                                                           г423?EN[djr}а╗─▌х╙╢iь                                                                                                                                                                                                                                                                             Z*,/475257HOKKOQRV\ab_Ug                                                                                                                                                                                                                                                                                                                                                                                                     їsnzЙЮ╛╦╡ФЯмЮКГГИГyppiZMD{                                                                                                                                                                                                                                                                            9+19@=5689=DIGJORTU]`a]WL                                                                                                                                                                                                                                                                                                                                                                                                    Йsww{Да║╚═┼┐─╟╣зОДБxqqme[PJ                                                                                                                                                                                                                                                                            X*2=A>9988:BJIIMSWY_bgcZL                                                                                                                                                                                                                                                                                                                                                                                                 эУy~zusuyМ╝╚╛╡╚═╞╟╒┌х─~ДА{sjaV                                                                                                                                                                                                                                                                            Ж+3?ID7788:?DHJLPV\_bfe]Nс                                                                                                                                                                                                                                                                                                                                                                                              ┐ДИ~Дuokir{Ч┤└├╦╘║║┘яўъЗТЛД|sk^╣                                                                                                                                                                                                                                                                           к*2@KI;777:;BHKMOSV\afe_Qд                                                                                                                                                                                                                                                                                                                                                                                           ┴ИДЕ}tnhd_\]am~б═╒▀╪╕╣▄цЁ┘ХЪТЛГ|thБ                                                                                                                                                                                                                                                                           ч+2BLK?:758;BHIHLQTZ`fgcWx                                                                                                                                                                                                                                                                                                                                                                                       Ў│НКСКЗЕzrlea[XXWZaqН╖┌ь▄│╕─╟║пЬЮФНИД|wY                                                                                                                                                                                                                                                                            )3ANKB<8568?FHJMPPSbkkh[U                                                                                                                                                                                                                                                                                                                                                                                    ╩Р{ГЕzvqlfdb`][ZXVU^jyХл│─вФвнодгбзллжЩЗk                                                                                                                                                                                                                                                                            +2AOMD;5346@JJHIJJQbjjg_J                                                                                                                                                                                                                                                                                                                                                                                Єе||ЖАБАyuplheca`ab_]\[Y\]djxГЗЖДААЕПХЬкл╕╜┤мвХ                                                                                                                                                                                                                                                                            ;1>NNC84246@GHGHLLN`knh^N∙                                                                                                                                                                                                                                                                                                                                                                            ╬Пv|~wwutoiddce`bca`a]]^`aaabceebcroquyОСШи╛═╬═─в°                                                                                                                                                                                                                                                                           Z/;JIB;5123:FGACHMM\gkjaP╣                                                                                                                                                                                                                                                                                                                                                                        °мВВЙАААzspkeaabbbcbee_]]X^hoswsmja\]UZZdlt}ЗЕВХ┐╤╫╘╤ЮЇ                                                                                                                                                                                                                                                                           Ж-7GJB<84237EIFDHLJXfmjdTД                                                                                                                                                                                                                                                                                                                                                                     ╙Ы~~|wwuqliec`dcbdgfgb`]]^`]gtuxzy}qmd]ZTSQ`m{ДЕЖЕЙЩ▓╛╗╕Тщ                                                                                                                                                                                                                                                                           л,3BD?;64326BEB@FNMRbmmeZ_                                                                                                                                                                                                                                                                                                                                                                 Єиzm}}yurmjefbabachhjiee_ZZ[]dljpuuvutqoje\PKIGNo}qi~ГБ~}ДДДВ╨                                                                                                                                                                                                                                                                           ч*.;98635AEC@@FEP^hlg^I                                                                                                                                                                                                                                                                                                                                                              ╤Пjlrmihdc^]a^aaaacceefc^[WUWY[aghjotrrrojc[TNIB;;?CEKXu|ztjgq~p┴                                                                                                                                                                                                                                                                            +.379;;8533?CBBCGIO_ikhaL                                                                                                                                                                                                                                                                                                                                                         Ї╞Ъwgrpkhecebcdc`a`c_``_`bd`[WWVXXXYZYZ\^bdea\QFA;853327;?AHn{vmeZNTY╠                                                                                                                                                                                                                                                                            *-169=;9533=EEA?GKN^hiicQ╪                                                                                                                                                                                                                                                                                                                                                   спЕ`ccbc`_][]__`^bdc`^_`]WUUXYX[[YZZYXSQPPMHDEILMKE>:5211001479;Fitqmh]OME┬                                                                                                                                                                                                                                                                            :,0369:9636:AEEBEINV`dedVЬ                                                                                                                                                                                                                                                                                                                                              ╓Яy___gbeb_^^\\^]^^_`_ba_\[[ZXUSTVVYZZ\[YXRKFB=:77676566541.//010447:BdwsqhWOD=у                                                                                                                                                                                                                                                                            Y+.149::7349=CB@CFJNXaed[p                                                                                                                                                                                                                                                                                                                                        №┼Рo]^`[[\[[]]]WWY\\Y[\\[ZZY[YWRPROTQRUWX[YXWTND=941/////..011///./058::::;E`ghh]NG<8№                                                                                                                                                                                                                                                                            З*+.15985148=EFB@EDJR\ad`M                                                                                                                                                                                                                                                                                                                                   Ў╝ЭЛW`cdcbd`]\YZ[\^`\]]^^[YYWUTRSQQOOOQTXUUUVUTSOIC=72..,,,--,---/02233489::;<<>EVdc`ZM>;5                                                                                                                                                                                                                                                                             н,-.27985438=>@ABHPZclnheYH                                                                                                                                                                                                                                                                             ь00247:97766>HJD?CDIPZ`fdLЄ                                                                                                                                                                                                                                                                                                                        ╓ЮsTY_a^b`]_ac_\[ZZ[][]\]][\[^[YXXXUQPNKHGHIHEDDB@>;:8868987565788769::;::;<>=<>?>=<>?@DFGNVZkВНМЗlU                                                                                                                                                                                                                                                                              87677852315>GHGABFJPW^deO│                                                                                                                                                                                                                                                                                                                   ╞СkTX\__^^_]Z\YZ\\ZWXWXZ[YVZYYWWVVWVTQOONKMLHEB>;972/..101555469978:=;<<<<<;<;;<>?<>A@@?=>@ACCFT`oМаггЭКb                                                                                                                                                                                                                                                                              CC>98852322:CGC?CGINSZa_O                                                                                                                                                                                                                                                                                                             ў╝ЙcT[]``_b`a`^\]\[ZZ\^\XWWXYXYVXZUVURQPPNOMJJGDA=9640-/.--+,.02367;=>??@@?<=@?<>><>>??@@?@@??>@AEGLS^wР╦°°╧лТq┘                                                                                                                                                                                                                                                                             MPSI?:402135?HGCFGGIOV^[OW                                                                                                                                                                                                                                                                                                        щнБ[X]^^Y\\[^^\]\_^\YYYZYXZ\][XYYWVTTURONNLJIHHFCA<7412100//1211489:@?@AABAA?@=;;<====<;=?=<866569AFFADGGFIT\UPA                                                                                                                                                                                                                                                                                                   ▄аrSUZ^Yba``__^]^_^\Z\\]]\YXY\[[[[ZVXWUSQONKJHGEB?<953211.012224589::;;;==??@>??@A@?>?<<999:::::97:;;=?BHM^istwЕГ│╧Ў №╫p^m                                                                                                                                                                                                                                                                           ╜PUTQSRG=98859BILDEHFEGOUQPA                                                                                                                                                                                                                                                                                              ╩ЦkQX]]^\[]]Z][[\\]]^`_\[Z\\\\[YWUVWUTRPKMOMGFEGA=:64423///0200589:;=;<>@B?B=<<=<::::;:::R]jСП╜╥ССРПygРРо╫╪  yN\||rmouЧ╝ы∙щЧ`SE                                                                                                                                                                                                                                                                           `]VPQOLIE?:705?GJGJLHBBNZVRE╬                                                                                                                                                                                                                                                                                       ∙╗МbPV\ab`faaa_^__^\\[\]^^]][Z[\\^][ZWXURQOOMKHGDB@=;610.//-10/0268:;=???>>=>>>?@><;9976CmЬ╙                       еL[eok_V]dР═╪Тf[J=                                                                                                                                                                                                                                                                          т\rtVOLHHMQH;11=IOOLNNHEM_affЭ                                                                                                                                                                                                                                                                                  ь┤БZKPU[]`\\\\\_]^^]^]__]\[\^^a`^\ZZZ[ZWVSQKDDDC>;<<9543/.-////248;<>AA?B@AA?==?<<:778750WЩь                            ▌GHKLLKNOWexБ}e[J>є                                                                                                                                                                                                                                                                         ЙtЗrZF?BGMTTE11;FLQOPMC?Maexfo                                                                                                                                                                                                                                                                             ▀ЭrPPW[\\Z\_]_^Y[ZY]`]\]^]][][]_`^\]^\ZYWSTROLHD?<86435531210101469:<>>A@@A>?>===<;9843228lк°                                 B=>@CINNPZ`iuh[L@╡                                                                                                                                                                                                                                                                         ]^kgK><@@?==<::88754310.QЙ╘                                      C=::=DIGHT_fgcZL?В                                                                                                                                                                                                                                                                         RLIC><<<@FNRF.09BIPPPNE@I_a`ZG                                                                                                                                                                                                                                                                  №└ПdLQW\\]e`a`_^^[\\ZYY[\YYWTUWZ]^^]\[ZZ\[[WTPLGC@=952/-,,++++,-.2579;=>>=?DB>=;;:97652110/Hy┐¤                                          U<856AIDAMSX^_YJAW                                                                                                                                                                                                                                                                         `D<57898:97::/05>HMONNE>DV\_[Kы                                                                                                                                                                                                                                                            є│В]PW]``]Y[]ZY^\^]^^\[ZXVTSSURSOOQSZ\[YWVUSRNKGDB?<863300....,./3557:=>?;=>?><=<<97541///.=nлЎ                                               }@:66;D@ANV\``\OB;                                                                                                                                                                                                                                                                         ╧0/./47;@=73.*,08DNMIHB?CL[_]Mп                                                                                                                                                                                                                                                       фжtTNTZ^`[`a]Z[VZ\[\]\^[]][XVWTQQSTWXXYWW\ZVQNJHECB?=:7431112310/12589:<<=>>?<=;<;8654321/.7eаэ                                                    кC;55<==?>=<;<:8741/,--,KБ─                                                               @;64:CDBFNTZ]ZPG<┤                                                                                                                                                                                                                                                                           п-.;A>:3*&&&*1;FKJJGB?HYa`VF                                                                                                                                                                                                                                       °╝ВXFLSY\`Z^_]]]Z][]_a_`]]ZVTVWVSTQQSPTXYZ\\b]XVVSLEBA?<9512////24667:>BD@=<<>;:99666642000/,@r╕·                                                                   CA838BFDELRW[[SI>{                                                                                                                                                                                                                                                                             T;=<80(&&'+2:EJHJIFCES_]VI                                                                                                                                                                                                                                  ёмzSGOU[aZ^`Z\ZWZ[[^_^]]]]\\[ZWSQRRUSUWVXYW]]ZXVSPKHEC@;86754400/1369;=>@@@@BA@=<=:8652/-/./.;iдё                                                                        \@835>DFHOSW]ZUK?T                                                                                                                                                                                                                                                                              ъ]...*$%&).9ENNQOJFFN[_YM┼                                                                                                                                                                                                                            рвqNJQV[[\ZYXXWYYU[X[\]^`^^YYWVUSQSONPSVYWXVUWUSOJFEA?;98533534234779:::=?@C@B?>><9752/--,*)(.YЩт                                                                             Д=932=FGGKOSZ\TK?8                                                                                                                                                                                                                                                                                с+,-*%&',7DJORUSJBNY][PР                                                                                                                                                                                                                       ╦ШjEHOW\^a[a_[Z\X[Z]^]__^`]^^ZUVRRRSSPSVU[]\aVWSQMIFDB@>;642/1/.2355558::;;<=>?@?<:76653/.,+*)LЕ╤                                                                                  ╢@:349BFHMQU[ZRLB8                                                                                                                                                                                                                                                                                 **--)''-6CHNQTUPIMZ_]Sd                                                                                                                                                                                                                 ·┐Б[CINT[ba`][[YW]]\[Z]^^a`__\]ZVUPMRRSOSY[ZaXXWWVRMHEA@=<:8975352579:;<=;>=<=<><;;:8510/.,,.,,Ev└¤                                                                                      ЄB;3.7?C@GNRY`XOC7ф                                                                                                                                                                                                                                                                                J-/-,*)-5CGNQTVRFM[__VG                                                                                                                                                                                                            ё┤yQ=DIR[]`^^b_]]YY[Z]aaa__`\_][YVTVTWVWYYY[X]`]XVQMJGFB?;999746676579:9;=?>?===<:9886632/.-,,+:mлЇ                                                                                            ?<736=ECEJPV[ZQE:л                                                                                                                                                                                                                                                                                v+.0-)*-5ABLOSVSIL]d`VG                                                                                                                                                                                                       чаlE<>FKQTUV\[Y[\[[T\_aaa_ba`_]\YSVQTWVWX[_]\]Z[VTRNKGC@<:872023553669=???>@>=<>?;:9863/-+*)*))3\Юц                                                                                                 G>625:@>AGMSZXQH=x                                                                                                                                                                                                                                                                                ┐,/10.,.5@CQRSSQMQ_`\VJт                                                                                                                                                                                                 ╨Чc@:=AEJPSVVZ[ZZ]Z^___`cfegd``_\\YXWUVSVZ[]`]d^ZWVTSLIECC@=86333244689;A>;99741.--+**-UК╫                                                                                                      `=831:BAADKPUXRI@S                                                                                                                                                                                                                                                                                °*/60-,.4=DMPQPQQT\``[Mд                                                                                                                                                                                            ╞Н]<=@DINQRSVXUTYY]``aadhffgcfc`_\X[[[WX[[YZZ^^^^ZXWTRPOOOIEB?;9146778;7531000-,,,+H─                                                                                                           О=954;>>?FLPTVRJB:                                                                                                                                                                                                                                                                                 ,/40-,.3:@JMNOOOS]`_]Os                                                                                                                                                                                      ∙╗}R:=AEGJLOQRUXXXZ\Z^bdghilegec`^\^[]_^\]]a\[[ZYXYXWWWSSSPLGC@=9;==;899;===@?@?ABA?<986520.--++,Bp╕∙                                                                                                               ╛=;628AB@CINPYTKB:                                                                                                                                                                                                                                                                                 J/62-,-05A?<:886320.+++*)0XШр                                                                                                                          A?836?BCEIJLRTNG>а                                                                                                                                                                                                                                                                                ╕.152/-/3;GMHFHHGO\a`XGў                                                                                                                                                                      ╤С^<;AEIKMPRUXX]`\]^_bfijmoplpljgfcfgkhhhhggbfc\XVSOKMMMJGJMNNLE@A=?A>>=?@@??ADACA>=;:620/0/,-,,)(KЗ╙                                                                                                                               F?;65=DEFHJHU\SH@v                                                                                                                                                                                                                                                                                ·/164/-.1>@@>=A?@@ABCABBA?=?=;:9630/--,,--+Ew┐¤                                                                                                                                   j?946:7679;:6:;???BGDCBBA?>><:630--,,++,+))9kкє                                                                                                                                        Ц>;539BEEFIIOTQH>4                                                                                                                                                                                                                                                                                 N055/-/2;76310.-+**)))2\Эх                                                                                                                                             ╠@;348?CEGKIKPOI@3                                                                                                                                                                                                                                                                                 w-471--2;FIEAAFCDKU_`ZJ                                                                                                                                                 ┘Уb;8;>BGKNRVY\]_]_diheijotxxwsspljmjmiilmkmikjiie`][YXUSQMHEA=;9:9999;>?@@??@DBB@=<;:9850.--.-,+(('SЛ╪                                                                                                                                                  №?<606>ECBGGHRSMA4╫                                                                                                                                                                                                                                                                                ░,871./05DFDEGKGAFT_`]K                                                                                                                                            ╚И\7:@AEJRVXZZZ^adfghgkoruvwxsuxvuqmnlkmnmpmnnkkfca`_]\XTQNJFA>9<:898899;=>ABBAA@>A>=;974.000/.-,,++K}─                                                                                                                                                        A=957@HJGJGFNSNB8Ю                                                                                                                                                                                                                                                                                Ё+684.--.=BEEFJKDDP_d_O▄                                                                                                                                     ∙╖~M57;?EJMNNUZ`flhflosv{БЖОХЖ~Б{xtmkkinklllnollhfc`_]\XSNKHD?;:::::59:;<=ACCDAAAAC>=;95203101/,,,,,*@q░∙                                                                                                                                                            M=956AHGEGGGKOMD:i                                                                                                                                                                                                                                                                                 ,5740-+/8@EFFHF?BP_dbUЮ                                                                                                                                ёйsG69=@BDJPTXZ]^`cgkpv|ГИРЫЯаЮСЫСЗА|wwroonnolljhhged`\XTPMIF@;888:69<<;;=<;9765320030.-+*7gгЁ                                                                                                                                                                 l=865AMPLLIEIOOG=F                                                                                                                                                                                                                                                                                 64982,,/8>CAAFFABPeoj[j                                                                                                                           ▀ЭhF;<@EKORUUV[^acfgjloyБОЮйп╡││маФИ~zwxvrv|tromkiigeba^TKGFC>;98;7778;==>ACD@A?A@>?><963111.0001.---1YШр                                                                                                                                                                      бB:65AJNMNNKJLNI@4                                                                                                                                                                                                                                                                                 \37850.28=EHHJF?AReppaI                                                                                                                      ╘Уb:89KPOOOMMPPIB6                                                                                                                                                                                                                                                                                 Н2794.-17?>?@CFIMQV[agmrw|БЕКЧа░╜╣╕╗┤╜╖мЯПГ{||xtpopklkhcb`\WTPLHD<74457578;>@??ADDEFCED@;877830..//-,**)))Au╛■                                                                                                                                                                                ?<66=;:8431///,,+,,**9kйє                                                                                                                                                                                     ?@719DLOQSOPQRNG<П                                                                                                                                                                                                                                                                                 -5850,-4>?CFCEDB@@=><:63313/..,,*,+*2\Яц                                                                                                                                                                                          R?:67ALSTYTPQTSK@j                                                                                                                                                                                                                                                                                 /3872-.2:GNIDFDFISbjfPЕ                                                                                                █Ыc>68:>CHNS[dlyЗЛЙЖА{}ВЙЦд╝┴┐╜┐├┴└└┴│гХЙЕБ|{xxvqoljgdb`[WPJD?::::9789;<>==@A@AABEDC?<;9753431.../-++++UН┘                                                                                                                                                                                               wA<45>HNOSTQRSRMCE                                                                                                                                                                                                                                                                                 H4883-+08DLKGIFBEO^feT]                                                                                           ╚МW379;>ACGMOSY`inwГНУХШви╜═┼├╟╩╠╞╞╟╟╣жУЛГ|xsorsqnlmlhc_[TMFB=9538588:<>BDAAABBAB>?>:86410///20./-,++*+Fy├                                                                                                                                                                                                    йB>53ADHNRW[]bejnv~ИФао╣╞╫▐╫╪╓╘╤╙┘═╝░бФЛБ{tsspmhhhgec`\TMHA=97:2676:=<;>@ABFDEBBB@?<98863..-+++,..+**=r░∙                                                                                                                                                                                                        сC?54<<:9;<>A@@ACFBC@@BB@=;9:8753.//.-,+****:eдь                                                                                                                                                                                                              @?97;DKNOPKLRWRF8╞                                                                                                                                                                                                                                                                                ю2672*,/5?HHGEEECIWfbXL╒                                                                          цаnC78:;><<;;<>@BCDDCGFDA?:75533330-..---,**0XСс                                                                                                                                                                                                                   B@;89@JPQURNPTQG<Х                                                                                                                                                                                                                                                                                 0475-,/6?GIG58:?GJHFMSY]cmv~ГКТЧЮби┤┴╨╩╔╤╙╓╓╤╤╓╞╖йЫПДА|vrpkijjgdba]XRMFB><;;>>>?@BFEBCCCACCEB>;9542////.----,*)**)LЕ╙                                                                                                                                                                                                                        \E=79?HOPTRQSVSI=d                                                                                                                                                                                                                                                                                 95750..4=EGFCEDACO^`^Sl                                                                ╟МY67:<@CHKPSX^baafkqzВРЮжк┤─╙уф▌▌▄▄▄█с█╔║паХЙВ{unhjddc`\^[XQLF@;96:88:8<=?@ACEEGCDEC@A>:33330.-,,,,+++**(Ct╛¤                                                                                                                                                                                                                            АA=88=HQQTUQQUTK>A                                                                                                                                                                                                                                                                                 \2763.03:DKIACGEDN_fcWH                                                          √╗ДU<>ADGGIOV\bdgillnrv{АКХи╝╧██туус▀┘╤═╤└╢лвЦПКД~xurnhdcb_\XSNHB>:878;:>@A@BFKHFHHFB@?=;865461.00/--,+***(9mкє                                                                                                                                                                                                                                 ╡A>67=FMMU]XSTUNA5                                                                                                                                                                                                                                                                                 Р04641/19AIMFCDDEN^dg\F                                                     Ё░uM;<@CHLPTX^bglqsx}АБГЗЛСЬи╗═╧╪руччцт╓╒╠╢зХЗ{|yuspmggd`\UOLGEC?<;=9::;>?BCDDDEIJKJLKC=:67642/130..--+,+5^Юш                                                                                                                                                                                                                                      ь@?99?ACFEDEFHFCDA>AFOLA9565541/./.,*)TЛ┘                                                                                                                                                                                                                                            CA97:AJMQUTRUZVD7┬                                                                                                                                                                                                                                                                                 15861--1:FOFBFGHO`hicM╡                                          ┘ЧcA@DHMQQRUY]`dglnprwzВЙФЮио╖╦▐ЄэыццччъЄц╥┴╕мдЦМЕ~ymie`^[YXTOJGB=9988979;=>?@ABDDFGEDB@>;888>ENXUH=<;;=8/.-L~─                                                                                                                                                                                                                                                 EB<67AJLNQRRV\SE9К                                                                                                                                                                                                                                                                                 37:83/19DLPHGNOMWqzwmYК                                     ╩УaCHKNPQRX`giihghmqrty|ВКФЮк╗╩┌┘руустс▀╪█╦╜▒леЯЩПНЗzurqia]ZTMGD@==>=9:9:>ADFFEEGGCCACA<98765446ARЕ┤╢Й]AI==Mz┤·                                                                                                                                                                                                                                                     hD>99@FHMRTQQURG=b                                                                                                                                                                                                                                                                                 F49:629DQ[aYOPQ]pВМЧГkp     р╧├▄█┘╪▌ў                  ┼ТfNNONQVZ^accginqttsuv{~ГМФе┤├╬╬╒▐суфс▀╓╫╨╛кЩЛЕДГБ|vrokd]XRLGC?>?;<<=??BCDEFFGEFFFDA=;7643311.105>M{▓┤╢Ы^{▓ё                                                                                                                                                                                                                                                          МD>79=FHKPTTV[VJ?=                                                                                                                                                                                                                                                                                 o5:975@VmyzqjlosЕ▒╞╚└УnЫv[YX_mЬ╥▄╒╚иДqfyос∙      №╒г{hfghgfc``abdfeglnsw}АДЛРШж║═╟╚╥╫█▐▀срр▄╦╝пЪПД|tniflmnmkiggc^VMD<:9<=:;>>?ACDBDCDDGIEA<852/.-0.-./0.116?GUм╒ц                                                                                                                                                                                                                                                                ╜B=988:=>=>?@ACDEEDCAB@=;;961/.-,++--,-./146`Ъу                                                                                                                                                                                                                                                                    їC@:9::BLNPUWWW[PI9║                                                                                                                                                                                                                                                                                 0:J\o~╜╙╞жБkd]alxЗНФ{bP?Gclo|ЙХЬг╢╞╠║Хж╒┌р▌иКДА}|}~ББВДЕИЙКННМИИОЛз▒╢╗╝╗╖▒мжаЧНЗ|z||z}xwtplicc`\YUROKEBAB?BBDEEDEEGEGFC?<<:741/000.../,-,,,-.>rп∙                                                                                                                                                                                                                                                                              LF?:?ADEEEFDCCBA=;866320....,++,++*))VМ┌                                                                                                                                                                                                                                                                                        ЦC?<;>KPQRUUUVRD85                                                                                                                                                                                                                                                                                 М;P]XPV``WPKFGNXf}ЙЗ{k]SP[o}ОИПУЪд╡╔╓╥╩╒▌р▐╪═─╖лкЮЦОЗЕДВysopqnieegikifccaejaYVTQLIHHGCAAA@@AB@ABFHHHHEEDBA@?;9644521//.-,-+***)*L}─                                                                                                                                                                                                                                                                                             ╚BC=;=KPOQTVXYRE93                                                                                                                                                                                                                                                                                 └8HTRQUXSIIEFGLYf}ТРЛ~j[ZYi{Ъо╟┼─ъ№ √чюЎ     ўЄ╬оЫЛ|wrolid_][^__\Z]\_ba\XZ[WSNMJFDA???=BCBABDEDFGKJGFC@@;:523224322/..-,+**+>q░∙                                                                                                                                                                                                                                                                                                 ¤BC@;;HQQTWVVVRG<4э                                                                                                                                                                                                                                                                                ·4F^YMS[XKEFFIO[h}в▒мЬЖle]d}┴ц                 ·╥Тxi_[YZYWUSVVTSRWZ\]\\XQPKGC@=:9=<=@@BDEFFFFDECAA?:6111/.-,)+,.-,,+,+,8cгы                                                                                                                                                                                                                                                                                                       CC>;;CMNQUWWUPH>4▒                                                                                                                                                                                                                                                                                 3C]^^]\WPNMMOT_lЖ▓╣╝╖Ы|p\gЗ╠№                 №╚ПqZ\TTTVVSQPPLKNSU[XUPJE@;:66:9>@DGIHGEGEEDB?=::9751.,--,+*))*,,+/ZУт                                                                                                                                                                                                                                                                                                            JB?:8BNPSVWVSNH>6А                                                                                                                                                                                                                                                                                 D>[^Y]`aYWY[]_esС╜╟╨┴▒К~ejМ╙∙                 ъ▓Еrifdbaa^XSQNJFGIKMNKF@?6;>?@ABBDHILKFAAA>954132421..,+***)(*NВ═                                                                                                                                                                                                                                                                                                                 rC?;:@JNRXZXSOH@5P                                                                                                                                                                                                                                                                                 f:Vffbaa]^^_^aj|С╔╧╨┼▒ЩЕinЛ┴ы                т░М~uolmheeb\PNJEBBBBBA===;ADEEEEFCEDB?;7644331/...0/-,+*)(?t╡¤                                                                                                                                                                                                                                                                                                                     ЫEA:7>KORW[YTRLB86                                                                                                                                                                                                                                                                                 С7Sjjhkmhe`bbdl{С╜╤╨┐▓кНtrЖе╙·              °оБА{xqljifcaUMC:41123:;=ACCFGGECB?<820...,--.//-+))++*;fйя                                                                                                                                                                                                                                                                                                                          ╓C@98;7432/.,++,-,++*()3]Юш                                                                                                                                                                                                                                                                                                                                BB97=GKMQX^WRPG;6я                                                                                                                                                                                                                                                                                 4LkvtqollbaachrМ│╔╙┌╘┴╢йЫХЭЬЧЭжжн╣╤∙■■¤Ї▓ШКzlqmhca^ULE@<9689;>ACDAAB@>:9743100...-+******UЛ╪                                                                                                                                                                                                                                                                                                                                     AA>;;96412000//0--++*)J|─                                                                                                                                                                                                                                                                                                                                          RE@;=CINQVa`^VKA7z                                                                                                                                                                                                                                                                                 I?f{}xojha^^^ckГк╝┘учт╫├├зМСЯЯ|pga_ellnkhhc]UJD=9=AEGGECA>;731.//.-+-,,--,+>pп°                                                                                                                                                                                                                                                                                                                                              xBA=;BJOPUab^VK@7P                                                                                                                                                                                                                                                                                 k=b{В|oge]][\bkВЩ┤█ьъш╥╣йЦПЦЫЫ~j]SKIKOORXYUQHD?>>>BEGIJJKGC>:75210/-,,,+++8eды                                                                                                                                                                                                                                                                                                                                                   дCA=?CHNPTbc`WLB81                                                                                                                                                                                                                                                                                 Э;]x}yrid_```ckБЧм╖└─└╜нЬК}АЪвvbWRNRXY\\ZWWTTTRRPONMPKHGB:75442100/.,/[Тс                                                                                                                                                                                                                                                                                                                                                        █DEABDJOOS^eaYOC7.                                                                                                                                                                                                                                                                                 ▀;Xenplfb[^acdizФлаТй┤║ЬЛ~pvЧФn\NJNQUWX\][YWUTUSOMLNGA<9652120//-OГ╧                                                                                                                                                                                                                                                                                                                                                              BDCBDHLPQW_`[QD9/щ                                                                                                                                                                                                                                                                                 ;Rclmhfb]aaa`fsЛййНЗв╕j_\fАДcUMNQQWTPTZZXYWWTPLIFA:841120/Cx╕■                                                                                                                                                                                                                                                                                                                                                                  BDC@ACGJNYb`\TH<1д                                                                                                                                                                                                                                                                                 ;J\kokfc\`bbaajБХбЩЙГo]VQPZi_VOJJKKMPRUVVSVTROKFA;642/=iмё                                                                                                                                                                                                                                                                                                                                                                       XCDAADIMRY]\YTK>3t                                                                                                                                                                                                                                                                                 OEXgqoiiaab`_^`qИЦШР~e]UMJLSVPJFDDGGLSUVUTTOKE?96:fбь                                                                                                                                                                                                                                                                                                                                                                            ВED=?AFKOV]ZSPL@6I                                                                                                                                                                                                                                                                                 ~BTeljec^^`]WQYdxПЦК|pcXIBEIHHDBACEGINRSRNMIB]Ш┌                                                                                                                                                                                                                                                                                                                                                                                 ▒DFA?DGLPUXUSRND84                                                                                                                                                                                                                                                                                 ╕FUfold_^]][VQS]jОМД}l\J@@CDCAACEIKMOQSQMFNє                                                                                                                                                                                                                                                                                                                                                                                    чAEBAEHKOTXWVSOG80                                                                                                                                                                                                                                                                                 ЎLXemga__][VQLRXdvЗМЗ}rdOAA@CCEGKORONPSQOHv                                                                                                                                                                                                                                                                                                                                                                                       @EB>AHOORVZXVRI:2с                                                                                                                                                                                                                                                                                 ZXbkjd`_^\XUSU[ezРЯгаДq[KFDGKRW]^YQNONOP┴                                                                                                                                                                                                                                                                                                                                                                                        DEDA?FMNQVXZVQJ<3ж                                                                                                                                                                                                                                                                                 i^chheaa_ZZZW[]jЧй▓пСzdTIBJW^u|l^OKJJe                                                                                                                                                                                                                                                                                                                                                                                          `GD?@FJJJPXVRQJ?2o                                                                                                                                                                                                                                                                                 ЙTYceb[^bbbdcairЛ┤┼┐╢ЩАm[LGMXg|ЛБ\NKGЫ                                                                                                                                                                                                                                                                                                                                                                                           ГEDB?BGIHKPNOOM?0G                                                                                                                                                                                                                                                                                 ▓XV[abccedgjnrsЫ║╠╠┤ЯИubOBKYd}КxXNZ                                                                                                                                                                                                                                                                                                                                                                                             ╝GFA@CEFFJNNOPK?4,                                                                                                                                                                                                                                                                                 ┌IMYadgjqy|{yГБМа╕╒▀█▒НvdSBGP]ipiM}                                                                                                                                                                                                                                                                                                                                                                                              єGIC>@EIIHKLMNJB8/                                                                                                                                                                                                                                                                                 №>GS]fhhwГЖ|ВБМЮ▒╓є╓│НveRACFNXWVф                                                                                                                                                                                                                                                                                                                                                                                                DEDA@BGKJJKKKIC=1█                                                                                                                                                                                                                                                                                 6?N[dji{ВБ~ЖГЙФм╞р═мЖoaQ?>==;p                                                                                                                                                                                                                                                                                                                                                                                                  FDC@?ADHHJLMLKFA3Ъ                                                                                                                                                                                                                                                                                 8:IZdgjr|~{vww}ИЮ▓╛оЦxfYK<95B▄                                                                                                                                                                                                                                                                                                                                                                                                   cCDB@AEHIILMLLGA3j                                                                                                                                                                                                                                                                                 X7HX_aacghhfdgmuБНУв~hZQD74У                                                                                                                                                                                                                                                                                                                                                                                                     ТFEECDFIHIOQQNIA5D                                                                                                                                                                                                                                                                                 К8DR^VLPY\XTVX^fnv|pc[J>8m                                                                                                                                                                                                                                                                                                                                                                                                       ╔DGECDILJJLPPMKD7/                                                                                                                                                                                                                                                                                 ╞4?BDDEGFFM[[ZJ:4                                                                                                                                                                                                                                                                                                                                                                                                         OHFDCEJMKKJJJJH?1Ш                                                                                                                                                                                                                                                                                 C2;C?8758ADD@CGGGJW\YL:/                                                                                                                                                                                                                                                                                                                                                                                                         qGFCCEHJKLKKLML?4d                                                                                                                                                                                                                                                                                 l.6@@835858=CIKHHJHECMVXN@4Л                                                                                                                                                                                                                                                                                                                                                                                                        ╥KIECDFHEHHHIHIB6+                                                                                                                                                                                                                                                                                 ь.7AC977;BHPKJJIHEHWXPD8U                                                                                                                                                                                                                                                                                                                                                                                                         ILGCCFHGHIHGLOF9.■                                                                                                                                                                                                                                                                                 ,4>?;868?FJIHGGCAJXVQH;4                                                                                                                                                                                                                                                                                                                                                                                                         FHEBCGHHIMMKLNJ:/╦                                                                                                                                                                                                                                                                                 60.                                                                                                                                                                                                                                                                                                                                                                                                         RFEA?FJJIKIINQK=0М                                                                                                                                                                                                                                                                                 [/9><9427>GLIGFDDMYWSMA0╓                                                                                                                                                                                                                                                                                                                                                                                                        vFECACGKKLMNOOK>2_                                                                                                                                                                                                                                                                                 З-7?>9524;DHIGFHJP^cZOA1Р                                                                                                                                                                                                                                                                                                                                                                                                        вGGC@BCHHKOQRRK@5>                                                                                                                                                                                                                                                                                 ╠.4=?:6357@IHCDHMRbc\PB3Y                                                                                                                                                                                                                                                                                                                                                                                                        ▌EFEABDILNQSTQKC7/                                                                                                                                                                                                                                                                                  ,09;64337>GGEGJMS_e_RA12                                                                                                                                                                                                                                                                                                                                                                                                         EGC>@BHKNQRSTLD9/■                                                                                                                                                                                                                                                                                 ,-:;96411=GFAAGJM[`]SA1.                                                                                                                                                                                                                                                                                                                                                                                                         AGFA>CIKLMOOPMF<3╟                                                                                                                                                                                                                                                                                 I19=;9423;DECBFGGU`_TC41▌                                                                                                                                                                                                                                                                                                                                                                                                        XEDA?AFIJKLOQNG?7Т                                                                                                                                                                                                                                                                                 s.7><940/9BDAAFIKNY]UD40Х                                                                                                                                                                                                                                                                                                                                                                                                        {FGB;@GIJKLONOHB8`                                                                                                                                                                                                                                                                                 н.5;;94106>DEBCGIL[`UB7.c                                                                                                                                                                                                                                                                                                                                                                                                        йDHE@?EGIKMKHLGA7;                                                                                                                                                                                                                                                                                 э,3=<95/.3:ACCEIHHU`[I824                                                                                                                                                                                                                                                                                                                                                                                                        хDFD@AEHKLKHKNJB91                                                                                                                                                                                                                                                                                  -0<>;72//:@CCEIHJR]\P<5.                                                                                                                                                                                                                                                                                                                                                                                                         BFEA@CHKMMKKKID<4Ў                                                                                                                                                                                                                                                                                 4/;>;8513:?BBHLIFM]`RA8.т                                                                                                                                                                                                                                                                                                                                                                                                        DHFB@BGILMMJIGF?6└                                                                                                                                                                                                                                                                                 Y-:A=:5118>B?AGJGKZaTD90Ь                                                                                                                                                                                                                                                                                                                                                                                                        \FFB:@HKMNKGHJGB9К                                                                                                                                                                                                                                                                                 О/8<;85205=CDFJJGM[cXE;0c                                                                                                                                                                                                                                                                                                                                                                                                        ЗGFB=?CHKMKHGGFB9Y                                                                                                                                                                                                                                                                                 ╠+6==963,2                                                                                                                                                                                                                                                                                                                                                                                                        ╡CEB<=CHMNIEFHHC:8                                                                                                                                                                                                                                                                                  -49<;97419ADEEIIM[d^MC72                                                                                                                                                                                                                                                                                                                                                                                                        ёDEE>=BIMLJGDGIE<2                                                                                                                                                                                                                                                                                  /19<;87427>CEFLKLYc_QF92щ                                                                                                                                                                                                                                                                                                                                                                                                        CFE<;?EIJKJIMMH>5ў                                                                                                                                                                                                                                                                                 K/7??;62-4=CBAHMPW__UI;5г                                                                                                                                                                                                                                                                                                                                                                                                        EHJ>7?HJKKLHLNLB6╛                                                                                                                                                                                                                                                                                 v-7=@<83/2;CDBEHHRciZM<7m                                                                                                                                                                                                                                                                                                                                                                                                        cGH@:AGLLOROONMF;Й                                                                                                                                                                                                                                                                                 ▒-6>@<84,2;BA=BFHPZ`]P?6@                                                                                                                                                                                                                                                                                                                                                                                                        ЙFJC:@IOOORSRRQL?`                                                                                                                                                                                                                                                                                 ё+4@FLPQUTRRTPC:                                                                                                                                                                                                                                                                                  +1;@=84,09AB@@LLKP]^XC80э                                                                                                                                                                                                                                                                                                                                                                                                       ЇEOH;73.17=ADCGFBFUa_H;3l                                                                                                                                                                                                                                                                                                                                                                                                        GJJ??CGHJPRPPQPH9╖                                                                                                                                                                                                                                                                                 Р*4@@84//5;BB?CCBEPaaK;3B                                                                                                                                                                                                                                                                                                                                                                                                        mKL@>AFIKOOONSTK:Г                                                                                                                                                                                                                                                                                 ╥)1;<:5//4:AECDD?CQabK=4.                                                                                                                                                                                                                                                                                                                                                                                                        ЧLJA?@EGGKMMNOSM>V                                                                                                                                                                                                                                                                                  )1;>;71.07=B@CGFHR`cN?5.ё                                                                                                                                                                                                                                                                                                                                                                                                       ╚FHE@@FJHGIHKQUO?<                                                                                                                                                                                                                                                                                  /19<;72//5:3..3;BCCGGEJZbRB7/s                                                                                                                                                                                                                                                                                                                                                                                                        DJH@=ADECDFHOVSB5я                                                                                                                                                                                                                                                                                 ~.7?>940/2;DC=BCCFTZTE7.C                                                                                                                                                                                                                                                                                                                                                                                                        QHIC?ADFFHGIMUVF4п                                                                                                                                                                                                                                                                                 ╣.4<=:6422;EFBCEBDTeWI8-*                                                                                                                                                                                                                                                                                                                                                                                                        qHHB>BEGFHKNSWUK6z                                                                                                                                                                                                                                                                                 ў-2;B=73-.8DC?BGHIPWVJ8-,ў                                                                                                                                                                                                                                                                                                                                                                                                       вFKC<=DGHHKNRXZN9S                                                                                                                                                                                                                                                                                  /3:>>83/.5B@?BEEENVXK:.+▒                                                                                                                                                                                                                                                                                                                                                                                                       ╘DHB>@EGFHLNPSVQ<6                                                                                                                                                                                                                                                                                  ;09A>85/-4?>=@FHFKUXM:0,w                                                                                                                                                                                                                                                                                                                                                                                                        CGE=BDDCGSWN=1-G                                                                                                                                                                                                                                                                                                                                                                                                        EHGB=@EHHJLNQUUB6ы                                                                                                                                                                                                                                                                                 Ы09B@;8315<==BFFELTO@5.,∙                                                                                                                                                                                                                                                                                                                                                                                                       xFKD==DGEEFGHSXL;x                                                                                                                                                                                                                                                                                  /6?A>:4026<>@CEFCGXTC71+└                                                                                                                                                                                                                                                                                                                                                                                                       кDGE@BCEDEEEINRPAO                                                                                                                                                                                                                                                                                  /3>DA=8226=?@CHHBCTVH;60В                                                                                                                                                                                                                                                                                                                                                                                                       тEKHBACHGHHFGNUQE9                                                                                                                                                                                                                                                                                  O1:635=CBEGE@@RUH<5,K                                                                                                                                                                                                                                                                                                                                                                                                        DIGC@?DDEHHJORRF7                                                                                                                                                                                                                                                                                  Г1:AB=:4.2;??AFHA?NUK>5.-                                                                                                                                                                                                                                                                                                                                                                                                        BIIBA>:61/:A@?AFDCJNJ?5+)¤                                                                                                                                                                                                                                                                                                                                                                                                       XFJG@>CEEEEFHUZL;и                                                                                                                                                                                                                                                                                 ·-6<>;97528===BHDBIROC5*&╜                                                                                                                                                                                                                                                                                                                                                                                                       FIFB@BDDEEEHSUL=v                                                                                                                                                                                                                                                                                  -4:>>;8206>>>@FHFHMNF9,(                                                                                                                                                                                                                                                                                                                                                                                                       │BHIB?CDDFEFGQUN@P                                                                                                                                                                                                                                                                                  >0=@>:7213<@ABFHEGOQI:,(L                                                                                                                                                                                                                                                                                                                                                                                                       ъAGF@?CB@BCEIOROB6                                                                                                                                                                                                                                                                                  g-:A>:62.1;AACGKHGMPK<-*,                                                                                                                                                                                                                                                                                                                                                                                                        BJKC;?BABCDENTQD8                                                                                                                                                                                                                                                                                  Я/9@@>:711;CEEIIFGOQK?/*)                                                                                                                                                                                                                                                                                                                                                                                                        DGJF?@B@ABFGLRQH;▐                                                                                                                                                                                                                                                                                 у/8BB=:601:@CDFHEAJSQC1,)╦                                                                                                                                                                                                                                                                                                                                                                                                       ]FJD=@DBA@CEKQQJ?б                                                                                                                                                                                                                                                                                  07BFA=9228ACBCFFDHPRF3+)Д                                                                                                                                                                                                                                                                                                                                                                                                       АCGB@=ABBCDFKRUPCs                                                                                                                                                                                                                                                                                  24AC=:6028?CEFGE@DTWJ6.*O                                                                                                                                                                                                                                                                                                                                                                                                       ╢CHC>?CCBBDGKVUQHR                                                                                                                                                                                                                                                                                  S0?EB=81-5=CEEFFBBQXK80+.                                                                                                                                                                                                                                                                                                                                                                                                       яCJJ@>CECABFIRSRL?                                                                                                                                                                                                                                                                                  Д/=CB>8202;DFDEC?APXN<3**                                                                                                                                                                                                                                                                                                                                                                                                        AHIEDEFBADGIPSQL?                                                                                                                                                                                                                                                                                  ┐.:BD?83/2;BDAABABNVO?4*(╥                                                                                                                                                                                                                                                                                                                                                                                                       DIKFBDGFBACDLSTM@╘                                                                                                                                                                                                                                                                                 ■.8@CB;411:BDB>A?@IQOD8+*О                                                                                                                                                                                                                                                                                                                                                                                                       bCGDA@BBBCCDKPTNBд                                                                                                                                                                                                                                                                                  07@EC>6019ADCBGB?FSTH<--Y                                                                                                                                                                                                                                                                                                                                                                                                       ЛCIG@@BCCB@=GORNCr                                                                                                                                                                                                                                                                                  H5?EC=70-6@D@=BBBGNOL;>CCBABGNTQDN                                                                                                                                                                                                                                                                                  m4>DC>9..3;?>>BB?CKPM<.))                                                                                                                                                                                                                                                                                                                                                                                                       ў>FF;;>ACAA?GMQMC9                                                                                                                                                                                                                                                                                  з1;CE@:2.1;B>=BFDCIQO=.**┌                                                                                                                                                                                                                                                                                                                                                                                                       >GM?;?CECBDFLRRF8                                                                                                                                                                                                                                                                                  ъ/8ADA:3/0GI<;@AACCGIPQK>g                                                                                                                                                                                                                                                                                  W/;CA<7/39>B??DDBGPUL8.*)                                                                                                                                                                                                                                                                                                                                                                                                       ╦=JI>;@DEFGHJQRL@H                                                                                                                                                                                                                                                                                  Й0;DD=:326@FB>CGFHNSM:.*)р                                                                                                                                                                                                                                                                                                                                                                                                      №;IH?;?CFEHGHNQNB:                                                                                                                                                                                                                                                                                  ╞.:CB>:426BFFGNYV@3,([                                                                                                                                                                                                                                                                                                                                                                                                       JEGE;;?AAADGKPNF<╦                                                                                                                                                                                                                                                                                  -6=BB<5159@DAADCDMXWD6-(5                                                                                                                                                                                                                                                                                                                                                                                                       jAFHA<=?DD@7127=CABFGHLSXH9/*'                                                                                                                                                                                                                                                                                                                                                                                                       ЪBGH?=@B?@CC@BDFGHF=B                                                                                                                                                                                                                                                                                  м09DF@:1/3:ACBFFDDLTL@2*)Ю                                                                                                                                                                                                                                                                                                                                                                                                       ;?C?<@DA>@CEFIE>5                                                                                                                                                                                                                                                                                  э/6AHE:4.1:BA@BEEDFNKC4++d                                                                                                                                                                                                                                                                                                                                                                                                       8@GA<@?BDCDHUOH8,*6                                                                                                                                                                                                                                                                                                                                                                                                       NAEE@=?BA?=>BFD;7╞                                                                                                                                                                                                                                                                                  96>HE@9//8?>=?ABDGORJ:.*)                                                                                                                                                                                                                                                                                                                                                                                                       r=JG=;@C>>==@GJ>8Р                                                                                                                                                                                                                                                                                  ^3;BE@;416=@@?ABBEPPJ<.)(ы                                                                                                                                                                                                                                                                                                                                                                                                      б:EHB>>@9:9;=BE>6[                                                                                                                                                                                                                                                                                  Н08?B?:3/5<>=>CDCBMPK=2*)г                                                                                                                                                                                                                                                                                                                                                                                                      р;IJB<@A=:::=DJC69                                                                                                                                                                                                                                                                                  ╠.6@FA:3/2;@=3+*h                                                                                                                                                                                                                                                                                                                                                                                                       :HJD>?B@=<>AFIG92                                                                                                                                                                                                                                                                                   .6@BB<513:>=>BDEDGOLA4,+?                                                                                                                                                                                                                                                                                                                                                                                                       :EHD@AE@9;=BGKE;4Ї                                                                                                                                                                                                                                                                                  -4?CC>8359@A?AEFECKLB6.++                                                                                                                                                                                                                                                                                                                                                                                                       MBIG?<@?<:;@DGD=3║                                                                                                                                                                                                                                                                                  K3>BDA9347BDDCCDGFMMD90)*Ё                                                                                                                                                                                                                                                                                                                                                                                                      w>EEB@B?:9;>CGD=6Б                                                                                                                                                                                                                                                                                  x1DGIA7]                                                                                                                                                                                                                                                                                  ▒09@GC=744=DDBBCBCIKG>3+,o                                                                                                                                                                                                                                                                                                                                                                                                      щ;CFEA@@=;<>BEFB78                                                                                                                                                                                                                                                                                  Ё-8@EB?;738AACDECAELI?3++?                                                                                                                                                                                                                                                                                                                                                                                                       :AEDACF@;;=@DFC60                                                                                                                                                                                                                                                                                   /8>FEB<607CDABCECBGHB5)*+                                                                                                                                                                                                                                                                                                                                                                                                       >?GFD@C?<:;>BEC82ю                                                                                                                                                                                                                                                                                  >6;DFC<636ACDBADDEJKF:++-Ў                                                                                                                                                                                                                                                                                                                                                                                                      XAHJHDFB=<:=CIE;6╖                                                                                                                                                                                                                                                                                  c19DD?:504ACBCCDDBGMH;-,.│                                                                                                                                                                                                                                                                                                                                                                                                      Е;GKGBEFB@@AEHF>:Е                                                                                                                                                                                                                                                                                  Т08ACA<723>CDCCEBDJNI=-++x                                                                                                                                                                                                                                                                                                                                                                                                      ╡7BGGFFEA?@CHKG@:V                                                                                                                                                                                                                                                                                  ╒.7@CA<813=BDDFHDAIQPB/,*E                                                                                                                                                                                                                                                                                                                                                                                                      ю7DJHGEGA>?DHIID<;                                                                                                                                                                                                                                                                                   06ADB<823=AEHKGD=7                                                                                                                                                                                                                                                                                   14@BA<713:@CEDFDBGOSG5.*+∙                                                                                                                                                                                                                                                                                                                                                                                                      ;BIHCBGC>=AEGID?7ъ                                                                                                                                                                                                                                                                                  L0CB@CCBDNTL9-)*╕                                                                                                                                                                                                                                                                                                                                                                                                      _=GIB>CE@<>BDEC<5п                                                                                                                                                                                                                                                                                  x/9?B>8006BFC<>BCFC<76                                                                                                                                                                                                                                                                                   /7>DC<5137>CCDDBCKWZN;+((¤                                                                                                                                                                                                                                                                                                                                                                                                      3>FF>?BA;9=@EGA73                                                                                                                                                                                                                                                                                   ?6?EE>7316AGEDCADJSXR;*)*┐                                                                                                                                                                                                                                                                                                                                                                                                      =<;>CGGA:6ь                                                                                                                                                                                                                                                                                  f4;;?DGID=6к                                                                                                                                                                                                                                                                                  Ъ1;EFA;504?GDBC@CFKPO@-**N                                                                                                                                                                                                                                                                                                                                                                                                      Р8DJ>=>A>=AEHHE?9z                                                                                                                                                                                                                                                                                  ┌08BGD<104>FGEEDCCHNOC.*)-                                                                                                                                                                                                                                                                                                                                                                                                      ╬5>D?=?A><@CHKHA9O                                                                                                                                                                                                                                                                                   /6BFD=6,/HFA;/.7CFCABB@DKOH3+))┼                                                                                                                                                                                                                                                                                                                                                                                                      1104:CFB@?<;CQR<2-+-                                                                                                                                                                                                                                                                                                                                                                                                      Ы7DFDCEFB>DLQSLA:t                                                                                                                                                                                                                                                                                  ∙.8BFEA5/08AECBB@<@PV@3,+)                                                                                                                                                                                                                                                                                                                                                                                                      ╙1AJDADGFAAJPSNC=L                                                                                                                                                                                                                                                                                   07?CEA8216>FDDA<;@LMB4+()╘                                                                                                                                                                                                                                                                                                                                                                                                      /;EDCFGC@BJOSQIB5                                                                                                                                                                                                                                                                                   A4=DC>90/3;CBBA?=>GRF5,''Л                                                                                                                                                                                                                                                                                                                                                                                                      .:HHA@BBA@GMQSMB8                                                                                                                                                                                                                                                                                   l3;DE@:3/1/)'.                                                                                                                                                                                                                                                                                                                                                                                                      o6HJDACFDCFNTTOC:Я                                                                                                                                                                                                                                                                                  ф08BGC>8//:EDBAA@?>IKA0))*                                                                                                                                                                                                                                                                                                                                                                                                      е4DJFA@CECEKTVPF=r                                                                                                                                                                                                                                                                                   .5=DF@9208CFBA@AA@GJB3)((╘                                                                                                                                                                                                                                                                                                                                                                                                     с0>GEA=@A?CINQOHAQ                                                                                                                                                                                                                                                                                   11C=>@@=:HPF6+)'Т                                                                                                                                                                                                                                                                                                                                                                                                      />JG>;?@@DGKMLGE@                                                                                                                                                                                                                                                                                   T08FJF@5/5?FC?@=9;HNH9,))[                                                                                                                                                                                                                                                                                                                                                                                                      2;ED@>@B@AFIMMMIB                                                                                                                                                                                                                                                                                   В.9FHFB717>EDB@><:ESK:.*(0                                                                                                                                                                                                                                                                                                                                                                                                      Q8FF?>BEAAFHLPQJD┘                                                                                                                                                                                                                                                                                  └08ELHC914;8AUQB1*')с                                                                                                                                                                                                                                                                                                                                                                                                     м2@EB?BDB@EHMQSKEv                                                                                                                                                                                                                                                                                   -3AKIG=549CGEBA@JIAAECCEHOTRKEM                                                                                                                                                                                                                                                                                   C3?GLF>868CHFA@>;@LOE6+''\                                                                                                                                                                                                                                                                                                                                                                                                      /;EGFGIFCFIMQSLH?                                                                                                                                                                                                                                                                                   n1>GJF=845BGECA>=?HKD8,'&/                                                                                                                                                                                                                                                                                                                                                                                                      38BFFDGEDFHILNIE>                                                                                                                                                                                                                                                                                   ж1;EKH@842>HFC@=;>DGD:/&%&                                                                                                                                                                                                                                                                                                                                                                                                      S5@HJIIIFDFHLPLGA╓                                                                                                                                                                                                                                                                                  щ/8BJKC:55FIJJMGCCGKONICЫ                                                                                                                                                                                                                                                                                   .4=627?BA??<99ELH7'&&4                                                                                                                                                                                                                                                                                                                                                                                                      -7EKIIIGEBCHNNGA<                                                                                                                                                                                                                                                                                   И/8CHF@833:CDC@<68BJF9()&'                                                                                                                                                                                                                                                                                                                                                                                                      87BIIIKJHEFIKNH?<                                                                                                                                                                                                                                                                                   ┼/4CEF@9148@DCA>:8?LL<)(&'ы                                                                                                                                                                                                                                                                                                                                                                                                     \6AHHEHKGCBFGIHC=═                                                                                                                                                                                                                                                                                   .2@DC@:427AED?><9;IL?+&&&в                                                                                                                                                                                                                                                                                                                                                                                                     Й4?IKHGHFDEGGIGA;Т                                                                                                                                                                                                                                                                                   .2=BEB=547@FD@=;4:FK?.)&&e                                                                                                                                                                                                                                                                                                                                                                                                     ╞2=FIHIHGEDGHIGB;e                                                                                                                                                                                                                                                                                   D1CA<<>::BF?1'%':                                                                                                                                                                                                                                                                                                                                                                                                     ¤1<;99BIC4)$&(                                                                                                                                                                                                                                                                                                                                                                                                      0:DKNMMHBADGIIEA<                                                                                                                                                                                                                                                                                   м-9@DE?814:@@<<;97@HF6*%&'я                                                                                                                                                                                                                                                                                                                                                                                                     ?8BKOLIDA?@DKLHC=·                                                                                                                                                                                                                                                                                  э.9@EE@8538@C?;:79?EC:,%%'к                                                                                                                                                                                                                                                                                                                                                                                                     i6?JQLKFC??BJPMF>╟                                                                                                                                                                                                                                                                                   /8AFGE;327>DB=987-'%&k                                                                                                                                                                                                                                                                                                                                                                                                     Ц4EFD=6/6BFC=;98:AFD0(&(>                                                                                                                                                                                                                                                                                                                                                                                                     ╠1:GRKHDB@?BEIIE?c                                                                                                                                                                                                                                                                                   \4=CGE@847AGD?>978@HF4)&'(                                                                                                                                                                                                                                                                                                                                                                                                      .8DKFDA@>GI:+)((є                                                                                                                                                                                                                                                                                                                                                                                                     /8DPJCACB?AADEGB8                                                                                                                                                                                                                                                                                   ╠0:BGHC;44=ED@<::;=DH?-**)░                                                                                                                                                                                                                                                                                                                                                                                                     I9DKKECB@?@@BCEB:Ї                                                                                                                                                                                                                                                                                   -6?EGD?33;889?HD2,))@                                                                                                                                                                                                                                                                                                                                                                                                     б3??@AA>CDA;Б                                                                                                                                                                                                                                                                                   G0;DHGE649?CB?;856>JH3-+))                                                                                                                                                                                                                                                                                                                                                                                                     ▌3DC?=:86>ML8-)((°                                                                                                                                                                                                                                                                                                                                                                                                     2;GNC=>AA@@>CCC>:                                                                                                                                                                                                                                                                                   ▒-7AGHC:56NN;/)&(╕                                                                                                                                                                                                                                                                                                                                                                                                     49CGA>AB@>>=@CB=5                                                                                                                                                                                                                                                                                   я,6?DF@824/)&'u                                                                                                                                                                                                                                                                                                                                                                                                     O8AKE<;>><<=>?@=7ю                                                                                                                                                                                                                                                                                   +4=DJ@8539CE><:66=HJA2)&&F                                                                                                                                                                                                                                                                                                                                                                                                     u8>=;>;===<8┤                                                                                                                                                                                                                                                                                   71/(((╛                                                                                                                                                                                                                                                                                                                                                                                                     5:AEA?ADDHGDBA?;6                                                                                                                                                                                                                                                                                   ╘/8AGIE>86;B=77778;GL@0)('{                                                                                                                                                                                                                                                                                                                                                                                                     :;BGD??BDFHGCAA:1                                                                                                                                                                                                                                                                                    ,6@HOGC:89>>::7549FLA4+*(G                                                                                                                                                                                                                                                                                                                                                                                                     TA<87435BVY?-)(+                                                                                                                                                                                                                                                                                                                                                                                                     ╝9AKOOICA?LSUSME8t                                                                                                                                                                                                                                                                                   y.6AEFA849KOOJFEDIOUTOG>N                                                                                                                                                                                                                                                                                   ▒-4AEHE;569EMQNGB@DJQTVUE5                                                                                                                                                                                                                                                                                    ,1;DHD=75;CA;:8538P_M5)%(,                                                                                                                                                                                                                                                                                                                                                                                                     ]9BKPNF@:AIPUVQH5ш                                                                                                                                                                                                                                                                                   <19EIE=879@C>;9529IPI9+&'*                                                                                                                                                                                                                                                                                                                                                                                                     К6=KURF?=?FPUSOI3е                                                                                                                                                                                                                                                                                   d.7EHF@958@B<99648ERO>.&(*═                                                                                                                                                                                                                                                                                                                                                                                                    ┬4=KROHAAAFNRRNH8r                                                                                                                                                                                                                                                                                   Щ.6AIGC<86>F?:8515@KN@.&)*З                                                                                                                                                                                                                                                                                                                                                                                                    ·4=IPOD=@AFPSOKG;I                                                                                                                                                                                                                                                                                   ╪,5=FJE<67:B>:97212┌                                                                                                                                                                                                                                                                                   P08EGF@848EC<86424@RP;*)))╥                                                                                                                                                                                                                                                                                                                                                                                                    У:BLPHAB?BFIIFC?3Ю                                                                                                                                                                                                                                                                                   ~07CIHB=79DD>76534:GJ=+)''П                                                                                                                                                                                                                                                                                                                                                                                                    ╤:=IQNBA@AFJKHB>3l                                                                                                                                                                                                                                                                                   ║/5@FGE=58BC<987538JPB+)('U                                                                                                                                                                                                                                                                                                                                                                                                     >ELPMCA?AIMLJC@6C                                                                                                                                                                                                                                                                                   є-2>GJH@77>A>:67549IUH,(('/                                                                                                                                                                                                                                                                                                                                                                                                     DIOPLB??AEIJG@<8/                                                                                                                                                                                                                                                                                    ,/>FLLD99<==;87415ITF/*(')                                                                                                                                                                                                                                                                                                                                                                                                     YQTSMB?>ABEFG?;6/                                                                                                                                                                                                                                                                                    <.;HPNE838==965113CMD/(%%'█                                                                                                                                                                                                                                                                                                                                                                                                    Кvk[QF<>ACCCB?<70┌                                                                                                                                                                                                                                                                                   i-9EOOG:859<<97403?IC/)&&(Т                                                                                                                                                                                                                                                                                                                                                                                                    ╟ph_TJCABCB?<=<80Ъ                                                                                                                                                                                                                                                                                   Ю+7BKMG?<7:=<87524=:75049=;5+&%(3                                                                                                                                                                                                                                                                                                                                                                                                    №лХjWLDBCDEA>AG@6G                                                                                                                                                                                                                                                                                    *1?LPLA849==;77548<=7-''()                                                                                                                                                                                                                                                                                                                                                                                                     дЩrVM:>DDB@=@:36466:<9/'')*р                                                                                                                                                                                                                                                                                                                                                                                                    беzXN?3                                                                                                                                                                                                                                                                                    U/7DKJD;55;?<78656;A;/*))*а                                                                                                                                                                                                                                                                                                                                                                                                    здzVNC>?@@@>?FC:1╦                                                                                                                                                                                                                                                                                   В,5AIHE<55;>:377637=>2((()d                                                                                                                                                                                                                                                                                                                                                                                                    йШxUSF===@A@CHD:2У                                                                                                                                                                                                                                                                                   ┐.3@IIE;529>=898747;;4+(((6                                                                                                                                                                                                                                                                                                                                                                                                    мЗrPNI@<>BEFDCC>3e                                                                                                                                                                                                                                                                                   ∙,3=FIG<338<;789503;>6*&&&(                                                                                                                                                                                                                                                                                                                                                                                                    ╛}lQSK<<=BHOA?@<6>                                                                                                                                                                                                                                                                                    -1/@AEIC@@>;5                                                                                                                                                                                                                                                                                    g-9DJJD:549<:44311586/)'&'f                                                                                                                                                                                                                                                                                                                                                                                                    \XLKKE?=?@EEA@>:5╬                                                                                                                                                                                                                                                                                   Ю,7CHLG;747;>964/0596.)&%'9                                                                                                                                                                                                                                                                                                                                                                                                    Z]MIIFCCDEGEB@?;6Т                                                                                                                                                                                                                                                                                   ц+4?GJI>536:=966203:;1)&'**                                                                                                                                                                                                                                                                                                                                                                                                    NTPKLI@@BCIQHDA<8f                                                                                                                                                                                                                                                                                    ,4;64337:>4.)'**л                                                                                                                                                                                                                                                                                                                                                                                                   BGFGLJFEEEFHMKF@:5                                                                                                                                                                                                                                                                                    W/7CIGB=637?;530048:3-'&*+l                                                                                                                                                                                                                                                                                                                                                                                                   LHEBHJJIHEEJNJD?:6¤                                                                                                                                                                                                                                                                                   И.5?GIC;627A=742017<6-)()*<                                                                                                                                                                                                                                                                                                                                                                                                   QHEDGKJIEEGMMIE?:7═                                                                                                                                                                                                                                                                                   ─-4?JHD<617B>754437;91)'(**                                                                                                                                                                                                                                                                                                                                                                                                   SFB@HNMIHFGLLHDA?:Т                                                                                                                                                                                                                                                                                   ¤*3<3+&&))я                                                                                                                                                                                                                                                                                                                                                                                                  cFBAGKJJJIMRPIECB=h                                                                                                                                                                                                                                                                                    *0;DJIB838?>756543:=3+((*)о                                                                                                                                                                                                                                                                                                                                                                                                  kGB;CLMMKMPSTKEDC?D                                                                                                                                                                                                                                                                                    B/9CLJB925@LNLIJSYWMKNMC;                                                                                                                                                                                                                                                                                    l-5BING<659<:866558;6.)'(*B                                                                                                                                                                                                                                                                                                                                                                                                  ФFB:626=;755425:7.(&(*)                                                                                                                                                                                                                                                                                                                                                                                                  ░EB8:JLMIHQV[]XVVOG╩                                                                                                                                                                                                                                                                                   ч*/61499641--991)&%%&C                                                                                                                                                                                                                                                                                                                                                                                                  IH;=M`}ЧбСЕЖПг╛┌▐╚З^                                                                                                                                                                                                                                                                                   О.2>KKF>5-2<;74200771+'$&()                                                                                                                                                                                                                                                                                                                                                                                                  VD>GSЛ└╞вХПИЦи├┌ъ▒lPй                                                                                                                                                                                                                                                                                  ╬/39IPJ@713::8651.594-)&''(∙                                                                                                                                                                                                                                                                                                                                                                                                 xQTZhм╝╖Ч{hfkwКМБh`OM                                                                                                                                                                                                                                                                                   -/8FKIC9/1<:64320453.)&''(┐                                                                                                                                                                                                                                                                                                                                                                                                 зbivФиЮgb_ciqoobYLA╞                                                                                                                                                                                                                                                                                  )-6EKKF=107964310252.)&$%'|                                                                                                                                                                                                                                                                                                                                                                                                 k{ИРxibgmcXZ[agia^PD>P                                                                                                                                                                                                                                                                                  D+6CJNJ@558842120132-)&%&'J                                                                                                                                                                                                                                                                                                                                                                                               э`tКЭЖldeggc`\_cehg[JB;8·                                                                                                                                                                                                                                                                                 p,6AJNKC727961010264/+'&'&,                                                                                                                                                                                                                                                                                                                                                                                              ╝ap|ЖВwjaekopllkkjie_MEB=}                                                                                                                                                                                                                                                                                 л+1>IONF:867641121572*&&&(*                                                                                                                                                                                                                                                                                                                                                                                             Мhsy~~{vkhhlu|{zwsnhd\NHEAC                                                                                                                                                                                                                                                                                 ь*.;GNNH=879852123340*&$%)*─                                                                                                                                                                                                                                                                                                                                                                                           w}{xuqrvrmoxб╣├╣йХДse]YQKKJH▐                                                                                                                                                                                                                                                                                 +.8DPQJ@958:84322562+'&%'(Б                                                                                                                                                                                                                                                                                                                                                                                         еsЛГЕwnmprrqzМл┼─╩┘╥м}j`^\[ZWQГ                                                                                                                                                                                                                                                                                 918CNQJA86:<74214563-)'&'*O                                                                                                                                                                                                                                                                                                                                                                                       °БДПЖwrkhihc[hВШк╖║╩╬╙╞ВmioyЖЗВvh                                                                                                                                                                                                                                                                                 a06COSLC936;;64456870)'&&)-                                                                                                                                                                                                                                                                                                                                                                                      дАМСМumhc`]Z_eyд╕мй┴╦─иЗmn{ДУгаНx                                                                                                                                                                                                                                                                                 У,3@NSOD:548844665672)&&'((                                                                                                                                                                                                                                                                                                                                                                                    еНПСТТК}qbWSOMF@NjГЩЮИejmrrpsДС╗┴└┐Ъї                                                                                                                                                                                                                                                                                ╘,0658;:6741464-)&&&(Ж                                                                                                                                                                                                                                                                                                                                                                              ╥ТКОУХХХЦПБuh]WQMKIGE??GPUX[ekkhlvДЛФап┤д─                                                                                                                                                                                                                                                                                 1-5CMLGA44:<86644574.*%%'(P                                                                                                                                                                                                                                                                                                                                                                           фОsЙННПРУССЖzocZZWWWTMFC>?@BEIT_efhmuwxЙОРКХ                                                                                                                                                                                                                                                                                 L+/@OOIC747975663576/*&&''.                                                                                                                                                                                                                                                                                                                                                                         зyБДИЙЙИЗЖБ}qd\URY\^feaZJB;;=<=@K\eeackprb[ZWYi                                                                                                                                                                                                                                                                                 w(.?LNME879:85676565.*%&&(+                                                                                                                                                                                                                                                                                                                                                                      ╡xxДКЙЛЙЗДБ~{wka[TSVZ`cfgaXL>658856@WVOP[hnmdSHHDK                                                                                                                                                                                                                                                                                 п)/?KMKF:68;;65556981.)((**╘                                                                                                                                                                                                                                                                                                                                                                  ╔Вrzz|ВЕГЖ}ungb[SVUV]`^b^]WLC>91...037;EP^ktn_TTVN                                                                                                                                                                                                                                                                                  +-9FLNJ>668:75411541-(%&((S                                                                                                                                                                                                                                                                                                                                                           ЁФcgmstuy~}|wqjd\XROMMQUTSNIC?;97532.-+***,047:=BM_enm^QNOJ                                                                                                                                                                                                                                                                                  6-6CLPI>8569:7853241.(''&&,                                                                                                                                                                                                                                                                                                                                                        ╜xYgsyuyyxx{}{xrke^VTMLKKMPPPKE@;62/.-,,,-*+--014789>L^ism^PMND¤                                                                                                                                                                                                                                                                                 ^-5ALNIA967983544210,)(&&&'                                                                                                                                                                                                                                                                                                                                                     ▓dXcovxxwtxzxvvqlga\YVSQMLMMKHE?95530.----,04221579?;:;=Jamto\KB:2ю                                                                                                                                                                                                                                                                                 Ч+4?KPLE;559<7541222.+(&'''┘                                                                                                                                                                                                                                                                                                                                                ЇОPKYgkxwy{{xuwvrmjfb]XTQQONOMMNIE>75430//-.0245667779:;=<<>Ibkvq\I@94▀                                                                                                                                                                                                                                                                                 ┘*/749<522/.131,(&&'(^                                                                                                                                                                                                                                                                                                                                          ╗gIUclsqrsrqsvrtskd]WURSTSRPONMLKE@>>:400.144799;:888:8:8543133459CTdpseRB30╕                                                                                                                                                                                                                                                                                  .,4@IKIA847:7651/154.(&&()4                                                                                                                                                                                                                                                                                                                                      ЎЯaU[djopspnnnmormga[UQNNJLOPOQMJFB<96999757:9:9<=:;98642132000//11049CT^oun^I91Ы                                                                                                                                                                                                                                                                                  O,0=HMMC836>96401375/+'&(**                                                                                                                                                                                                                                                                                                                                   ╠{HP[gqmmpqrqlkjhgfb\XSPMKMKKLLKLHD>:8656788:<=:;<;<:6410//,+-,,-./010362Ы                                                                                                                                                                                                                                                                                  |+/9GONE:34<:61/.0550,)'')*р                                                                                                                                                                                                                                                                                                                               │hR]dhifgihkoprrjic[TOIJJJKLKLLLJD?:42123258;?=<=<;60.-,******))**+++.13776:<631//22/-)'')*_                                                                                                                                                                                                                                                                                                                        ╜qGS[dhjlifhkmlmjigc]VNOOMIGEGFFDB@<998853325<<<;77530/./-+++,+***)*0k╦ ¤p*.27ENSMFCBBCC@;630R                                                                                                                                                                                                                                                                                   **2DJOH?:8784110122/-*((**6                                                                                                                                                                                                                                                                                                                    °ЫSGOYdfkmjkhfffgjjgd]WSRPNNMHFDBBB@>:75545567:8<;:73/0/.,++*+**+,++*:Жы       Ф;6>LNE@>:<:;7420/2                                                                                                                                                                                                                                                                                   :*3AILGA967;6421211/,*'&(**                                                                                                                                                                                                                                                                                                                 ╪АOT\bghjhfdaaebba_\ZVSLEHKKNMJGEB?;30/133557@<777430-+)+,+,**)))()))Lг             ╢8DEA9768996200..√                                                                                                                                                                                                                                                                                  b)0>FJHB<52775441/120,('&)+ч                                                                                                                                                          ¤╬Ъ═ў                                                                                                                                              к[DMXcdkmkghhggddd`_\UOLFG?BDFKLHEA>9741--/27:8;:86521.,+*)))))*)(((*e╜                 D=@;7868;85333.,│                                                                                                                                                                                                                                                                                  Щ).;FKID;42573331002/,)&&'+б                                                                                                                                                       ╖:+/594/8У                                                                                                                                        юЙLIR[cfjdca][a_ceb_\YVOIEEDEEEHHKMEA:645555698885431/,,--,*)''&'(''&3yх                    B==?;8543/,@                                                                                                                                                                                                                                                                                   (*4CHJG?83670122122/,('&'):                                                                                                                                                   ┐/)*+*,3BMJD;2.e                                                                                                                               √дS@IVdefa`_\]aa^][YWTPMMJFEHKFFCBA>:75456856569:650-,+++*+(())*))''&$_о                           A9>A@<<<><9543.-,                                                                                                                                                                                                                                                                                   0*/?HKHC90496220.252/+(''')                                                                                                                                                  j,+++**-4?KTKE<4/█                                                                                                                           █yGELV]cffifbca__a_^ZUPKHIHGEDCCDDA<9633.234669:7653//,,***,++*)(((('1oр                              B7?A@;9;==;8861++ё                                                                                                                                                                                                                                                                                  P)-=;<=<8/-c                                                                                                                                                                                                                                                                                  ╛++4DLKE<2.79520.,/10,)&(''e                                                                                                                                              Е,-++--.,-/49G_bUNIH@0Ё                                                                                                               ╔zEHQW\_\__YVZY[VWYZVOLHGHGEAC@@B@:53001.117;<=;31100.-*'(()(()((''''.i╒                                        <39@@<98;<<<<=<1-;                                                                                                                                                                                                                                                                                  ∙)(2CIJG?4257410.,...-)&''(<                                                                                                                                             ┤30.-.0353235:Nhb]UOKB0B                                                                                                           √дWAHOWdfcha^_^]]]Z]WUSRRPFDCDEE@CBA>942./02348;:863/.../.*((%'((((((':Дя                                           <18AB<99;><;;<9100                                                                                                                                                                                                                                                                                   )*/AJMJB7039830-+,///,('),*                                                                                                                                            ш>97646:<=>===DSmxcVPLB2,Т                                                                                                       ▐|ECMT[cca`]\\[]\ZYWTQPLJGGOOFBBDC>8632102/27:<<9:851.,,*++,+)(('&'(*(Oв                                               <28@A<::<@>:9;92.-┘                                                                                                                                                                                                                                                                                  =*.?HKJD7325420.,-..-+&'*+*я                                                                                                                                           B<<:;<>ACFECBCHVmndTNH>31.╞                                                                                                   │c?GOV_a_ca`^[ZZYXZWSPMKIFHFEFKHEC@=:64231135788::731/.-,++*****)(((',f─                                                  ;28CF>8:<==<;<62/.С                                                                                                                                                                                                                                                                                  i),DA:89;<<;731/.U                                                                                                                                                                                                                                                                                  Э(,8EMNF:3/36410-..--*&),,+p                                                                                                                                        ┐D8897>GJNPMNNLKFJVda]UJCA<<950Й                                                                                          ├wBIPX^a_a^^\YYY[]^ZTPLIEBBAAAB@B?=:851-./1238;997531///,*)()(((((&'''FЭ№                                                        ;-2=CA<99;=><631/03                                                                                                                                                                                                                                                                                  р),6CLOH=106740/-,./-+(&+.-B                                                                                                                                      ├M=====>BGLNOMNRPQMNS]`]VQNLHFCA:4p                                                                                     √з]LPV\`]`^[XUSUTRRPOOMGD@@CACGDA@<9740000.15:::8:61.-,-++***()(*((()('b╢                                                            8,0;CC<97821/.-                                                                                                                                                                                                                                                                                   (,3ALNH@5147631.,,..,*(,,*)                                                                                                                                    ┴FIOLC72132/1/,)*+*)&(*)(є                                                                                                                                 ╔E88=AEEFFD@>?;==>CBIKMORW[XRPT]ktncOB<6S                                                                             ░cJQW[^[]^]WTRTSQQQMJIECEEFEDDBB@;7654211/789:;:=82.-*)())++*)(**+,-++AШє                                                                  7),5BE>327:73/--y                                                                                                                                                                                                                                                                                  V,/;JOKD9226521/++,-,+)'())п                                                                                                                               ╦G<=@BDEGHGFC??>>?BEGHJNPRVXZWRNXuМРФqREA:7J                                                                        чLGOV^aada_\YWSRPROKHFDFEDABDHFFA?=953220/148>=;;97640,*(''()++*)*++,,Z▒                                                                      8*+2;B?868JT[aYYZZYVSVUTSPMJFBBAACDGDCBABB<95424247:>>;==;61--,.,*'&&%*3:?:-/5m┌                                                                         9)*0=HE868<>=97530//                                                                                                                                                                                                                                                                                  ─*,7EMLI=2177301.-//,++))*+D                                                                                                                        ъЖN??@CDHJKLMLNQQRRQPLHHKLPROPTZ`fjg\[csО│ЫДeSLD?<:7612uЁ                                                           ёТK?FNY\]d]WUUTSRPSQNKJHFBC@@DFEHFB?;98664456:<<=<;850.+++****('&').8UTLХё                                                                            8(-1Щ                                                      ╚uBGNT]X\\VTSQQMNQQLFCCDDCFEEHFDDA@<72/031578<<;=;:840/,+))((&%&'(()),/e╛                                                                                3*,08BF<65:=>9655200п                                                                                                                                                                                                                                                                                  )*/ALLLB53562.0.-...-+&())*∙                                                                                                                ┘КQHHGEFGIJKJKORUWZ_`bbeggggghecaa_ZUX^fntoiqzА|si^SJDB?<::966532/+T─                                               ∙жQ=EMX\]c\ZXVUTROPLMLIDB=@ACEGEIGC?<98653457:;;>=:9510..+))*)''&%%&')*2m╧                                                                                  u)+,/6BK?55:<=<830/.1m                                                                                                                                                                                                                                                                                  @+.;KONE9226510.,,-,--)*))+┐                                                                                                            №│cIMOMNQPOLOSVWY]abdgjpsvxyy{{{zxvpnlhd\V\dimk{ОКxoaWLGCA><<=<755222/-+.lы                                         █xFHSX]]\[]ZYTUTRQOMIGDBAACDDEDFEB?;:97532668<>=@96541/+,++*)(''('&&());Бъ                                                                                    ╛**+*.5>GB738<=<:51011=                                                                                                                                                                                                                                                                                  l)-;HOQF<6565100.--..+(&())}                                                                                                         ┼{FHKMPSVVUVWVXZ[\`fklkpuwyyy|~~~}|yzupmllc_Z[_djlЩБgiК`MHFB?><>><:9953220//-,8Н                                    м]<;731..--*+)(('&&%&&')Iд¤                                                                                      ∙/-*++-3?NE769<<<9310000                                                                                                                                                                                                                                                                                  д*,8FMOE<52681//.----+'%%')H                                                                                                     ЁТOBDFGMOQV\`cdccgilnrvzzzwz|АБ|||А~yxxurnkfba_YWWX\dk|gTuжПaSJEB=96;=>=<;752220010/.,Fл                             ыГH>FPZ_a_[XURUSSSPKHB<>?>ACFHFCAA?==:64523459::>97430,*+*)*)*((%%&&&&&*c└                                                                                          ;/,()*,1BFHINSX\^djljlnruxy}}ББ}zz~Б~zywuurolfb`][ZXRNJGSСэ   ┴gЙШy[PFB<:;=>AA>;;865532575540.-hт                       ┤i6;BHPZcbb_ZXXVSTSRMIDC==?ADDEGGFB?=;;:7652467;<99741.-+*)))''(''%&%&&5tц                                                                                            R-/-+(*.2;NL<889;>;2000/1Ц                                                                                                                                                                                                                                                                                  ()0@JOLC8213320.--.12,(()()№                                                                                             тH?=BFECELOWbhlpruxy}АГИМГВБГВ~yupopojfdb`ZXWXSNJGDCCm▒         ╥СжжгКiRHEB>>@B@=:6533798888863.+4В°                ЇЩL9=FNSWZZ]ab]XWVTPLIEDDCEFDEEFFBCCA><:846579;>A9872//,,+++)))()('&'&''>ЭЄ                                                                                              Б+./,*(+.09LOA879:;:510.+.Z                                                                                                                                                                                                                                                                                  0+2>JPKD92035210.-/20,*('()╛                                                                                         √м^ABCDFGHKOPRTZ`gmsy~ГЖИЙЙККЗГА}{yvoigea^\YVUUSOLGA@?Xд°              ▐╣║╕ЩrTOIE?>AA<=8657;:89:;;=762-++>г           ╙v=;AEINUTXZ[\^a^XUSPNJHEDBCFJGGFFFB=@><<:86777;821/.,++*)**(&&%&&'((\░                                                                                                 ┼,/0.+*(*-0:JNB;789;:621//03                                                                                                                                                                                                                                                                                  X(.;HPOG92024320.,,02/(&&&'А                                                                                      └xBACFDFGGLOSVZ_afkqxzЖЙПНОМЙЖysnmmkfb^ZWUTRNHC?;87By╫                    ъ╨╬┐ЭscRHB>;877678:<<<:;;93551.-*(*W─    №еS7=GPRSTRRTSWYXWWZYUNIGEE>@CBDEEDEDDED@A<9998:B610/.,,,,+)((''''&%&&%&1o┘                                                                                                   ¤/11-))((),07DJE:6799960....-                                                                                                                                                                                                                                                                                  Л)-6ESOH:0.35220--.130,)''&I                                                                                  єЦSACDEGJNNOPSVZ^chnqtswz|БЖНОНЛЖВ}vogd_]\[WRPLHC?=:65g▓                          я╚└вr^PE@:84678;>>BA><;:5630/,+*---2wx@5:AGNVUWYYWXXW[ZVVTVUTLDDDFA??>@AACBACC@<=:9;:7851///-,*))('(''%&&&&&:Ою                                                                                                      =010-*(((*,/4>EG<5589::40--,-аЇ╬╬═¤                                                                                                                                                                                                                                                                            ╩(*2@RSL=6454-/1/--141+()+')                                                                               ╡i>CFFEHLNNQUZ^cfhjqw{{yuuuwxz}~{vpib_[[ZXUQLHD?<854Tв∙                               у│пЭАaLC:::9;<<<<<:98511/0//..0/38=@CJPRSUWUW]\[XVTWVSOMMJHFCBBA=?@A@BBD?;;<<=?:73.+**++++*)())''&&&%%&Sй                                                                                                         ]021/-*(''+,-2>;;:;:987644321101046:AHMQSTWWY\_[[Z\ZUTVZWSNJJGFC@>?@>A=>????;:::;=:62.+++*)))))'''''%&&-i╩                                                                                                           О/2540.,*(')*.29HLB858<::72//110000..02/-++4|                                                                                                                                                                                                                                                                     +,.9LSQF:310..///0141.*)'()╠                                                                      ўеV:>=CFGKNQTX^bcehlnorv|z|{}vnkhfa]WW[][ZVQNKIA:7327l╕                                           зЕРБoRE>:84/0//00332467:?FJPPRUVUY_`ab^\VTUTQRRTTOGBBAA?=;=<<:89::::99630.-.*'''(((%$$%%&''&4Въ                                                                                                             ╙+0132/.+*'&&(+.6FJB:7687951.,/113100011.,,+,)){                                                                                                                                                                                                                                                                   D(,8JOQH<5221/.000/22-)'())Ж                                                                   ├u<8=ADGJLNPSV\afjoqqrtvwwx{{xyvsof]ZVWWRQRQPMIDA<964]ж№                                                б{odF951.//0223554:BHMRVYYVWZZ]`bdb_[WRQOONNLIGE@>:;;979:9;77::89752/...,,)(('(&(&%%%$%Jв                                                                                                                 237520.,--*&'*-.5FOF<899::62/,-0311125310.-/0-*):                                                                                                                                                                                                                                                                  q*-5GQRK>3/340.000040+)))**P                                                               ёТP=<8;>EJPPQUZ]`cioprv}Бzyw{ywwvrrpkbYROOQMHCB@>:874JИы                                                      wB85212469::=DINSX[\ZZ\[\`a`a_^[VSVUQMJEDECB?=;9897459:;?78530.-.++*+*()&%%%%$&((+g╜                                                                                                                   A266210.---*(')+,5DKG?;:9:;61/--//-,/257431../0/-,-╦                                                                                                                                                                                                                                                                й*,5FPVNA6233//21/./.+)(*+*-                                                            ╖m:<<>ABEFKNRUW^cgkorssvw{}zupppmljge`[VOIGEA>;;974>w╩                                                            ]5468:<@DJRWSZZYY_a^`^_^]_]\ZURPSPMIFCA@?>;9764756986740/.--,++)*(((((&%&&&&5yх                                                                                                                     a145620/////,*)*+-4BOJB<;:<>92./-00...12223321/01/10-К                                                                                                                                                                                                                                                               ы(+2DMTOC71371//0..0-+)()*()                                                        ▐~F:<>>ACEGKPSW[bglrvwvxzywwwxwvogb\ZZ[\[ZXTNF>786643fо                                                                ·R8;EMQSVXYWU_cb``a^^][YXXWVUOIEFEB?:7431433547:7962//,+**+**)(%%&%&%%$#$AЭ№                                                                                                                       Т/123310-..-.,*(()+3>IKC:9:;<:620/10///00-013220-/./1/-V                                                                                                                                                                                                                                                               '*1@KTQF:5141010/./,+(&)*))╥                                                   ·лZ??==@BCEHKQTZ^afjnrx{~}zx}~wuplhfc[TSRSTWSOJD?9431KРя                                                                ╢n9<94343445996762/---,)('())')'%$$%&&&_о                                                                                                                          с*/243200/00/,-+*(),3;9:<;730.0102222//246563014422/?                                                                                                                                                                                                                                                              1+0:GRRH>756422220.-,)()*+)Л                                                ╩}B<=@CEEGINRSY]bemuutssvz}}~zwutoh_\[XWSOMLIHHFB=:8@w┘                                                                ЎХO=CHNUSQUY\\Y[^_`aacda^]XXXUROKFB@<7432565789=8760-++,,+,+*(&&'()''&%$%1oр                                                                                                                             2/23312//./00..+,)*.2:MRK@;88;<83//.0-./11001234665121322.<                                                                                                                                                                                                                                                             Y+.6GVULB:4553330.//,)'(*+)T                                            ЎЫR?A@AACFHILOTY_cgknqruuuuvwxvsrqnkf`ZTNLLKHDDBAAA>>p╣                                                                 └t<=DHNRTWWVVXZ\^\^`_`_\]`_\XUROLGC???:421/4479988740.-++*,,++++(&&&'''''=РЄ                                                                                                                               ?/54454410012/--+)()-08KQLC;98<;8301//.--022420357786312300.7·                                                                                                                                                                                                                                                           С*,5FRUQG<5352120.-/,*))+,*/                                         ║q>A@@BADGKMQW\`chklqyzyxuvtussnjd`ZVRPSRPKHB?=;;=:6Nбў                                                                ўЩVEMSVWUUZYXYXY\]\YYVXZY]]ZXZ[YTQJB=:831433236:77520-**(()'(&(((('('&&&&&Vк                                                                                                                                  d/13121011./010.-+*(),/7INMB8438;:4/0//.*+,/23123563686421.0103ё                                                                                                                                                                                                                                                          ╙)*0CRUSL=4775542//1-*)*++)*                                     фЕI<<=@DDECEGMQV\bgjnsvvyxxxvurqmhc]XVRPNMMMJFC?=:95C}ц                                                                 ╛u>BHPV][[ZWY]_^]_bb^][VWXY[]XTTVVRPHA;533.136766851/.-,+))(((&&&&&&%'%&&&&&Nх                                                                                                                                  е-02543210.,-/10/,+('(,06FMNF;568:;730./.)&(*-2232433467753354303                                                                                                                                                                                                                                                           )*0@QWWNB9:744441..,*(()++*┘                                ¤│f?>=<>@CHLLKRW[`dglquux{xyvtrrrmic\VPLIEFFECBBA=88=;;;:8Yи·                                                                 ┴u<@JRYa^a^\\][__a`abaa__][XYVRQPNKHFB>9774989;:8:9740-,-+*****+)((((((+))++++*')))''''0К                                                                                                                             7035321410/---/0/.-,**)+/1?JQK>89;;;:4.-.,)&%$'*/46536779;:98679:62=                                                                                                                                                                                                                                                         G),5MXXQA62444220.0/,**()++Z                         єЯS<<:9=?AFIJLQW[_aeintttvxБ~zuspkheb[TNLHFDA?>:7764GЗь                                                                 ∙вTAGNU[[[]][]]_`bchfdfijfe^\XVSNJFBA=94372367789863///--+**)(('()(((('),-/0..---031.+((()'&%&`є                                                                                                                         K.1430110/..+,*,,+.,+,+)),.=LSM?9:;;<:5/+-.+'%#$&)-47787348:;;:779974F                                                                                                                                                                                                                                                        u)+4KTXSE6544332300/,)(')++2                      ╣u=<<=;;@FMU\Z^_aa__`_bdfhjmljjkjh`XURNKEB>:6520367888967510/.,+**((((&'()(')+,/244522.-02362,+***)('()*D┐                                                                                                                      m.2365221.---,**+-//-*+))),1>A<98:=:0f                                                                                                                                                                                                                                                       ░*,3GUYUJ;3544321-02.)('(++*                  шВG:@AABCHOQTY`dgjpwwwusssuvvwrplf]VPOMKHEBA?>:96^и№                                                                 ЄСVGJMT[_]\\[]]_abehghkorpsifc^YRMKJGC>82524657>:=:53/-.,--,*)())))*))*-14448>>><;;:96442033211-++*****)*4С                                                                                                                   м.24554110.-+,,***-//,,,+))-3:HQOC:9:9::72//0-(%""%&))+27::989=@A>;9;=C91У                                                                                                                                                                                                                                                      Ё**/BQYYO@8645211/11-+)(),++с             ·к]9;<;=?AAAFJLPRUYaekpuuxxwxurrnnoomie^WPJHEC@?=;98LФэ                                                                  ╢m;;:?@90ф                                                                                                                                                                                                                                                      )*-?MVYPA8566310,..-+*(&+++Ш          ╩u=799;>BDDFLOPRUZ_eintuvyvywvttsoqnheb_ZWOIEA?=:86?v╩                                                                  шГJAFLPUX[_[Z_`a``ccgiklllnkfb[XWTOJEA<:7300547:66630/,.-,++*)&'&(&('&()),7_OCBDDFRHDDEDAACGA;:99744310.0///-+)**+('&G╩                                                                                                             ;0365321/----,+*,,+*+,+++*)(*.5DOMA74579:830./-)%#"$%%%&+189999;=CGD=;DHFA><<::9740/233330.,*+++)((&1Р                                                                                                          L/356320-.,,,++*+++++,,+-,,,**-3>OQC7537:<830+./+%#"#$%%%&.48;<;<62/00,&#"#$%%%&)/4;@A@>CJKJF=;>B>80┤                                                                                                                                                                                                                                                    У*/7ETYSH=66544520/.,,***.02uC579:99:;=BEJOSX]`chputxwuusnmomljc]^^YTOLHEA@?>>IА▐                                                                  °жW9<@FLSS```ab`a_bceijlnmnokfb_[XSPLIGB=9413135579843/.--,**++)(()(&&$%%$$$1l▄   яc,.27FUfwБkYROOSVRPH?;<:<=><;9675444464320/-++)(*))*I╦                                                                                                   ▒-.123200.-,+,--./,++**+,+,+*)**-2;KTK?979=>;51001-&""$$%%%%(,0:BBB@CFIIGB?73                                                                                                                                                                                                                                                    ╙*.4CSXTK?976422010...+&',03668<>??@EKQWY[_flpvwwvvyutrqpidba_^ZRKIGE?<>;;>q║                                                                   ╠s>9BIR]bcb^[^^acegifgikmmspjc]WURNIEB<71114544559853/,.+++*+)('))'%$&&%$#$#OЭ¤         И1/27==??;88556566654540-+)))))('4Ь                                                                                                °/.000141/-,+-,,,,,,***)(***')***+2:JTNC:89<=<6--./-(#""##$%%&*,6?BB>ACEGHE@?@B@;4[                                                                                                                                                                                                                                                    *-2?PXVNB76764531/,,-,(',2789=ADGINRUW]agnsw|zyxtqrrnke]XYZVRLE?=<<<;9Wв∙                                                                  ЇУI48=ENV]ba`bcbcbcfikkkihijie`[XUSPNKIC;62.103776624320/,+***)(((%&'''&&&%%4qф               ▒<.4?K]rwxmZNMKNSQLHF@?@@@A<<:988899876761.,*))(('(()p¤                                                                                             9/11/001/.,**,-,++,+,+*+)(*))(()),39ITQE=::<=<91-041)##%##$$%&'*19AED@BCFJKE>>AB=91█                                                                                                                                                                                                                                                   +)/:86FВш                                                                   ╡j65;BIS[cd_`aacfjikknmnokle`]]ZXSPMJIEA;402556646542/-...,+*((('%$''&''&&&&Zи                     ┌T4:?BDO_nv{eKKQONUROIA<<;;<>==;::785464321.-+)))((()Q╠                                                                                          Q/210/010/..*(),,+*,*+*+,,+,+******08GSSG:9;=>>93/041*$$$$##%$&()-5=FIFDEGIKIA<<@A=7C                                                                                                                                                                                                                                                   L+.8MXYTG9688425310.,*)),5?JSUUXY]ckrvwyyuqnlllifaYQNMKGCA@@>:>r╜                                                                   эЙH58=;;89776652.,++++))*)5Ю                                                                                       Б+/11/-.0/--,+*++,,+-++,,-+++)*+*))*07CNPI@<:>@>:30164,%$$###%%&)+-1:EGFFGIJLHE@>=@B=0б                                                                                                                                                                                                                                                  |,.5HVWSI8444236541/+)&(+5FX]ahkqqqqussomihea^\ZVMEA>>><:76[и√                                                                   ░g69=AHQW\]Y^a`ceeikkonnonolic]XRMNPOLG>4323326869840-+,++*)*)**('&&%%$$$%%(_н                                 Н4,.4;CYsЕНВZOQRQSSKGD?>=<<;<=<8778867872100/-+*(*('+s¤                                                                                   ─+,.0/,++-++)(*))()***+++++)+,,**)(&'-4APTK>96;@A;3//34-%"#"!"$$%'+,/6@EFBBEIIGFA=:;BC56                                                                                                                                                                                                                                                  ║-+1BRSRI8567444220.,*)*-6Jalprrsqpnmklmjc\XSOLHFB@<876GВь                                                                   уz>468??C@<966:::::9746620,***('&')O╪                                                                                №*+/100.-+,+,*++)()+,**,+,++++,++*))')-4@KQN@99:::==<<:761698752-,)'''(((8Э                                                                              9*,/110.,+,++*++)*+++++**)*+++*+++*+)(,4?LTP?::CGOWY]__]^`chknoorqokfb[TTTQPQOKHD@94534655746510.-.-*))((&'())'&''''BЦя                                                  Й7368>O`uЙГdPOKRZZUPJDBA?=?=>===98788778631.+))()*((+z                                                                           W,....//--,,,+**)++,+,,,+*+--+*+++))))(*1A?50/120+(%$##$$%&),.039FIGEEEFGFFB??EC<4б                                                                                                                                                                                                                                              щУS:12=LVUN@6477544420-+)))0>MU[[YVRPLHDB@><;8NЦЄ                                                                   ЇЯO799;>B>5/-.01-*&$#"!$$&(+/025=FHFCBDEHHD??EEB79                                                                                                                                                                                                                                          ёЪO48<<:32:HSXQ?:776554431/++*+/7ESTTRMKHFC@;7Ay╩                                                                    ╗l726:@FLRWYZ^`acdhnprsuuqrpe^YUVTQRPJLID@;6844788958431/.,+++*))(('&&&$%%&'JЭє                                                             ╒Q.0;FSdu}ИmYTWXWVRSPE>;89<><<93455797971-*(('))))(')9░                                                                    ╠.0/..-++*++)))**)(*+++++,,,,+,+,+,+*)*+((,8FTYK?;;<>>6/--/1/,*'%$$%%&',/0136?9665676852.,**)-+*))()((+y                                                                  3011.+++++++))))**)*+***+++,+,,-,++*))()'(+6DPVPB99;<<7.,-02/)),)%%%%&'+/10.36AKKBDEGKKE<:@D=47                                                                                                                                                                                                                                  ░m667:<<NVSF=9665588741.+)),06AAC?8945346757321-,+**+*++)*'''&'%&%&Sб°                                                                         еB22:BP_gjhXHILQVYPRKC?@>=:::<;;987420/-+++*))(((()')Xх                                                              @//0..,,+,,--+)*)+++*++++*+*--+++++*+++)*(&*4AO[QD=<<<=6.,,./-)())'&%%%'+.011/3;DHDBAEJKF@>>??:1╣                                                                                                                                                                                                                             ╗t=8;;<=>BGIMRW[`aaTF=?HRRG?877416762-.+)(+-02E|▄                                                                   ўдV159=BGLOTWY]bforyЗЧЧХЙГБzri`\[ZZXXVQMKF@<75338:886552//.,,+)('((((''&$%%&&4r▐                                                                               ╚G+.19DM[zvtfVLKHMUVPJC<:9;?A>:9668851-)()'(()(('&'%'5н                                                           _-00-+,,+**++++**)))))*+*'()()++*)*,*)**()(&)2=JVRF;88996,+,-0.'&&()'&#$%(,/28217@EE??AFIFB>=A@;6I                                                                                                                                                                                                                         ═|C8:;:9>?DHLQUVY^dhmpnmS<9HVUJA867658751./-((*,.Б                                                                   пl7469;@GMSY]^`cflrАОШЫЬЯаСГxsnf^YTSUTPLIE@;7856679:896411/--+))(('''(('&&&%%Uи                                                                                     ∙b/4:@GTbo{t\LJHNSSPPG=<=?A@<;9:9971.++**()))++))()()/Е                                                        Р,.//.+*+*++++,+,+)(()()**()**)*,+**+++****(&'/==<:64-----,))*+++,,)++)())Yц                                                    т,..//.-+,++**+*)**)''((*-,**+.++,,+*+*))*++)&&-=MTUMD>=><90.-.0.*&')-/*&$$&),264005;GGA?DGHFC;<<>;1}                                                                                                                                                                                                                ЄдQ8999:;<>EJPTVXX]bgntwzxwwtrmjU=7BSUTI<7765874121.*)*-,9                                                           чG3679831/..-,++++./23/,+*())**@╕                                                  410//.-+++***))**,***)))*++++,,*++++)*+*('*,)&&-:GSSOE?=?@:3/./01,'&&',.'$%$',2563228DC@@EGGHC::;<931                                                                                                                                                                                                            ∙▒d67789;<7442677310-*)*++*                                                       ▄~G0369?CGKPTX\biqwzБСвм╢кикЬЛД{se][Z\[ZUQLH@<<:7967;999743/.----.,*)('&&&%%$&9Гъ                                                                                                      ┘R.//4:761..-,-++,.049<72.+**)))(-Г                                               C.11.,-,***,+*)(***((((*++,*()*+*+++,+))((''*(&&,5@QUQG@@A?=3/-/00.*&%&(+*%$$&*/340./2?DB>==>CB;349:6,с                                                                                                                                                                                                        ╣r:7898:9<>DINPTWZ_chkpv~ВЖЖГwplea]XTPK:5=KSUOA9876788643/+****)ъ                                                  ╧{C0157;?DKPSUX\`bfovГПЬй╖╜┐│ЯСЙВztj^WTRTWUQKB;=8:9:::7:8765410-,++++-*'&&'%%&(`┤                                                                                                             z.,1;8743110//.0137<<<852-+*)()''&_у                                           e-031--,,*)*++)))*+***+**++**)*++**)****())*)))%(-4>OTQKDA?>;50.022.,)%%&+*%$%&*.263,,08?D?;<>CA>84588.q                                                                                                                                                                                                    ╚zD4688:;=ACGJQW[]`cemu|БЕЖЗДДГВ}tlfaZSNMJKI;5;JVWSD:7658998651.,+,+(з                                              ╗t>236:>BFLSW[^cfjmuАМЩи┤╗╡▓│гТЗ|vurmfb\WQNMMG@<<;<::><;:744200/.,-+)())(*)'%%%=Пю                                                                                                                  Ю:2789=EXysk_PIMINRQMIC=:87645447666:;;988862/+))('&'?╛                                        Ь)./2/--,,*)))((((*+*+++++,+)**,,+++*))*+))(((+,*)+3>L[UKC<:<:5/0484/,+(&&(*&%$%&,2451./4@=7423412                                                                                                                                                                                                чГK8;:8789==BGKNRYacdgntx{АВГЕДЖГБ~{qjaXRKGCAA@<869GSZUG;76799;:642/-+)))i                                          ╖p<468<=BEJOTZ`dhmpu}ЖФд▒╣║╗╗╢гХЖzsnf_\__][UMHC?>;;<=>=9;986311..,-,,,,)&&'('('-d┬                                                                                                                        ═O125:AP`fidYOKGMSUSNE@=<<==;;;;:99;=:999:630.,*+)))*4Ж                                     ш*,/10.--+,**))*+*))***))+++,+*++-+,*++*+*)*(()+,+**/9HOUPD=<@<5347982.,*('%(*&%%'+/220/./8A=988<=@931584-э                                                                                                                                                                                           їЯR69;;;=<<<>BGNUZ\_djqw{~ГЖЗЖЗЗЙЗГЖ~vmcXOGD?=<;9778757COWUI=7579:97553/.-++)=                                     Ў░j826;@FJMPQUY]bip|ГПЬн╔┐╜╝┬┐┬▓ЬЦОqeb][XWWVSMG@:7563648<=944//.../,****)))&%&&&@ЪЄ                                                                                                                             °c,-/26;KjИКЛbOHFDHMOQNLHC<>>==<<;:766687784/-+((())((cє                                  2+,/0.-+,++**)))**)))*)()*)(*))+-,**')+,,**(((()+('(-5DNTSJ>8<>778N\WKA8579:98998/.,+-,&                                 ▌ПP/368:<78<@B@65552*%&('&%%&).///--0:;95469<9413451M                                                                                                                                                                                    ╥yB677879<>BFKRUWZ]`bfqxАГЗМУЧЫЦУСИЖБ{vqkd\UNFA>>;742/GМыЖ5:>=;9:699899764221/.,,+**))))(''&'JЮ∙                                                                                                                                         ▒=046:?FWmqkbQDHFFJLNYQKKLJEDB>=;<:8755521/,+*))((())3П                            g*.000..,+,,+()'(++,,++,('(&)))**))*++++,,+))))*)(&''(*.=BRTPJFFIFEGIH?20CF;/(&&''&&'(,--//..7:96469:8420131-                                                                                                                                                                                ЁЧL765789;;=@FIORX_effhnryВИНТЩЭХШЦТЛАyogc_YTNIC@>;:85@{▌    ┬3JRC:JYXTK?7;==>=:69;61./.+╛ в]/1@PLDAiбщ          рУU579<>ADGJQX_ekoquzБЛХо┴╟┬─╟┼┼╞╔╣йЭЙЕytngb^WTRNLIC=:88899=987641....,-**)''((('&3n╫                                                                                                                                               ъ]0149=L\dedZOJCDKRTVRPOLHGEB@?>?<97651.--,,,*()'())))aє                        й(,./10.,,,++**)))***++,-+*****))*++**))+-+,*'')))(())**.;AQRSQMLOPPPPK@4-@_bB+(&''&&()*,,,,..5797447<:5200240т                                                                                                                                                                           №нc75689:99;87Cv├        т2Ut:GZYUND=<==>@=99:310//,1))-7B\wteXOKIEJw╖√ ╗zH===AFIMQSV[`chnuИПЯ░╚╨╤╓╪┘╫╠═╦╝лЪДqfbflheaa]XWNHC=;;9;:99:9741/.--,+***()'(('''&Sб                                                                                                                                                      x.,-5:=EZХНВkPBCBGNPSSOLIEDCCA?<8640.-,*,,+***())))*)I═                     я(+/10.-,-.+++,+)(*,-*,+++*+*+,.**)+++)(%')+*)(''(&''())+.8?GNRSTTX]d_UM@7-?dxZ0)&''&&'))++++,,05630149;83/042-Ч                                                                                                                                                                        ╛p>69=:659;<>BGKQXXX^bgpxГМУЩЭз╝╗╗мЫМВxpg`ZUQMJFB=997?ADD?;>@;31330-,,4HaЭ╞└йР|jbYQIEB@CEHLOQRVYZ_adejnwВПЮ▒─╪уруфхщчц╩╡иХЗznc_``_YTRNKGC>>::;;;;;::7630--,++))()((''('5r▀                                                                                                                                                           Ь8.16@DHKLOUZ`cehou|ЗФе┤┤┤▒йвХЗБyrke_XQKHEA>?<97hк¤                .Rvk=CV_]WPKFFGJJJLSZZVPKA;98DGUtОЖ~cMEHHMPPQONJHIFDDB>9898631100,-/.,(***)((nЄ               K,..011.,+*)()**)*+*+**,+****++*())**++*)(*+++)(()(&)+*''*,29=ADINVbzЖoTC9/,3CUS7+&%'))'''*+))**-15852059940.,013                                                                                                                                                                ЎеV54468:<<;CCGKNSWYZ^adipzДНФШЭлйиЫНВ|vpjbZRMIEBA><86Yбў                    +?ME>?R\a_]ZTQQTVXaАбХАm`O=?EKSeТ═°ш╪╨═╟╟╞жЖwrmkhiikosy~КЦж╕┐╛└╔╚╧╧╨╥╬┐кШМДypnnlkffc]WRQNG?>;::99<:;;8420/..,*++)))(&&&&<Ах                                                                                                                                                                      ўg26:=BRqЙВzeOEHKNPRRQLJKIGGEB===<:99;88655310..+*)*)*G╦            r*,.0262.++,*')++***+****+*)*++*))+)***+))*+,,,++**)))++)(),27;=@CGS_ГwbK;4.)-7=;8*&%&'&&'))+**-+-05753236760,-21/                                                                                                                                                             ╢j2036779:;>BEIMRV[bffdjpxАЗИЛКРТРМИВ{toibYPMID=;8763NФы                        -3GM;@:9653/..,,,++*)((&&&&)_н                                                                                                                                                                             Ж4-.07?E[ИУИx`LOJGILMQNJIIIFGDC@?>=<:988877651,**)*)(4Э         ▒+-/0111.-+)+*'*++,*(**+****(()**)()*)))*')****,-+))(')+*(()+/279::?M[[UN@2/+')/695)%$$%%&'(('')+,,.3552114652-+/1/э                                                                                                                                                        ╓u?554367899;>CGLQUY]adglouz}ЖИДГГВА|zzyqiaZSKDA<;743Ey▄                            ;-16;:58::>?:8410.-+*+*+*)'%&&&=Кщ                                                                                                                                                                                  ╝B-5<<;;<;:;840-++*)'')*o№     Є--01121//,,+,*')*+,+*++,,++**)***)*))***+*)*+,++--++**++))()-116768=DMUPC72,)&')+03)&%&&&'))'&')+--/351..-16720,.0/о                                                                                                                                                    ЎЦQ3347::89=AADIQT[^_aeikmt{|{Б~~~~{vqpnjgd]VRLHC@<:7Cu╚                                O,/7;=WuГ╕└╚╗ОБ|tqtДМйХjLCCJbptzЗ╖╢┤┬╬╬╟╔╥╘╒╪█╤╔╢│нзввбЮЬЫЬЮЭЬЫЧУМГzohb`\WPLJJJHGGGIFDB?;<8530/.+,,+**+,*()(&+b┤                                                                                                                                                                                        щ`78::>GWxзлж|R@CGHJKNOLIKLKHEDDBBAA@=99964212.+*('(''P╦   5*.1441/./.,+++)***)*)+,,,+*'()*,+*+))****,*+,-..0/-,**,/--**,..44469@FMIA91,(')**,/*&%%%''))'''*-0..055/+,1763/,.21                                                                                                                                                 ╢m98::998:>>??EMSUZ]acehmrux{АБ|zzxvsqlif`ZVQOID?=<;@t╕                                    d)-5BQaqБб┐─оscYTSX]yo_VJACHYq~~ДСЧи║┴╛╗▌▀ў°√Єь╓╛пйгЫКЗАВДЗЗИЗГ{tojgb^YXVPMHEA<;>=BCABA>9740/---+++))())*)BЦю                                                                                                                                                                                              В5239CS|йвПwZFHGHKNQQKKMNLJHFCDDCA><97544520.-,)))**(5ЮL*,0442/-,,-+++++*****,,+,,++*)+,,+*))(***,--./112442/./00-,*)+0177557;@JGA91,)((')+/)%$$%&')))''),---0120-*/683/-.00X                                                                                                                                             ЁИH5579;>==;>CHMSV\_aefhou{БАИА}|ywsomjf_XQLEB@>=:5dй                                        }&+2DZ]^dhgafZNHECEHPSXI;<9<;;?AAC?:630-,-+*)(*))'''%0h┬                                                                                                                                                                                                    Ю9-/5>KSawИИЛjMGHEEGIRRPMJGHLIDBA>;841.2001/-+*)*('(*+,06631.+++,+)*+*())(*,,+*()++***+++))(())+-./268:<;6346661,*'(,15652269GNF:1+'&%&&'*'%"#%&'))''')*+,,-//.+*,252/,.10@                                                                                                                                          ░h55668::;ABCDINRVZ^^cglqu}ЕЕЕЖДВА}ytrnjfa\UOJFC?=97[е°                                           Ы%(0DX[^adfadPH@=>?EHQMD86:>IWk}КДЖд╠чхщ ■     є╕жШИxji]]^^ab`\WRNKGE@=:87269;<=>=;9630.-,,*(())(('FЬЄ                                                                                                                                                                                                         ╪P.6?DHSnКОЦwUFCBDGMPPLJJJKJHFBA=:731032121/..-,*),/247632/+,,-,++*))*)+*+,*)(+,,,+++++*++,++-0049<=>CC>979;81.*)*,03532235EHD;0+'%%%%&(&###$%&'))((()+---/.-+),241/./0/-                                                                                                                                      ьБG89:;:98;74:8:>>;9;>;64330,,,+++)'&'(0n╤                                                                                                                                                                                                                v79;;8778411101310..18@@=962.,,--,+*))***++,,+**,,+*)****)+,,+,16FC91*&%%%$$&%$###$%%')('&'(*(*...++,031.,.//.                                                                                                                                   к^6:?<>=>@>>AEJPU^cfhlnryБМЦУЩЫФОКДАysnic\VQKD@><;:JД▌                                                   ▐&)/?OTZaeghd^TKE=;9886:G^zЙНЙhKHGJMMOTQOOOKGDB>=<;974322235412:AEGC<840/.--,,,*)++,,,+-+()*+*+*,-+**,+++.28DJRSLHIJD?;::882-+,.-011112289961)'&$%%%'%%$$$%&'(((('&')(*--.+*,121/----,¤                                                                                                                              р{E699:=A@CDGJMOQU\ciqw{ЗСан╡╡│ХУНЕ{wtsjaYTLG@;5257o╝                                                       ў'*/9IPQ\eghf_WKB<;?EPURG9524?UБ┬у           ёЪux{tlgb^QKGD?9342579>CBEA;72.//.-+++**()&3t▀                                                                                                                                                                                                                           ╦J-/37@KXtЮЫЩuXOMHIKMPQMIFDBABA=;645431457BPX_ebN?85510.-++)))*,-+*+))()*)(')++)')()-059Ifqk\IID;9989762.+++*,,,.//-35871(%#"##"$$$##$%&%'&'''&%&')*+,*((+./.--..*ы                                                                                                                          √дU468::;=?CFIJOQV]begms|ИЦж╖┐├└┤еЪНЕ}xrplh_WOID@;75dз■                                                           )+.4GNP[behb]RHA;:>BMY\P=7.2:Nsж╧         ∙╨Щmgmjhd`[RHA:53-/15:=?B@C?:71.-,-+)*))((Sи                                                                                                                                                                                                                                  o+.4>KTkЙЙВs]NICFHMNPIGGGHGGD@=9875569?KWbtДqXJ@8511.,*++***,--,-,*))+)))**++)**,.15BPexxaKF?:7777661-*+*+--.../-/286-(&#"""#$$$$#$%&%&''''&&'()*+-*))*,..+),-+╙                                                                                                                       ╩u<59;:<>@BBHNU\`ejnorx{ИХл╣║┐└┴╡дУЗЕГ{rid^YTNFD?=>;84010-+*+,+)(7yх                                                                                                                                                                                                                                       Т96?@=CHUpИИГ`IDFGGGJONLKJJFCA><:9;;CNYlл╢│[]bkI;6/++*+,+,,,,--+)&)*+,,+**+*++/6Ca`cgkbKG>5212322/,+**+-//-,,*+,,,*(&##"$###$$#$%%&&'(&%&''&')++)(')-..+),,+╖                                                                                                                   ЄЮN4689;>ADEEGHPV`iqswxyЙФк╕╣║╜┐╣иЦОЖysle^TOIDA<HOVYUPRKF@<:;AGNcojdWMIGQcusВСбййзЪНЖ|shc[KJHHEBEB@ADDC@E?=:6211/-,*()**^░                                                                                                                                                                                                                                             ╬Q6559=J_ruxdNCCBIIMOOLLMKGECA??BBENXiУ┤╢ДkpЖpZI?82-,,+++,--.-,+*)++,----+,+,0=NZihd^WND<6111213/,++,,--.-+,,++-,*(%#$$$###$$$%&&&&&''&%&)))*++*((+./.+'),,Я                                                                                                                ╜q<79::;>=ABGMPUY]airzАБРв│╛╝╗╗╕┤оЮУКБ{sle`[UOG@;9H}═                                                                       >++0:ENTWUSUNKE<96.++.-,.-*((**+)*++,,*)**('##"#$$#$#""#%&$%%&('&&(()*+,))'*.1-)'(*)Х                                                                                                            яФK6889:;>@BDFIPX^bcfkqwВОЯ░┬╗╚╟╩┬╡гЪУЛwohaYSNHB<=n░                                                                           Q*+/9CIRYWSPMKFB?@EPYiМ║┐иСv\TY_]QNJFC@BGJLTTMLEGIIKMKKKKHB<84/-**()++a╡                                                                                                                                                                                                                                                         Р5-15=DQbsЕfKFDCFFHJKLLLLJHJJMSZjКГqlМ╜в{hXH;,/-,++)),-,,,,-----,-,++,.2=HIJ=778850,('))+.+''*+,.,+,,,,+**)(&$!"$$"#$$#"#%%&&'&''&(++,,++*'(*,.-)'')*Х                                                                                                         ┬l8789;=>=@AEMUZ_dlrvwy{ЙЩн╛└─┬┴╛▒ЮТНДВАzriaZOFA@?eп■                                                                              m+.1:AFPY]WNLLJEAAFO_}▓╞╥╩╟м|[PPQPLIGFFDHSWWUPPLPNKIIKE@<741/.+*((>ЛЁ                                                                                                                                                                                                                                                              ╛D/4669CQgНЪД_GDACGJNONLNPPPPT[a^\bo|Е|}jSE<7320/../.,-+++..--..,***,169:5100/-,+(&&()**)'&)*++,+*(*+**)'&%" $$"!####$$%&%'))'''(+)+,,*)'''+-,('&'*|                                                                                                      ░[678;>>@CDDGIPY`gmrv|БЗОЧн║╜┐╜└║мЬУЙДА|wqkd\RJFBUЫё                                                                                  Й-/3;CHPVZYPHJLHCAEO`Р└╚█╘╦╖ДeKDGGGHJMNNQSTSRQPONMLHFA<962/.,+0g╜                                                                                                                                                                                                                                                                    Ўg0226=G`}ЛЧЙcBA@DGHJLNPQSRRSWYYVZdlnnlg]K?:6542100..//-+-.-,,-,+**,/4852..,++)'&%&(**))())**-,*+*+*))'&&%##""""$##"##%'&((&')(),*+,,,(&''*,.)('''y                                                                                                   зM8:;<=ACEEGJPV_ckqt~ЖЙЦв╢┴╜╛┐╗╡мЮУМЖА{uoiebYMHDNГ▄                                                                                      б.07?EGLSXUPKKLLICDNbЖ┼╠▌╩┤Рy`HCDCBFLQQPPRQPNMONNLGC?:50-+)EЦє                                                                                                                                                                                                                                                                          И3--05>AG[yГ~s[HEBCHMPSQPPONNOPKJJKOQPOKJFC=;98655431/.,--./-,++,*)()'&&')**++))()*))*++*(''(**'$##$"#! !##!!""$%&&&&&&)''&&)())'&&'((((('%У         ╒;765559=>;8`√                                                                  ╞p;?=@BCEIKOSW^glux~АБДИРз┐┐╛└──╡дЮЪСЗ~ytohaWONWИ╫                                                                                                кIXlzncTOLHDJJJOMGBAHMW_fltziUHDBEHIGD?;97;<>A>;9Bw╓                                                                                                                                                                                                                                                                                            М;544:?QequrZB@ADHKMQQQQNOPSOKKLNQSPONLKGCA?=:7866641/0//..-,,,*+*)&&)*+++))*******++*)''&)'%###$$$"!#$# "#$$%&))()''()(''))'&&(*))(('(&Ь        М976678:@CC>853/369;<94]                                                                                                                                                                                                                                                                                                 │?../16:FZmmlYIBEFGKMMNOOQRPQSQOOKJNPPQLJFCA>=@ED=632100.,-,,*+,,)()++++*')(()'('())(&%$%%$" !"#$###$#! !"$$$&))('(&&'(('%$%#%')(&'))&┤       е9867779;?HC<62/0A                                                          ═h;<<>?ADFJNSZbiosw{ДМШо└╚═╠╠╩└┤зЪОВysmie^TMK]Хє                                                                                                       ZdcUIC=HSWYXVSMIC?;<@DIJE@GMIC?<9;@<74301146662\                                                                                                                                                                                                                                                                                                    чY,.1577455511.-,,-,+**+,,,+*)))))**++*(&%%$%##"##$$##$%$"!"#$%&'()*()''''''&&&%&())''()'╔      ├::=;:998ABDEINSY_dioty~ДЙРЮ▒┬├┬╦╚╞╖еЭХОЖ~vnd]XUQSВ╟                                                                                                           b@=;:78DR\`_a[TJ@:98;DHJIFEGB>=<76777886677874\                                                                                                                                                                                                                                                                                                        ~40587;>DMU`iPGCCAEJMQQPTUSRTSQRRSXZXRLHGM[\TIA=BFE=9942/./.--,,--,+**()++*****'$%$##"""#$%%%%%$!"!"###$&&&%$%&&&'''''%%'((('''''ў      99:<=;:9;><:741////-0ё                                                 є}C?BCDGHIIOV^elrtxz~ВЙУЮ╕┬├┼─├╢мЫРЙВ|wpkbXPMl╖                                                                                                                ╪E5534AR\]]aa\NB=887=CGKOEB>=;86547989:;<;97V                                                                                                                                                                                                                                                                                                           ▒@2/024;HZZZNFCA@EHLOPQUTTTSTTUZ_`\XPMRX]c^PFFCFKLKI?73100/00//-*()))'())(*)*(%%$$#""$#$$&'&%$#$#$#%%%'&&&%&&&&()((&&&')))()(&'      Q77:<<:9::;87520//-.-,2                                              °ИE@ADFEGJOU]dkoqstzГЙФв▒├┬┴┼╩┬╕йШРЗАxsld\TP^Сё                                                                                                                     а4-0=GOU^fecRG@:68=BFHKF<86545788O                                                                                                                                                                                                                                                                                                              ┘U*,-/27:DLNQSHBDAAEHORRTVX\afigd]WXcrp_YRLKKMb~{mA52//220.,)(())((''&&('(&$#! !#$&(+,,*'$$##""$$#$&%$$$%&&%&&'&%%&''(('&&&(     ┐57:<==<:;978630//0/...-2uў                                         ЭO?>?CFIMQUYbhmrtvyy}ЖСе╗┐╞╦╠┬╣░зЪРГzqjd`ZPm┬                                                                                                                          Б+.9FOT_cfeWI@996;?CLOI950//147>EHIHGE@<=AFLQN<61-,/49AGIKJK?T                                                                                                                                                                                                                                                                                                                     Я<--02369@FAQRKGDBGIQ\jxУД{pd][\^^\YX[WRNPqЦДdE<8774210-+*)((&&(&&&'(&$$$$""#$%&'))'$##"#"!""$$&'&&%%$%&''''$%&'*+)&&'&_    э357:;==;9889866654332356432102v∙            │s╢               Ёz=?==DJLMQYbjstvxwu{АЗРг┐╛─├├▓бЦКД{ywribZRЗ┌                                                                                                                                 +,2@GO^afaTIE@A>BEIQ[S@90,,.29BHIHF?L                                                                                                                                                                                                                                                                                                                        ┘Q,-.025:>EKJCDDDHNTeБЗН~sg`ZYXUSQT`ZRNO]vВVC=95310/.++**(('''''&)'$$#%$""#$%%&('%#$$#"""###$'&%%%&$%$&''(%%&&((''&&%Ь    }3657;<;;9:9:967777656678763447;Ce╓        ┼ЩМydeы           ЯL<;==>BGOU\fnu{wwx|БЛУж╗┼┴┬┼╖жУЗxqjd^YSQЕх                                                                                                                                    -,/;DJZ^_YRNLKJFHKMQZZH=1+++06@DED=K                                                                                                                                                                                                                                                                                                                            x/**,+.37=?DOKHILTevzxqg`[VRMKKHHHEBDLTTG@;71//-,***('%%%&&%&%%$$#"$$" "#$%%&&$$"#!""!!"#$&%$$$%#""%%&&%&%%'&&%&%%э    82579;;9:;::888787889::::99859ALWbcSНчры┼│cАСМ}jW;q       ╨a:<<;=?ADGNT^hpuyxuy}ЗЪн└═┴╝╗░зШМ}rga[RKLГх                                                                                                                                       R-/8AIV[[UONQSMGJNOU_aPC4+)(,2<@>9H                                                                                                                                                                                                                                                                                                                               ░A)*-/25;AHMGBDO]fqolga[VQLIGECFCBBCHJ@:74221-*)*)((&&&%%%&%%$$##%$###$&'&%%$$""""! !""$&$$#%%$#$&'&'%$&'&&&&'&%    Ї02346899:::978::::99;=@DGFA>==DP^glcZY_inleyДДziW915╗  ■Г?::9;;@BEJOSY^lqruwyЕСд║┬├├┐обЦПЗ{pbWOJNГї                                                                                                                                          Т,.8BISYVKJPTSNJNQQWbfUI8.*()0893<                                                                                                                                                                                                                                                                                                                                  хc*-//0017<@BFLNV]`_^ZUPJHGFCDB?;;=@9524760-*(''''&%&%$$%%$%$#"#"#%%&('&%$"!!!""! "#$%%$#$$&%$%%&&&$%''&$&&&&F    в/013557789:87;<<<<;<=>DJLGDA?BGR_mqpeV[jpmlt{xqeJ4233YL77767=>DHOTZ_bcgprux~Ре║┴┴┐╡жУКБzslaWMQО√                                                                                                                                             ▄,.8CIOPOJKOSTOHLRTXfd[J;0)'*110<                                                                                                                                                                                                                                                                                                                                      Т5-,.-07=AACGKNTVUSSQMHEB?@>:779<631662-+)('))*''&&&&%%%%$####%%&&%$$$#! !"!""#$%&%#$$$%$%&&&&%%&((&%&&&Х    n-..0/13577778;=>>>@ACBHQXRD@=?==>@B?GV[PDA=<>GWmspqturolged_O=967;=;:@DINS[dinpsutrtuГФи└╦├╜пЯУИ}reZOIJЧ                                                                                                                                                    8.6=DDGEDCGLNK?FU\XSUVF7.-*,*+═                                                                                                                                                                                                                                                                                                                                           №m*),07<=ABABCFJMKHD?;86455202100.,***(&%%%&$%%%%&$##""""###%%$$#"!  !!!"$%%%$###$%&%$$$%%%&&&&&%%,     l,+,-//0111447:=>=;=DHFINPLAA;8:ALbpqsw|}trh`YOC9567;=AIS]flquuutsty}ДИЭ┤╛└┴пЩРД~tk_RNJ^╨                                                                                                                                                      x06@KMHHEDEGIHACHGBJUNB720//,,м                                                                                                                                                                                                                                                                                                                                              Ы8*,15;FORRIAEGINJ@986455681.-++)((%#$%&&$$%$#$##"!"!"""""#""""!! "$$##%$##$$$%$#$$$$%&&&%%%$m     и/,-..,-/0/0368888;AHHGJMIC?@:98>FU`iovxtnnf^SKB775:AE=30///-,~                                                                                                                                                                                                                                                                                                                                                ╪^,/4=GOPOICFJLJEA<955684/,+*(()(&$$#&$%$$%$%#"""""#""##""!!#!!  ##$#$&%%$#"#$%%$$$$%%%%$%&&у      ,*+-.,)+,-/247656;FS^XQKDABDFGA;?GNXckprrti\TLD=;=BGNXfuАКФЪЮЧРЗЗКРЬ╣└░ЯРАtkbYRKDMЮ                                                                                                                                                             d;KU[NMKIHFC;9;;985:53/-//,+V                                                                                                                                                                                                                                                                                                                                                   в<.39>HULQOMLFG=:7321--*('&&'%%$!!"#$$$"!##! !! "#" !!!$%%#$%%$$!!#####$$%%%%$%%.       m+)+,,*,+++.157539I[`c[NFFGIJG@<:;DLWcmrqqkc^SHEHJOU]grБЛЩз░┤╡иНМПЪ▓╚╡ЮМ{l_SLDA\╘                                                                                                                                                                mG_VMJGGFA>89:;868;941220,+4                                                                                                                                                                                                                                                                                                                                                     ёs47<@CDDCBA>;82/00,-*))('&%$"!!#$$$$$#"!  !!  !  "####$%&%$#"####$%$%%%$$##Г        0*+,++,,+)+275339FR\`d`YXcnXKA;:;>GOauzzwqkaWOIPQW[cnwКк┼╠╧╦┼╛ЫЫд░▓вТВqaUMHCeЄ                                                                                                                                                                   m:>DFIMLE>;=?BC=9=>96434/,+                                                                                                                                                                                                                                                                                                                                                        ║R033343333O,***)*'&'(&%$$""!##$$$##"!!   !"$##"$%&$$##$#!"$$$##$$$#"         щ+***+-,)),/22228AHOXZ[\^gfaSC=<A@>=BA:6301,,+¤                                                                                                                                                                                                                                                                                                                                                           ╠б{VmЬ  d))*)((&&%%#$#$$#$#$$$$"!  #" !!!!  !#$$$$$%%%$$$%#"!#$#$$$%$#]          ▄,'(+*)((+,--.16;?CHLOQU\cbXPGB@?DLau|{xpe^]^YOUXZ`j|б╟┌▀█╒┬╚йдЩЗvcSH@:{                                                                                                                                                                         T/=JRTTOHB>@BA;9>B<4102.+)╠                                                                                                                                                                                                                                                                                                                                                                    e&(&&%&%$"!!"""#"!""!"! !    !""$##$%$#""#%#!!"#"!"#$$#Ё           °1')*'&&**,,-/37:>9:=><70-/,*(Ц                                                                                                                                                                                                                                                                                                                                                                     Г'%$$%%$$""""###"#!  !  !! !!###$$$$##"##$# "##!##$$Y              B()''(+,+*),/479;>>>BIZfpqqp]PWbfimtxpkВп┤╖ЭbaXSYbtЖгеЬЬЩШФАiSBAЩ                                                                                                                                                                             В/7FRWWVRG@@A@98:>=5/.0.+(k                                                                                                                                                                                                                                                                                                                                                                      ╗#####$##""!! ""! !!  "!""#$$$#$#""##"! "##"$$$$                ╔:&%'*+*'(),.36888:З                                                                                                                                                                               д/5CPWXVQGB?==977;;81-0/-+E                                                                                                                                                                                                                                                                                                                                                                       ш("#$$$#"!"!"!   !  !#!####$$$$##$"""$#!""##$$%%|                  эУR(*)&%&').642358:?LW`fifefld[Y`kМм┐╚┴еodXPNNOUVVZekpt[Bp                                                                                                                                                                                 ┼,3?LXYVPGEA@?935>=81.11/,,                                                                                                                                                                                                                                                                                                                                                                         6"!!##!  """!"###""! "!!! #"#"$5                      р<'%$$%'*+,-/158;855;<7-,01/,+                                                                                                                                                                                                                                                                                                                                                                          K"!!"  """#$"#"#!!"!! !! ! "$#$$%ю                        н."###&(*,-/235;ADDC?=P`^WaН╢─▓дУЕАЕ`QJECJOT^XK@^∙                                                                                                                                                                                    ■-1:ITUUMFB?<;834<;4++/0/,+ы                                                                                                                                                                                                                                                                                                                                                                          i !""#"####" !"!! ! !!#$%&'Х                           {#$#$&))*+.01578755:GSSVp┤║╛дДzzweSMJGGILPRTODG╠                                                                                                                                                                                     -07GRUUQGB=:;;748:4+(-10.+╕                                                                                                                                                                                                                                                                                                                                                                           ╞,!   !"#"""#"##!"!  !"$%%'d                              \!#$%%')*)+-012148BOSVkФеР|usk\OLJHHECADFHJID>MЎ                                                                                                                                                                                   +-4ERWYUIC>:9897772,+,01/,Ж                                                                                                                                                                                                                                                                                                                                                                             L!! !" ""#" !"$%$R                                ь>##$%&&((+---.04:>AMcwvqqxq\KIFGIGDAA@@?AFI<91d                                                                                                                                                                                  1+2CPUYTJD?::873575.)-21/.\                                                                                                                                                                                                                                                                                                                                                                              Я%"!    !#""!""!  !"#$$U                                   └1%%#$&'*,,,,-06435?MS^jh^TKFDDDDDDDA<<>===<>:8С                                                                                                                                                                                D,2AKPWXPIC><;;6444/+*/21/=                                                                                                                                                                                                                                                                                                                                                                                Q !!  !##"!"!  "#$$m                                      Н($%&''****,.33248>DLSYZSJFBDDCEFCA=@?>===?A=6<╟                                                                                                                                                                              Z+1>JRWVNH?;;;;75660(*/0/,,                                                                                                                                                                                                                                                                                                                                                                                 ╞."""  !"!"! !! !"$$О                                         l$$$%)))()*---/254AKQTSMKIIG@;BCC?DIMPNKKID<9<;;99;8;;=BCDF@<3e                                                                                                                                                                           Л*.;JU_[SLB<98:6311-()/22/+ч                                                                                                                                                                                                                                                                                                                                                                                    Г$!"#$!   !  ""#w                                               ╥8"$&%&')+,.//37799=FONNKGD=<=>?=>==<;=@A@B@A=9Т                                                                                                                                                                         й).8FR[]WPD=:;:72363*).33.)л                                                                                                                                                                                                                                                                                                                                                                                      Ж&#$$#!   !! !#`                                                   з,%%%&(**+,-155458;CJJIID;??>>?CFCA@@?<;?BACA:@╔                                                                                                                                                                       ╠*/7CQWZYPE===;72220++-01.,{                                                                                                                                                                                                                                                                                                                                                                                        ║Q$$#"""#     !#"! `■                                                      |$$$&&')*+-/232354:AFJKGECBBBCEGDCA=;96;<>BD?:SЎ                                                                                                                                                                     я*/6ANVYXQF<<>>:/-/0,(,01.+U                                                                                                                                                                                                                                                                                                                                                                                           зC"! !""#"   !#!^№                                                          S$&%&'((*+-./02319=@EIHGHHHGEGGCBA=;:::;>@B=;6j                                                                                                                                                                     -/4=>;0--/-++-00.4                                                                                                                                                                                                                                                                                                                                                                                              уУS)"#"""" !!! )Г                                                              ф@%%%&'()././154577;BIFIKQTNHH?@CB?=;99879:;>:8У                                                                                                                                                                   ,,18FW]\WJABAB<4024/++,031,                                                                                                                                                                                                                                                                                                                                                                                                   └wD$$!""##"" !5tч                                                                  ║-%%%'))*,-01220259=BEHLSXLIGFDAA@?><:889;=><7A╩                                                                                                                                                                 ++.6DUY]YMC@A>;4./45,*,241,¤                                                                                                                                                                                                                                                                                                                                                                                                         ╨╩ЬГи╚╚Ї                                                                        З&%&&%')*+*,-..02136;93/024-++164-╩                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           b$$%%()***+,,-/0037=DKKLOSRJDHFEA>><99;===>:87n                                                                                                                                                              5*.4@SY`[MDA?==5.057/*,5;6-Щ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ЁG$$&'()*+)*+/30126:AEGKOTWUROJGEDA>>A?;::8:?@AЭ                                                                                                                                                           д,-/4?QW\XOEA@?<60-/2/++5<9/o                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ╤1$$%'))))+-///0258<>CHLS^VUOJGIJDA@<:;::;?CBDMRWZZWSPJGEB@@?=9876=AACЬ                                                                                                                                                  X0765106AR\]ZQJCB@>82068-.3>G<-ь                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ф9%%%''(*)*+-0./0128=BKPW\YXSMIHDDCA<96258+╕                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      м.$&&&''()+,+,-/12459?EPX\bYPLIJGDA<840548<>>?X∙                                                                                                                                             ?04751.-2A?:42620/12.*Y                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ^#$%&(,+)*-..1000149?GOT[da\SNKIFA<:8888;??<:=Щ                                                                                                                                         71640//--09BU\]XQE??CD=5694/.00.+:                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           Ё@%&&'())*,,/1/./038;BJS[a[VROLJGC?=<:77:<==<:C╧                                                                                                                                      Д.130/..-.17?RX[XQFBACEB95761/..++*                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ├3%$%')*++*,-...0255:?ENUW]ZRKMOFB=9667;<;;;==]·                                                                                                                                    -0660..---/4;OWYWPHA@@BD>896/--.+((                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               У'%%&'())++,--.../48?FMTX^]VQPKF@;86:=;::=BAD=u                                                                                                                                  _/471.//.--.0;MUZYSJD?BFE=4530,,-+**┘                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                l$&%&'(()*,+,..-/2479@FQZ]YWOIEDDA@>::99;9@FECЬ                                                                                                                               э.6641//.----0;KV]^YMD@DGF>433/-/0-))в                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ■G$%&'&'))()+-..00236=AF^∙                                                                                                                          └+00/100-,-,++.5EPX[XRGCADGB6/240./.*'J                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     е*%&&&&((**++,,-,.05;AISVXUKCKMIGDA=<<=@@@CDE>u                                                                                                                         70520/00.*+***-6COX\YTLABEGC8441.+.1*%-                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       {$$$$&&)))*+,1/-.379;CMRUVSQOLJHFFHEEDB??@?@AAб                                                                                                                      П02310010-,**+*/8CKV[[VOEBCEC93450+,.*'&                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         S%$&&&'()**,...1347:AIPRUTROJIIGHGFDB>::8@@<1340,,/.*'├                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ╝.$%&&&'()+,-,+,,/38>EMRWZXRLMKIGFD=9347678::6v                                                                                                               Ё-030.----+)'())*-3=LX_`]QEA<<@?331-*,0.+*К                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             И&%%&')(()+-+,-/0358L[bd]SJD@@B?5220,+/0+*l                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               h%%%&'()))+,.//03779?GNRUSURONMKIFB<9868:8446E═                                                                                                          ╚231./,--.-,**)&'(+.>L[bb_UMF@?A@6-/10./.*(C                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ЁF%%&&'((**+--./0.137=BHPS[ZVRPKKLF@<8566557;@Y∙                                                                                                        <0/.00.-+,+*'(&&&(),;L_gd^VPHB>?=5//0.,/1,(+                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ╨4$$%&'(*(*,--..-/04:?IQX_a\XTNLKGB;976657:<;9x                                                                                                      У/01010/-+*++)&''&&(,9J_ifc[RHA>AA7,-10-,.,+*                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    Ш($&()+*')*,.1///149AGNU_feaWQMMKGB><97799;==>а                                                                                  ъ╥ФЕZXY11.<{ъ     012///..,*)*))'(&&&'+5F]ie`]SHB?A@90/0/--1/,*ы                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     v%&&()())+--..00248:CKT_ha^YQOOOHGC>;:789:=<:E╠                                                                           ╔ВO156768987665352/[п r12000//-+**))(((&&&(+1@Wfa]\UKB@A@:/020-,//+)┤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ■P$&&%%&())+,...--37;AHOWZ_[UQPLJJHD@;656888:=@BD@:88777667421..//01-,*)&'&'&&%%&'-9Ra_`^VNFBAA<3110-.11*(Д                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        у<&%&%&')*+-.,*,-/24;BNY\^\VQOKIJHEA=988777:=9x                                                                 ьk013488:<<<>A@DGGEB?=<9999886210/01/,+*('&&('&&&&(*4M_bb^VOEABC>1.11-+/0-+X                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          м.%%%&'))+++**,-..08=:869:::63210--+)'&'(&%%%&(+.E[aa_XPG@?BA3,,00,./,+;                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            Й%$%&()))**+--,-.26:?GPZe_XSJINNIHE@;:6668<=8D╠                                                          h//02567889:<=?FP_][LB?CEDA@<9989=<97620.-+*)''('%%$%(*.ARX_^ZRHB@C@4112.)-1.**                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              \#$&&&')*+++++,--168;@JUXfd[TOFILJF@9/2268:;?]·                                                      Ф0-.///35544679:>CIJIFA=<=BHEFEB=937<;;:6/-**)''')(&$$'*+/7CP[_[SH?>??6000-*+-+(&                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               ЁD&&&&'(*++++,,,,/48=;6.+)()'))'&%&')*,/8HU[]UHA?>=5453.**/-*'╫                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ┴3&&'(*++*+,,,,-/2565>DQ`hb[VMKNLGG<431058:<=Cй                                                ф6/-,,,-/01/.--/20159>CDEEBA@=;?BEHGDA=::;==>60,+**+)&$$%'))*.5@Q[[UIA=<<9522/++/.*(б                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  Ь*&&()))))*,---./025;DOX_^`VNJLIG?;854248;>>?N╨                                             ж//+))*,.0100/-,,.,.158=@EDCBA==;=<81-+)('%$$%'()*-3BDEEC@;8@B;2,*&&&%$%&''*+/7CMSSLE@=;81/,+*+01-*L                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ■K$&&&&&'()****+.015:AN[cge[UPJFEC=7432148=BG@А                                        z++)))(),/49842.,-/,+,-//148975367;=>?ACKKKKLHEBFLKD74-*(&%$%%'),.5;HLLHA::;82.,*,43.++Ї                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          z#$"%&')*+,,./133549?DNVZbZMHKKIIE@:623049;:7Y∙                               }+,*)'&'')*+,-0/.,,,,++,,,----.-.05;BEGFEB@>CGJMPNHEGJOOE=3*(&%$#&&'*-27@EILD:8972/,+*130,(─                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            W "$&(++++,-/00.126>DMV[_\TNNOMJF=852114788;7y                             ╞++*)''&%'**+-/./,---.,,-.,,--..-+,06@ADJNPQLIHJNQQH81*&%$%''')-16=CLMC89:71.,+-132-*Л                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             т>$%'(**+,-/.//01339>FOTY_fk]QNOJA;84134556569в                           4+,**)'&'())+.01301001.,-.--/../.--.36830-//03468X°                     є+-+())''(((++,-.01/00/.-+,,,+++*+*+-/0/38=CFHHGGHHJNOONOPQTYVM=/)'('))))*,27@DA86774.+*(+,//,*                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   g%&&'()*++,,,.04568@GQ]elj`XTNID@940/./027895x                    e+,+))(('*)*,,+,.0.--,+,,,,+++,,+,-..02/04:?CHHHHFFIMOPQQQSSY_YI;1)&&'((((+05977730-++*-22-*                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ёH&%'()*-,*(+/24358;?GPZbgce[PLKKE>941./497657а                  ,-,,+**)*))*+-,+-/-+*+**+*+**,-,--..-//../49?FHEFEFFJNQOQSSPLX_SE:-(()**)').39@A;89;84/--++./.+ш                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ╤4%''()))),.110156:?GPV^dfi`UQNLE>:5101466533@╥               },-+*)*))(('))++-04/+*+*+++**,,+++,-../..-036DFIHFEHPPPPPNLKMWZQE;.+**('(+.37897787542.**-0/+V                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ■P$&&()+++,,-015689;?GQZdjghULHHG?962112456768е         m+,,*)'&&''')+-/11341-,,+,-+-//-,))*)*-///1577888@EGECDDLMPSSMGJKPTRKF4.+*()(*/2269669:8742,*,12/5                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            у@&&&())+,-.0246668;BJS]fb^TKIJF>741010213553?╤       0+,+*)&%&'*+../02454/+++,-.-.///-*,++*+-..1587404;AGJGEGMOQSRMJJKKNQPJ:40,+**(+-05953799642.+,/0.,                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              н.$%%&(+*+-01663246;AHPVYfe^UKD?=:510.//23357T√    ы***)''&&&)-11/..0340+)(()*+(*,.130.+)(**+,16777316;CJJFEGGNRSMGGEGKNPMA95/,++())*-1028::832.,,14.+                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                З)&&&&'()-/03222458?CKS[bd[QKDA>;741/00446763y   И**)(&'&'(,/25/,,./0/,**(()+**,/335/+***)),035566438AGHHDDFLPPMLHGGJOQMH?81.+*&((),0128;:4///-.03/+                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  `&%'&()*,./0313479:8@IRZdgjYKECB=830144543339л R+)''&&''+.0120,*-../--.-++,)*,.025;71,+)**-25556855FP\ffeYMHIF=:63121113679H8-)''&&&*,0000-*,/13443210//.,--.16:<91.,)**.2454535:=CIHFFHNRURKIGHIKMNJ@61+,(&'*,0237:82/0/0365.+                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ┐2&&&&))-.-././343137?KX^ifZQMFBC<61/.//12389-)'&%&&+,,*)++-1555675412435110.-28=C?80,+)+.34565469=GGD@DJPSUPJHHHGHNKC;4.-*'')+.13132//200499.+                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       Ы+&&&)*++++-.01./04:BMW^gdYVPGFB=600-/01473.*(&&&)--*)((.26:97366644665841/--4=BGB5++(*-12355545:CFEDDFMSTQOKIFCGQNF>6-,+(&&),146761/0.2787.+                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         l&&')()'(),/1./0357:AGOY`aiZOIFC=8431012/,+)'()+-.,**.47:::967545786346689207:DNN90,+-./2578747AHHHGGKRVURNLKFDMOKD:.,*('&(,3689621280.,*&&'+0798754:=BEB8-+                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ╧8%&&'*)*++.1222358;>BNW_ig]SMFFE>720,*'&&'*-.('*/598882.346989:9:87777:A507ELPQ6.+*)/6643217=FLNKHLSWVPJDDDHILJC3/+)&%&),8CB=;?BGJKC6.*                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              м/%&&())(+020/1368:=BLU_hg]ZSKIE>72.)'''*+,**)+187744456:<<;:9:<;;998::754;I\Z>5.*+,25664208EKOOIFPXWTPLHFDGNNF81+(&%&(,7?EFGHMQONE7.,                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                }%&%&')),---02679:<>GPW]aci]SLGB72*'')++*)++-0421/26:>C><;;;?BA?<8689;<:9BSaL@3--,/3566523>KOOKILV[XTPJFDFLOI=40.)%&'*4@HMPORRRMD80.                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  _%&&)(**+,//26768;@DIPYccf`QEB=2*)()*-*()-01210249?DB====??BE<6468FOXO;--+.44564038CKMIEITYWUQLG@CKOJC851+%&&'0=KRRSUVRLC6.,                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   ф?$&'(*++.--03346;;=?DOW]hg_TB2,)'&(++**-0110017>DFDA=>BAB@:55679AKU\ccVG7,(&'+,+*,0430102:CGHFCDEEGE;776888HTT]aI?MXUG8++,03367943:GMNPMRVXVRJEBCFKJFA<1)%$#(5FQSTWTMD90-2                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         n%%'()**+-133445687>DFHE5,(&'*+++/476332;ITTRNLOSQG9994+*K                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ╨8%%&(*)*+/3355567751-(&'')*+/3666856DU[YVTUWUMA8FNTXWNIOVjЗЗqc`>>GLD3-)*,.0267336?LKEFLQTSPHC=<@IGC=2(%%$$-=INNLMG:1-*\                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              Щ+&&'&()+.135334761+'&''())0787652;KX_^WUXZTJABS^hcZTPPXgv|xghLABHF9/*++-02550/4:FLIFIRVTRIC?<1($$$%-?ABC?3)%#$%+9EKNIG@70,+Ю                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ■Q'&&())+--.///.+(%%'))(1788778GV^ba\\]YRJIUlnple`at|ЕСЬЬЖodVE<@>9-,+*,/032137@HJJIJORNJFA<<BA7-&"##&4AEHDA94.+)                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      н0(''%(*+++,,)&%%(++4;<:8:?<=>T]]]Z[]`^WUX[bkmkiedlr{ДУи░║┤йpKB995/+*+.//04579?GFCBGNPKGC=;9;>=:2*$$#&1=AD>631.+Ш                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ^$&&&')))(&&'**,9>@@>=?Xa`\YYZ``\YX]`efeb`eiw}ДЦп╡║├╛Щ_F::50+*+,-/13238?CDB?@ILIFB@>::=<;5,$##&1<=;941.+)                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ЁI%&&')*)''(*+/:>BA>=B[a][YZ\b`^^^_cgfcbbcn~ГШ╣╧╨╤╚╡zR8871-+,,-112335;>BBAACHJGDB=9::;;6.%$%'18863/.-,d                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ┬1$%(**&(+,,/;>@AABH]hc[XXZ]\^bgpxupnmlkquuzФ╝╦╨╙╦╝Й_9762.+++,.-/1269>BCCBCHFDDC?:9:::6/&$$&+120..-,+█                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                Ы+&'))*+++/;>@CEIN]ca]YWWX\agpАВЕВ}wroqrruЗ╖╩╧╫═╗Сa9672-+++,,,/0267:=@A??BCDDB=89:9760'%#$*.-.-/.,B                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  С$&&(**++-9=AHNNQ]c`]XSQTV]gtЛ║└└┤Ц{ssqpq}д╧╤╪╧▓Иb<433/*(***),.02368=@>9;>@AA<8956762(&"$&))+*,+L                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   ·$$&')+,*+9CGLPTWX\\YVUY\^aeoЙ░╫цц╪╝~tssrsГе╡╣└г~fG6461-+('((+,-/149>B@869;>@>;753574+&$$&(*)'))°                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    #%'()))),;CIOU[XQUWWVW\adeluГвъї·р╜Е{utqr|НЫ╡▒ТwcM:10/-+*()*-000//6<=;98::;=@@964343-&#$'))*))o                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     1$''''&)0:ELT^a_QOSUUW\achvГИФъў·ч┴ЛxsqomqzВДП~m_N?0---**)(),-/-*-49::85779=?<634442-&##%'(**2                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      Y$'(''(*-9FPYae\OPSSUUZ^dkxГМг┐▌■Є└Ф{rnkjmqwАxlaYO?/.0/,))()+,----169:97679;>=8/1111-(%%&()*(├                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      Н$'**))),:HQYbcZSRSTUVY^bgsГРжим│┴╗Т{oihkmjmokc[UQ@1//0-+)((+++,/0169:966779;;934220.+%%&())\                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ╤&)*)()).;GQYcg\RSUTTVYY^bl~ХдКПЬжвОsifbacaegb[VSQC3///-+)(*+,++-0159:9754457961/0/22+%$&''5                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         &')('&)/;COZac_VVSQOSVWY]duПдМВДФСВld`_^`^`^[WTQOE5.,,+*'')++*),//2798421346740,-/1/)%$$%%р                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         *')'')).9DNYbedVTRPPSUTVY^pЗАwy~~|uf^\ZYXXZVTTSQPG70-,,+)''((('+.03578610036741-+,//+'&%&Д                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          H')**)*-7DQ\bhj\WSNMTXVWX[__\WUanqm^ZXWUUWZVVTSPOI:0,**+,*())**,.0124651./47762-,+-..*(&I                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           y&)++++/5@R`die]URPRTURSUVWXNDFQ\bf^VTTRTTUSRSSSRJ;3.++***))((),..025751/035651/,+,.-('4                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            │%'+**+,1;N`ffc^UQPRUWTRRQPOA==FT]a\SQPQRTVTTVURRK=6/++*(((''()*,+,26620..045640,*+,-+,я                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ё%'+-,+,.:L[afc_ZRQTUWRRPNMK?88?KX^VONMMQUTPTY\ZWN>5-++*))'''))+---0452/.,.14540,++,-+└                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              &&)+**+.9IU\dffb\WWZ]WUSRNFA63;IRVRNPPOPRTUelnhWRC6/,,+*((()()*,..021//,,,.243.,,+-/,                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               G)+-++,-5DU_eimg_\^\[USUSJ@<21:EMTPMMOOQPV[bjj`WOE9/++,*''()((*+.-/141/-,-/2430-,,,,,                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               Р)+,+*,-1BU`ekuЕyjc_aVSSPH@720:BEIKKNQSTUWW[ZXUQLH:0+))'&&&''(*+---.00.**+-022/,*))*+                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               ▀'*++++,3BQ[ai}ЗЕxj^^WTSOF<5-0:@CDFHOSVXYWSQNNNLNI<0+*)&%%'''(*+,--//0/,+,./14/,*)(*,                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                '(+,+),4;HT[dzСЦО{ceYSPJB;2.2;BBA@LV\_aa^VOMNOPTQ@5-+*)&%%%&')*+,-00/.,+--/00.++**,+                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                =)****+/6@LVavРгвЗgdYUOJB72.1;@?=EQYafge`YTNOOLUVE4,+)('&&&%&'***+.0/.-++-./2/,*)(++                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                |)((((*+2;FS_oМбзЩvj_WQJB73017=?AJ^koosvvqha\XYc^I6+)(%%&%&%&&)**))-,.,,**,./.,*))++                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ╥'&')))+08DQ]hблЩИ}`YPKF6515:>?C[nqq{ОЯШТБm`YXbcN7,*(&%%'''&'+*))+,./,+**,-0.,)(()*                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 '''(***.8CNZfuЭ┼═║ЧБobXPA::;BFN]sНй╖╕╣╝┐░Цw`XZjjS9+*(%$%&(('&('''*.1/+*)(*+..+*)()*                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 5)))**+-3=LXdqЭ┼╓╙║ФВvhZPIDHLWh}Ы╣╗╝└└┐╜┤Рtd]\hqR7+**&&&'''%'(('),/1/,*)(),/.*)''(+                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 j())+**+.7ETamХ╔шЄщ│ЬРЙЖБ~|}Пк▓╢║╞├┼╟╟╟▓ЮБma^^fjN5)('%&&&'&&'))*+-/1/.+)'((,-+)(''(                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ╛))*+*++-3?M]nР╞ў√√┐пЭРЛДЕВКм╣┴╛─╩╬╤═├╖дИyi`\YaaF1))'&&&'&&&()+-/./0.,))))),+))''('                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  )))++,+,0;EWkИ└Ў  Ў╞пЮЫТНЛТк╜─└║╣╕▓ивЬР~qha__f_A0*('%&&&'&&(**+,.//.,**)))*''&''(I                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  D'(*,+*-17APd~лЁ   ё╚мбЩФОФг┤╜─╜кЮФММД}sjc_]^a[@/*(&&&&&&&%')))*,--.-+*)'*-*('&&&╪                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  Ы%&'*+,+/6;K]wХ╙    э╣нЯШФФЮк▓╛┬▒аТЛБzlfb]YY^eT>.(&&%%%%%$%&&'')+,*,+++*(*+)&%&%8                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    &')+++,,0:FUlЙ┼    ·╩╡вЮЦЦЪвн╖│░аК{vog[ZWVW\dO<.('%&%%&&%%%%%%&))+-,*)()*+)&%%$│                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    E')**+**08@McyЬё    Ё╞мзЭЧЩЪажйгЪЙwoid]XTTV_`H9/)'&$%''&%%$&%&&)*+,,)'&'**'%&%.                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ┤&'**+--.49CXp}ах   Ў▐▓нвЬЧЧЩЬЬЭФЖ|p`b\VST\`XA5,(&&$$$%%&&&&&&&)*+,+*&''),*'$$У                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      *')'(*,,/4;Nfn~Хю  №р─┴мбЬЩЧЦТРНЖВ~ukdYX[][P;/*'%%###%%%$$%%$%'((*)'&%&'))%$&                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       Ф'**+,+*-06DV\iГ┐ш ·ч╫╔│жЫЦХРОЙЗДБ~xrjiigc\I5,(&$#$$%&%$$#$$%&'))*('$%&(*'&%В                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        ,))*,,++.3CILNNU`jqttqnje]UOGC=93*)%$$###$'&%$$%$$$&&&&%%$"#%&&Ь                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 D%&-1.,,,,/48BELTZ]_\`^WPJEB>961,(%$$$$"#$%%%%%%$%%%&&&%&%$%$'╦                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   ф%&(),+*))*,-067:>HPPQPPNLGBA=940-+'%$$#""!!$%%$$%#"#$%'&&%%###E                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     И%'+,**)(*++.3359BHHIIIGEB>;63/,+('%$##"#$#$$$#####$%%&&&&$$$$ю                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      b&)+++)(++++--0467678:=;742/-*)('&##"#"###$%$$"##%%$%&&'$###q                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        Q')+-)&(***+,./34566754310-*)(&&$#####"##$#$$#"#%$#$%&%%$#7                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          E&()'&&''&()**+-/10/..--,+)(&%%$#""#"""""##$#"#$$#""$$#"!Ї                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           :'&'''''&'''')*+,-*+*)(*)(&&%$#""$##$$$#$$#"!#$$$##$#!"▓                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ;''''''&&'&')+--.+)(%%&)&&$$##!!#$$%$&%$#$#"#$%$#"#!!y                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               ;&%&))'&%%&'(*+*(&%%%'%&%#$#$""#%%%%$$$"""#$%$##"""`                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 >%&&'('%%%&&&'''&$$#%$$#"""""!"#$$$$##"""$%%$##"!k                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   D$%&&&%$#%$%$%%$$##$#""#"!""##$$$##$$$$#$$#$$#!Й                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ^%''&%%%%%%$$%$#"##!""##$#%$$#$%$$#$$#$#"####╣                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       а%&'&&&%%%$$%$###$###$$#$#$$$%%$##$###"##$)т                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         ё3%%&&&&%$%%###$%#$###"###""#$$"#!####$"/∙                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            }%&%'&%%$$$$$$$##""#####""#$%##$$$%%$V                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                b$$$$#$%$$$$##"""#"#$#$"#$$$""#%&+╕                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   П/$$$$$#$###""$##!"$$##$##"#%&}                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       эБ3$#"#"#""""#! "####" #q                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ▄ФT:"!!"$$"!"##$##$M▒                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ∙╟╔╚╟╚╚╚╚╚╨                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                endstream endobj 9 0 obj << /FL 1 /Type/ExtGState >> endobj 10 0 obj << /Domain[0 1] /Filter/FlateDecode /FunctionType 4 /Range[0 1] /Length 34 >> stream XЕ┬╤E╤Uю oе¤'"эЮsуI╡q фЬ endstream endobj 11 0 obj [/Separation/Black/DeviceGray 10 0 R] endobj 12 0 obj << /Width 801 /ColorSpace 11 0 R /Height 901 /Subtype/Image /Type/XObject /Length 721701 /BitsPerComponent 8 >> stream GQfwwup@0-/.,*///-32ДВе╣╤╝┐кдЯ╖ЩЩСкЯкв┬╬е  ЯЁЧЛд╩┴╟╝─╖╣╜▒▓░╛╞╣─╒ю■п *s═┬аЯо▓▒╡▓╢│╡╣╡│╡╡╖▓╖║├▄ЎЦ Oв░ПТЦепжелмйм░│┤╕╣╗┤║║╣╖▓о╢╢╝╔ы╝H<25135?)%&>_Э┘ш▄╣╗меееезкллп┤╡╝╜╛╜└┴╛╜▓н╖╖п╗х■╥╛еЮРЬо╨╙|,B\conwlzР═Ё╨▒лмйлжжЮбежмн▓║╜├╚╩╦╦╔─╕о╖╣░║╥▀╫╝одЬи┐▐■тбДC<% PhrvЖЦХп┐╒╞╨лЛВР├щ└дйлнн│зФЫеейп┤╛├┼╦╧╨╒╓═┴╖╝╗╢╣╝╦╩йНОТе║╩▌ъ▌▌╛╥╚╖йнШЮФРf5 PnyРЬ└╗╨╔┌├├╧э▌╒╨┴КeЗ║рпwФееп┐нНСбмой┤╛├╞╩╨╠╨ч╨╚╚┼╝╕┤╢╨├КjiЙк├┴├╠╘╙╤р∙ёЁтхщЇьь╦─змЬОБ}L( @ДЖви╦╟▌рЁсу┘┌╒╘╓чыу╤┘╦mRЫъкLЕи┤┐─╠╤╥╓╪▌Ё▌╓▐щэїЎЎю■■ ьё▄╒оаЙДt\.cНФ╢├╬█ъ┌╒▌ъс┌тус┌ссхштщ■╚@├▌rФа▒╛└┤о▓║┬├┼╦╨╨▐╩ЙЧ╣╨┌┘┘╨└═ьЎ╓};`Ы▓╝╟╬╒╫▌▐▌▐х┘╪счьыьыфэЁёъыЁЁЎхч╥═└╨ШЛsm&!WПСп╟╥╤█╒╧╓▌у▐█▄ц█рфщцыъштчь■■ЯПё╧Ьек╣╟╠╩╩╟╩╬╙╒┌┌╥ц╒дг╚┘тух▐╙▐ї√я╕~Т╕╞╩╤╒┌▐▄сртт┌╪фушшщчщщьцщцьщЄёэ▐▌т∙ъ▄┌╨┴УОWPДЯн▒╬┘▐╫▄╒с╫┌рфсхф▀▐фщъёьїш▄р▐я ■дТ∙ц┴╗╜┐═╒▐╓╒╪╓▄▄▐с▐Єф╨╩┌фхшьъххщюЁ╫┬┴╦╬╪╪┌▌▐рртту▐▐туфчьычцчщщъшшщючт╫хщц▌шюё╫╓═дДp*NИЩз┤╤ь▌╚╠┘╓▌р▐с▐▐цххцшф▐шььЁЁёх┌╪▌ш■ ╒/R▒ё┌╬╩╞╩╙█ф┘▐▐ттхххщЇшхцшшщщычрхтсх█┌╒╘╤▌┌██▐█┌┘▐▐▐┌рручэъч▀хчцшччштх▐╙▌▄▄██с╒═╦э▌┐╛┴еr!kЗг╛┌рщ╙▐▐ф▄▄▀▐сщщчщрчшшшцу▄щёяьщцт▌┌▐▀ь■ёЦMyв╩▐╦═╤╨╥▐▐▐┌уххшыщццхцшшъъщшчу╪тт▐▀▌█┌┌╒▌▐▌▄▌█╓╓▐▐█╪▌▀▐ушщчтфцухххх▐у▌╫┘┘┘█┘╪╙╧═█▄├╦╪ч╟▒ЩЪНУОГАМИЕnu~|R02/-ФЪ╢┐╬═┘╥▐▌▄уфччшщштъыюыыыыщчш▐┌чЇЁыышхррт╫╙▐с╠╛╞╩╩▄╒╓█▌сьф▐сттфчюшцц▐хфцччшхчч┘хчхфт▄▀сущфус▐▀█тху▌сххрщыъьышшчхфхуфр┌╓╒╧╧╨╨╬╧╧╦╧╩┴┬└╣╜└┼╕╟─╘▓┐╗╦зШЮ╟▓│ЯнСМВЮЙРАЗ~ЗxF3 AУе╠╪╫╪╧╬╥█┌усшщыыььььыьыюяяэьъхтфхчъшщщцурр▄╨╙┌▐┘▐┘┘╫▄т▄▌▀▌фурттрттфхуутухуххххфчччщшщшшшшщьыъщщшыъыщшыъььььэыээыхуср┌▌╪═╩╠├┴╜└└┴╛└┴┬▓╡┤▓░огЭйй▒нпииСВНдеежйгзел╣п▓╢╣▒╝н╖ЪЫЧдСеzH$VНЭ┴╔╤▐╨╤┘╪┘▌▐хшщыъыьыььъьъъчщччхтртсут▌хх▄█утрр▄█сяр╘▌э▐▄т▐▐▀▀▌рс▐▀▀тр▄р▄тфрфуууххщщщцшцшхцхцшъьыыыыЇьыътчъщщшчффчят█╪╙╦╝├╚┤┤жеегй░▓б░╛╕Цд│╖даЦвг▓▓╕┤╡░ЫyФк░ЭедлзгЭнзоп▓п┤╖╝╢╝┼┴╖├╛╗╜зЮЛЪИR"NСж╠╪╪╘╩╧╒▐▌фсс▐цыщщъыыыъъщшхчхтр▄┘╪┘█┘╙▄╫▌фф▌▌сстфцутш▄╪▐тр▐▄▄██▌┌██▌▌▐▐р▌▀▌▐▌╪ртртццшщцщшцт┌сссхъыьъщшщъчхстуртх▌▐┌х█╧═╔─╜░кЫ~wliwЗТемжн╜╜ед┴┼╕м▓└║├╞├╟╬─╕г░├╨╕╜║═║╕░╕┤╕╗┐║╝╕╡╢╣╗▓╢╡╝╩╠╩╩┐╚╒╠░ЭвзЭH 8Ни╗╥▌чщ╫╓█┌▐ЁъщышщЇюъшщшччъхцс▀▐█┌╪╨╦╦═╒╪╒█┌ъчуут▐с▌▌хсрч██╫┘█р╒╨╨╘╓┘╪█▄▄рфтттт▐██тфхцфшцщшшышф▌тр▐фшъьчххтут▐┌┌▐╒┌╤═╦╩╧╝┐╝╛╢╖┤Эm\89(YБХе▓╝╣┐╞├╛┘╨╚├┌╘╫╨т╧╧╘╤╟┼├╪╪╦┐╦┌┼░│▓╛┤╝╛╝║╖╢╣╗╗╖╝╕╕╜╣╜├╣╗╟╤╬┼╬╤с╟┤инЮp/ 'Йг╗▐у╫╨▌хЁф▐хцщЇюэюёЁ∙Ёщцчфрст▌▌╓╙╥╨╔╩┐┼╠╔╙▄▄▄фъчхфтс▌╫▌р▌▀х╪╒╒╥╙▄═╩╟═╒╓╪▌█▐▌тухфус▐хчъышъычттшыхтуттрххччс▀р▐┘╫╥╩╩╔╗┐│м▓╣┤п╕╕║╣╝┐│|kF:/dТй╖╧╠╠═╓╥▐р╥╬╙┌╘╒═█╦╦╞╩┴├╜╦╜╕о╣╒лrНвЮнн░пп░░п░п│░░░о│╛╢╖╖┴╣╡╡╗╩╩─╬╪╘┼╟╕еЬ`cЬ┼▌╪ттт┌▄ту▀цшщыыььяЁЁёяычус▀█┌╥╧╧╦╟╚╔└╞╜╨╒╨╓█▐ррцхтсс▀┘┌ф▄┘╘╙╠┬╞╠╬═╩╦╟╥╪█▌┘▌р▌тццхчфчшыээыъъх▌╒тчф┌рт▐с▀▐▌┘╫╓╫╩╔╟├┤▓ШОЕЖ}Ьой┤╛└╞╧╩╟╤╝аПp}О╣╝├▌╨═╠╒╧▄╦╔├╩├┴┤╢╣╖░▓┤пкомдЧЛС╣Н8%HVЧШЭгввЬЫЮбаддбЮдддазозвлн╝▓м▓╛╡┐═ь╓▐┘┬ж╝ХFSУй╟╘ё╒╨▌чсрухт╫▐чщщццшшшшщхс▌╪╓╘╬╚├║└─├═╦╨╙╓▄▄█▌▌▐▌█▌▌▌▌▌▐╪▌ш╓╬┬┼┐░║╞╦╔╬╨╨╫█▐▐┘тутффшшццшхшшючф▌┌█═▌ър█▌▐█╫╪╥╬╩┼┴╣нн╕│аСh`NTYОо╗┬═╩╨р┌╧╘╓├═╣┬╝╪┬┬╜╝╝╝╜╝╝╣╝▓╖┤░ШЬззШЯзЯЪаЮХ~lrЗ@ jСУОЦЧШНОМУУЩЩЦОФТСКЫаФНЯгжбЮзлкзомк▓╬─╩╓╪╛йк╢T,Р▒╨хї╙╨▄рсучфуххфт▐чщч▐цффу▀▌▄╪╥═╚╞╗░┬к╛═╬╒╓┘▄▄ру▐▄▄▌█┌┘╪╪╪╪▌╙╫╬╩─ж│╢╜╛╩╬╬╤╥╥▄▐▀▌хшффшцццчшчхр┌рт▄╔┌▌▐рр▐┌╒╒╪╬╧┬╝╢опЫУУе│йЙz[^W~б╕╦╨ц╙╬╘▌╧╬├╔╟╟▒╜о░мом▒пинмл▒пп░оаСЬгабЭШШЫФС}aftrd* iУаППУЧХУРУХШШЧХЦФХФХРИПЬЭЮФРввЭФбТШЫзди░▒╩├т┌╧║╩жPWЫ║┘ь▐ьт╪█тцщъЁшхшшццшшхцтшр▐▄╪╒╤╠╚┐┤╣п├╨╟╦╙╒╒╪┘┌█ят▄┌╒┘█┘┘╪╒╥╨═─┴╣╟╩╜┼╩╒╨╤╥╒╪┘▄цчшшшшшшчщыфцсхт┌┘▐▐▐╪█рш█▄╓╪═╟├└╕йлЯжмвУЪи╛┘╝╣икй╦┴╩╨╓╨╨╟┼╞╛╝помХtЗИЛЧЦЪЭвейждм╝пннмеезжеаЯЬЬЩЦНzoxvpfF:kЦЭТУЦХШХХЦХШШШЩЦЩЧШШЦХШЪЪЬЪЫеедвйизивеОСПЭажжп┐╪▌├┐╡░3 dб╩Ёщхфрштухцщъыёьщыщцшцтр▌▌▄╒╥╨╠─└╕╝┤╣┴╞╫┘╘╫▄╒╒╘╒╒╘р█╪╪╙╒╒╘╘╪╩╦╞╝╝н╖╩═╨╨╫╪╒╒╓┘▄▐ущчщщщыхфууу▌▌╤▐▐╪┌▐▐▄х▄х╓╨╩─├╜╗зкдджЮм╣▓о╣┴╔▐█┘┌╨▐╫╥╦├─└╝╡╣╢░пеаШydkpny~АЙПбШЧЮмнзлнммн▓лкееегбЫЧПЖ~ypДМfiНЧХФЦХЦФЦХФХЧЧЧЧЩЩЪЪЪШЩЩШЩЫЪвгзл░┬╢╞╡╛Ьzuj|ЙККУгмм─чъ┼м╕А1"ГЭ╛┌╙тъьхччщщчщщщчщщщф╫тр▐█╫╓╨╧┼╝┐╗╗╣┤┴┐╚╬╘█╪╫с┌╨╤╨╨╠╧╘╒╘╥╨╦╩╔╚╩о╕╗╛╩╕┴╠╨╥╒╙╩╒┘┘┘▄▐сххчхуф▐┘╒▐▐█▄╤▄▌╒┌ф╪╨╘╨╩й╜║обп║ленппж╗╦├├╩╩═╤╒╒╒╩╨├─╜╡иплелйевбЬЦБvvynlmewxЗw}ЖШУЫЮвджиннмнкезжеЯЮЪНtlНзМЖЬЩЧУХФСТФХХХЦЦСЦШЩЪЩЪЩШЧУФСТЬагее╡л╝└┼║Л{igr_kl}КЙТкм║└╧┐╩╛У0?Зм╬╥╨╒╒█хшхщщъъъщчшххус▌╧▐╪╤╨╩┼├╗│┤╗╕╜╗├╩╩╨╓╒╙╥╘▄╬╟├╩╠╩═╧╙╦╚├╣╗╡╝┴к║╛╦╨╦╦╬╨╨╒╙╩╫┘██┘▌▐ср▀р▄╥╘═╤▄┌▄█┘╪╪╤╙╒╔┴╝╝лФм░ЮХж╝╜╡─╞─╝╦╒══╤═╙╩╚╚└╝╕▓клкЬевЭбгЮЬЬЫЪЧНЗЛЙzwjxvyefoz~ЖНРФЩЭлкезикиййжмйбyZМ┤▒╢оЯУРССНСУУФУФФОЦЩЪЩЦЧЩЧЦФФОУШЮааЭЯЪа░░╕еСФuv`TVQgho~ГЛСУЭ╢▄╘┐╡Ч4 cП┤├╙╪╪╒уу▀ххчшыъъщячх▀█┌╒╒┌┌├┬└╣▓│жо┴┬├├┼╦╩╬═╙╧╦═╩╦╚╛╕╞╚╩╩╩╧├╝ои░м╣├╝╔╨╨╩═╦╬╨╨╒╪╫╪┌┌┌┘т▌▄┘╪┌╫╟╨═╒╪██┘╒╤╬┴├╡│лзйЯЦк░ейн┴╩╤╓╓╫╙╒╥╦╦╧╩╧┐╗╕┤│нжаддаааШЫЮЬХЪЩЩаЩХЦЪЦНЖКЛБsfnotww~~КСаЧЪвежжйим╣▓░ЖOu└хр╗гНЗЖПРТТТФССТТЦЦЦЩШЪШЪЧЧШЦЦЩШЩЭаХЦФЭбвзанФОНb_FKNF_^kzБЖНЫн║┘├╩н│H yй╖╠╣╗╚▌╫╒▐штруухчччщЁф█╫╥╬╩╩╓╜лоннеов║╬╚╟╟╩╟╚╚╩╩╞├┬├┬├┴┴└┼╟╛╝╕╗▓Эй╜┬├╩╩╦╫╩├╚╦╬╨╒┘┌┌┘┌▌┘▄щ╫╨╤╒╒╒╫╒╒╫┘┘╙╥─┼╝к▓дгЪевШЪп╣├╟╩╬╫тр╪╓┘╦╚┬╛╝╣╖▓о░пнлееедЭбаЭЧЪЬЩШЬЬЬЪЫЧЩЮЩХЦЫСЛДДГ}thrk}БЗБМЧЩЯадежйкжХ]eк■ї┬еНЖВПТТСССУФСЦЦЦЦХЩЫаЬЭЭЪЪЬЭЯФЭЮЬЭЮаЮЩЮЮЮШЫ░ПЗZ]2=-<\^lvАПМХФе╗╘╬йкR !Йд╘╒╩┐└╚╦╤╒┘█▄╪▐▀ррттсц▐█╨╩╞╜┐╛╣гвеен╖╝╛├╞╦├├├├├┐╝╛╝╣▒╕╖║╣╕╕├╢нмв▓▓о╢┴╬╩╬╦╚╚├╛─╚╩╨╙╒╓╒╒┌т╒▄╒─┴─╬╨╥┌╒╫╘╪╩┼╝з╢мл╢пн╢▓пЩж╜╬ср▀┌у╪▄╤╤└╢┤пнеийиииззййзеедааЮЩЭЭЬЪЩЩЩЩЩЧРЧЦЧФЩаЦУРОЛГ}vААyu~ЖКНУХЬаеейЪmsд▀ё╣еаЦШХНМТТСФФУФЦХХШЪЭибЮЮЩЬШЬоЬЪЫЦЬЮЪваЮЭЧЫЬЮЫЪ▓НЧoF?)$?WaЖw~БЕСЬй─╩ш╡┐4nи═╙╩╔╟─╩╨╤╤╒┌┘╪╪╪┌╪╪▐╤╧╬╩╟╜╢╣║┤░випм░▓╕─▌┐╣╡▒╗╝╝╗╢з▓╖пин▒▒▓йзмШе▓н▓│▒╕╝┴├├├─├┴╗├╔╩╩╬╨╬╦═╤╨┬╦╠╩╩╚═╬╥╬╩─┴╜п│жл╣╝╝┬└╟╙═╙─╟╤▐хЇ█╪╨┴╞├╝ЭЬЫагЫвбаадгдемевеедгдввбаЭЧНЧЧЩУНХЦТХХЬЧЧЩФФРНМИЙМЖ|yvА|КЕМЦЪадЬЕГбмкддедбЫЕГОТЙОЧЧТХЧШЧЫЮдЯЬЬЬЬЪРЮОТЫЪаШЛЬЯЭЬЪЯЫЫЧОЮЦЯЮ|БbB<'?HWisЖЕОФжи├├аtkС╦╘╬╩┼╚├╩╩╨╤╒╫╒╪╪╒╨╨╩╪╚╜╣▒╡╢ол░░кЭЬмп░░│▓╖┐▓▒жи││▓▓▓кйнмемйккгезЪйп▒▒┤│┤╡╖╕▒╖╣┐┐╛┐├─┼╞╟┼├╟╩╩├╔╟╞╟┼┼╨─╛╢иедекж│╜┬╚╩╨╒█╪▐ф┘т┌╘▐╦╟╝┤│╗╡бФХПСМЩЬУХЪЮЮЮдйгвдгедддедгаЪЯЭЭЧОЧХНОЦЩЫЩЧПТОЦЧРШШРНВАГАББКЗЩаЯЦЩеL|ЩжпкеРДСПНЗЬЮЦПЦХЦЪббЬУШЬЬжЪЬФНЬЭЫЯСШЪТЪЦШЦЫдЦХЧЩЫПЪеАЕRH&7^БКСУЪУЫШЛ|КЬЮЭаЧдгижЫдкжезкмо│┤─├╨─╧▒мп░▓╡├╬╝│нШТИЗДЦаЯ╜ФrДАЛЗШ╛КМ\) (E`csАНГДМЩ╗╛ПSБв┬─╟╒╧╞┼╚╩═╦╠╩╩╞╞╚╤┘аpoNdzuОЫЮ▓╞вгТwТСЙЙu`riДЩТЦвеМЙВj~ЙВНУЦк╟ЩОГhАГЖНШаПНАjЕСЪ│ХФЫЙЧЬЬЮевЩФГuЦЭЫ▓здзЪЦНОТЫ▒╝┴╩╤╙▐╫╬╒Ё╘┼┴╛╝╝╝╖╝└║оЮЬавЮЬСМНИГГЙЙНЖЙИЦеонп║╝┬┼┼╚┬╚█├╡╗╫┬╩┴┴╩╒╞╦─║╖│╢▓▒п▒░лШвЪЫбийззбКРЪЬЭЩРРМРЦХХСбЫE E|ДЗНПРФТЕБДФЪЫааежздОПХЮЭЭЫЪадбол░о┤╝│┴│▓╕╬╧┘╨╘╢мйЭСЗЬаноЭеЪЩФНЭНЧаic; "8Tv~Ж~ЗНабод[  iб╖╖╜├╦▐╨╟╞┬╦╫╚╞┼├╚╠о░Ч_XQW}НЩзев┐жНПprЧЙВx\hx}ЪппШдМdnksКОУФСХ╕дБwepИПТСеОzВs{ОСнЪ|}xЛЯаЫЩйКpznБЫвй░нйЯЬНЛЙЙГап┬╙╓╨╒╙╞├╩╗мй▒╜╖║╗├─╧╜╝╕┬╕▓олебЬПНЛМКЙБzАПФЮЭ▓┐╩╫╨╧╧╧┘▀╚╩╧╩─╝╣╝┴┐╗мзЧШЩЦЫЬЩЯЮЦЮЩЬЯдееемЦЦЫЭЫЬОРМУХУПТбмH\ДЖЙЗНОНКПМТСХЭжеплзЫПЬЮХЧТПЧЬЩЯЯПУХбеолл░╖╖└╚╩╥┼┌╝║ежзз╡л▓│мйЮФРМЬЖuИWX. "EalД|ПЛЕЙРк░лБ>П─╚╡╣┴╚╩╫╦╩┼├├╦┐║▓▓┴еwwXVjbvРм╖╟вФТg~Йr|ЕtzkmЛПНв│ЮАБc]swЗЩЬЧЪГyТts|uТЯЮН|Вcn~ВЮМБТkn~БЦзеН}Жgj~ЩЯгкп│╡лйЮаЭЮОз┤├╒╪╦╞╔┤зЩЪФУЦкай▓╖╖┬└╝╝├╞╝─╣╢▒мжеЯЭЭЬМ~ЕЦЮжк┐┼╨╙╨╧╪╟├╚╗╝╖┤░пвл▓╡╜оеЧОЛДМСННХШШЩЫЪЫЭЭажбЮЯЮЯЩМРТСФРННЪзo#K{ЗЙЙКАИЛИБОРПЛПЪбЮкойеЬгЯОФТМПШЪЪЩПТННЩвевдЩЬЯий╜╝╩╕┴╞╢┴▓│▓╕╝╝╗╜лдШПs3efpw@( !3Yg~ИВЗЕКЮо║ЩН"!В░╞╟┐╛┴├╚╚╠╩╔├┐╝┤╡╖аШШbQZQoЕМЮ╢╧╢ГdXЕГutcn~}С▒еСгЪg`b\tЗНЩнЩРКeaokИНШиШpid]ЕДФЧfgtfyРЧЧеЦhecdЕРЫвгз│┤├├└╕╣╣├╢о╗╚╟╠╧╜└╜мТЗЗЖИДМКТЮЫбжон░▓╛┐╞└┐┐║║╕┤╡▓пбЦвн┴╝╞╦╒╬─├├┼╡нееабЯвмЧвмп║▓н▒ШЦНКПКГЖРРРРФЩХХШЬЬЭЯабЯРЦЦЦЦХНРРЦНЖССНННКБГНЖzАЙЛКНСХЦЮиееезлЦТЦФООЧХЦЧХРЙТгйбвТОЛЗТгвЯеж╝╢┴╖╖└╜─├┴╦─└╢дt"HMДБme* 5TnББСНУЛПае┤Н ]д╙╬┼┬──╞╚╞┼╞╩├╣╢╣п│кДy_H^ipДМКЭЭЯ▓yfy^lИmlkc~ОЮн┐мГОmMY`wУЯЧжиwfVfoЖТТНПp`uhГТxЙlShtАРдШЕРoYlh~ЦЧаЫвЬ▓╖╞╧╦╩┴╢╧├╕┬╧├├┬│╗╝╖ЬХОУЛЙИЗКЛКННФЫЫЬд▒н╛┬╔╞╚╞╞╦╟╞╝╖╜╚╨─╬╟╙┬┤илЭЩХПОЙКХЬиЬЯез░▒п╖йедУЦОКБЛМИКНТНМТОЦТЩЪЭдвадЩШЦЦУМНЮ┐╝вЧСТПЛЗИЗБЕЖГИНОПЦЯЯвжж╡дШЯЬОНЧЦЩЧЦЦРФа░еддЦПВМЫШРШХдййнм╝╝─├┬╩╥тр╨ЬY$-0XРОи|V8 1\pООЩНДЙКе╝вй"8П╕╪╘╨╩╞╟╟╩├┬┴╝┴╡л▒╢зжsZ`MgБЗКЦНЯмЖxlWВИoofRnБМЭво▒мv[dXiyВТ║╖ЩЫnWf[tЕНЫЪСn`g^ЖСБЙm^lXlЖМОжн{di\yПНТСТУШФВХй┤╦├╚╢з╗┐┬╝╝╗╣╗┴╝┴╧┐╖▓│░ааЬЬССКЗДЖВДЖНРе║╚╦═╤┌▐╓╪╧┬├╬└╝║╕║╣нНМ|w{КЖЕ}ПФХСЧЬЯйззйлн┤йжжЯЬТРИ}|x}ЗЗКРНЦХЫдб░вЮгЬУБГе╤рпЬНОРМЛМЛЙЖИЕ~ЖЙИЖОХЧЬбгеиззеЦЩЬЫЦШЦЦХШЮваепгЯЩПЩЫТЭбжлЬеШШп░▓╖├╩эьЇ╨вxPHEasМкИЖ_)5MsЛНАЖНЙОХ░┼Гx╛╬┌┘▄═╓╦┼╔╠┐║ммкгж▓СДg8SesЙРТб░ХоЗdl]tдwhdQfМШж╜░КТyBL^xУСЧо╨Йvc2Th~ЩЮвЕБmMdjИ╢~xkJbztРлеНмАP]a{ЬЭЮЭРМИФМВ}Хбе░┤ий▓╣╨░дмм▓╔╜╠═┘╟╟╩╓├╣╣▓ойдЧТАВy~vКЩ║╚╨╓ця┘у╘╓╝▓┤░пвм░▓▒бЗy`n}БЗГИИКЖМПОЧЯЯЬдло▒▒╛▒╡вЧОxn^PYYmrРЖУЙПТЦЯгаивЬИwетх╝Ч~ДНМКЛКЛКИЕАДДГБЖМРЦЮЯбдди┤еабЬСХФУХЧШЪЬЮбЮвкЯЬЪРЩад╖нйЬГЪШУЪео╕╪х√╘╤Э~aCZhПЬ╟{k=8ckККЦКЖЕАбмЮ╕JП┐╧═╓╫╨╠╦╞╞╠║йЬЖЪЬХЮ^hQXwДМЩЭв▒П~БbvЙmutNgzuКк╡╖╥ЛP`RVuШ│кФШw:NJTtЖХЪаuWcYrЖЕж}BcgjЕБд─НtxZb~ГТеек│збааЭРБМУЙй┐▒ппимОЛЦЧРжкп▓║╢╗╨╩╬┬╚┐╚╗╖▓леЪЧЭв▒╕╩╧┌▐ь╤╕│▓вЫЧЫаежн▒║╗╣зЭКГЛГМРИz~БГААЖЛЛПТЩЫдеоноегеЙpS $1QZdluДМРННЦдЫТБЮ╧ю╗ЫЕЙЛНМИККЗЗДДБ~Г~{ЛПСРШЬЯджеввЯСПИНТУСХХФШЬЬЯЪЮоЪТТЛд▓кпжйвДГПФк▒╣╝┼╫зНwcu}ЛКШТПСL1(NpГРИГВГЛИЮСty▒╙═╬╧╫╤╚╞┐╛╚│ЪТННеКГrCRgg}ТаезЧЬВXoorЧА__N\~МТм╫зЮФXGWf~ПРи╒ФАp:7XiВЪиЛМzIVjvеВxxBGjoЖ|аР]gcgЖОФв╜▓│╟╚╝┤й║ЬЗТТХз╣╗░мЬЕД~МЛБДРХХЪги▓п╢╝╗┐┼╞├├├┬╝╖╜├├╘╧╥╠══▓Цzg]^s{ЗФ░м╡╕╞┬┴╢│еиЯбЯТЛ{ВГ|tknox}БЙЩХеввдмокИxA )>Q`~z}{ЙФННДЪ└т┬аМНРОМММИ}АБЕБГВ}ДИКМНХЧЬЭЯбазЬЧСНУХСУРСУФСЙРШгеЩЧНМагн╬┼┐ЮЙБ{АНПМдй║╗ж▒РФШЯЩРФНЭФoa/7[jГВМЖН|pДИУУGЩ╝╔╒╧╨╬╨╚├╗░п▓НМОТжН^cMHj{АРп╣┐ЪttO^Йv|Л_\`d~ШЧЬ┤оys[PhsКгнУЬб_fcK^sЕХзЦco\XzБЩОVb]NpusДni|b`yuГУЦЭн╝╗╡╫┌═дОвИТЭЭдк▒╣│пеЧЩОЩПАГНЙБКТТНУФжв░╝┼╞╩╨╥╓═╘╔┴┼├─╢╗╢еГ[,#LuИЫ╝╝│фгRG=LyУЯ║┘ЭЕu=H`avУЫж├ЖMT_kНМЭАN[WSuМПСз{fcThИКННМЧЧЪЮиЭе╒зf\M^КРЧаз░╜╝╩┼╟╝┴╢│лодЭЭЫРИНЦЫвадйзй╢з╣мдз░╜╙иВI:($#1F^kz~}wmg_XTfЗЩ╞╝╘╬╤╣░вУn_R73$!/;hzСм│├╜╛поЮЭМzrlWO<,&2?rЙПЧЧЩзЮПИnai~ЪnYФv@lЦЮбСРжпидШНЫУЦЩЦКИЖЖНППНЛЙЗККННЙНУЫХУЩиЛИuxx|УИГКФyujL[НОзОКНМКег╛УВrgkmХр▓кК_?`xЛЭж╕╝ж▓║зШОM3=V{╢╖-^ниJdШн▓│┤╗╜┐┐╝╣╕пййжбХЩБ2>VQjЛЭ▓┬иЯМL[{tНЖINPPwМХ╣╨иЧТ@;LQsШм╣тзQP89btДа┤М~Н[Pi~ЬЙofERtcczОРС|GZnnЙЧЦХТХТПЖФХПНУX^rj}СУУЧЭЭ░▒╗╕╛╕┬╞╝╜╛╟▓нп╕ЦСЙБНДЮ▓пЭТtДИЬе┴╨╢вЫ}gfiu|АВБxfV0# 4CwАЭ┴├╚─╟╡еЭЪВpdZNI/4('BBgnв│╩╝╜▓│▓ЩРОЗ{p^\FLQuПШбддзо│▓ЯРЬам}jгН^Ге╕йаЯ░┤╕▓зЯеаЬгЯЪШСДОНХШТСМДИЛЙ}ЙПЦХУЦвТНЗveaHm~}АХБmC=vл┴гХj$VГ│╗ЯСmL9hТ╝├]#PzЖФЮкбо╜│▓╝ТrF PVВЧЫФN>H9]АlssXcV0^ДПХе▒░п╣┬╣иЩЫj_fRsЩЯкгРЩПИДЖВЖГНХРЪЬее░└╚╡│НЙvlЗРЧ╡╜├ЩK !BsЛСЛЗЗЦи╝╣┤─╩│злЭЙn^8$ dlТТ|_5 CnЗ╕Ю}= ;tИ▒╢╒Ь5b|дO$_ln~ВКТРХШЯ┤▓╛┬═НQ,*TСП┴ШgniaИ{Skзп╝╡╗╖╗├╗пзвЩднаЫ▒е_3?:QzЛв╝┴зЭ\,G\КкjRZJcИЩи╬ш┼вX$>CTАШ│фтt>2Ip}ЗБjglRIsНгСzEIfivpeЖМH,NQdКПЮдно▓╡╨ф╧вЛaKnГЕРЫг╖┤омиЯЯбШНКЗКВЛНННЪЭХОpdvvСбЩаи▓═╞УR23[_iЛГf]F3^hWl~АДif}jsБЮ╚З('L/FgmФЬw{w}ОМНУРОХд╣╠┌▓НR "MkУ╝гШГ7E$@sЩ▓ufH;is~yorЦ^<\mЕЙИТ▓елй╡╨чЯЛl:^ЗОЫЬво╔╝├├┬╢║▓плевЪЫРФЗМКsojSvГЖпТЩШЮ▓т▄╧ЩР}ЗМНПЛИdK>(3PgЭЧ╩┴┌┼╔╟╞дСД}l^L>( 9И├├╔├─├╦┴┴╤ъ├╫╚╪┴╧╛╗│пмззежежийийеаСРМЙННННМКЛНКРЩwI=sСЮЧХПЙСНИАvwwyМЗЖНПУЧЬЦдгзжжзк╝┤╧┐╤╣└┤п░н░йвФЗuКУxvdIiЕnkcTgyfWjm~▓Фб~RY_Ж╨НЖwh:3fЙ▐ЯЗ}_a|ВЪЛwЛМНл╣Їу╥j/ @cЧ╩└╒m/RН╣i HО▓▓н▓╕╝╣╢┤▓ЪЩШЪЩк╖ЖjM/\sНЬв╞уЙ4CB`Нtto;LnvБЪ╩▐фФaV&1kС╖╥мЩg-MQhЕШ▓╢d#;I[ГЪиn5F8EntsИГlh^-@gpБАННЦЧвзОWtph~ЗЛСЧЮ▒ол│┴╡│╢╡║╦╖║┤▓леКy_Agt~вИthahwМв╕╣зЩЩк▒╨пгаЦЩБT" /2\uИо▓┘╨╙▒зедЖypdRC,!TР┼╨╨╤┬╛└╞┐╞├╖╣╣┤гкПЫвЩКНЗИМШЬаеегжйЫРЕvrАГВАДДУМEWРУаФРТНЙrOJBAHWdj{z~КНТЧЪНУНППббждйен╢▒╝│╟└┴░дЬЦЯЩРМlLuxstnjsr]hkQyЕЦн{_S@ДЩШ▓ЮБ>!5HЗиЬЬp.?MwШИПЖ^jpЯ╨█╤ДN'1aМЭ│г^?CFБеП;kЩ▓м╕┤│╖┬│оеОСЬЫЩд╢НbF1h}Ш╖┬й┼Ф8.HdвЕi\AGtЛСе╕┼тЦ<<@GlГУ╝хоЗ_VktЙРДЧu%-WjЗЧ▒r'1JWuАsГгsVTAF_sux||ВutЗЙЙФ{MXyАНИЖЗИНПЫШШЬжиенп┬╜╕┼╫╝└Нp_)Yr}Тд|XfE.[ШЙ}v*%VcyФПВО~@G[Wtrpvxz}}yЫАowaX{ДГНЗДГГГЕЕГГЖНРЛШвлЪз║╣бНYcdZwНУ┤├бs;5=]p~КЕДzlhy{ТЭм═┌╬▓кНrHP2&50]fШн├┴║╢║╖о║╡╜зи▒╝├┤╕взеЯЦЦЮбаЫломаЩЕzfoxwГИЛНТХЬЧалЦГbQ[P_gkwxБШh#No`TRzНм╖ЫСБa3 >JgЖЙЙШЧНТНВКИkQh~ГКНПЩажо╕а╣╖╢╕▓╦┘╙ЪН|xСНГВlX{pNQ\]ЬйШУ]?V\Я─╨зkZ<:mК░ШWPGJvЛЯдpopoЖРн╝▀╝Z0[ВдУДuhadzбХL]в╕п▓╣╗─┐╖▓аааТТЭбШЬГ9!E^vз╗╦ь┼tQ4=gxНИI1VrВРк┴я╫Л^81Ytt~ДП║еR;JI^|xК░ХP@GF]МкУr[5"RnzЯ╡ФК|B*VnvИwtwzz||БЪЦi[_gЗРЖДЖЕДВА~zonp{В}ЙПРЙЪЩБwXLn|ЕННЪ╣╦┬вХv{ГМНШПЕk:,#*5YiКЬм┬╛├┤олЦp_E>#!8oв╟╒╨╩┘═╞══╬│╡▒│ЬЧХНФХНВЗНННСв▓нкйаЙ{`\ijmy{ДЕЖКМЛРеЪХСgcK:IKdnuГНЧмЭh@4W~Э╕еийМlC-/bxwМЩФЦЩКИЖsFA_gsАГСУХЬШЙЦжгнл├┌ч─┤╖СЬЮЧХРb`tlX[?QПУлЭVLB_Хй▓кЛ]*.RjТЭЕ{PPjuднЦЩpeM?FLsННПТНАЛТТТЧЮ║╡╟┴╒▓к▓жо┴Чcw}lnQ5YmВ╡Сn_K]yД╝│ВM.PгЩбЖNWZn▓е▓Я``б╓╕╢s!VrТа╕КWTdgЕй╕Q}л░пп┤╖╣┴нЩЧМНФУФм╡tL?&TБОн├┌├ЩL?ZН║tXM@]wЖЬЯ╖▄╤p9HM]sv|ТРoeC"Kpn|РТtjIEkuАдвSI\syF:Н╦k3;>\xЖЖЙ~АxГДДzupE#ZwАХНЕzuВГyv}~~ynhfmsv}zrpVBluwБld^t~ЕНРЦвгей╝╣▓╗╬┤Рt<%  %;G^z│╛╩┬─кЯЩЧРШм╬▐ц╩╚╡нбТгипкл▒лЯЪВГzy|}o\Z@WsИ░жбаФЛojB8=H[hmut{z{sЕХЗЩyVK(ATkЫ╒ы├МhY[awАДНвпд│ЪБiP0 @pАОЦТНЧФВ_MH2]uwДЖМНБМНЖЖЙЖРМЭеззл╜░┴╘╨жКНvx{^ELPyеТМБO\\}╜еyK PsЗЬВliNpЕЫ╩М$SЕо┐╞В<4\~жнВ\`K\}Юлy4Смпп│┤║╣╛пеЦМЙСТЛХпtF;/OБЪ░╤слЩS =gН╧АSJ;dКЕКТРк╤v:TkГ|uЛЯmWF?mz|ЛФrfM@rНКМе^5YrиvJФf435]ЙРЩЮШЦПТУзХlhHB~НМУРИp|ДВ}~ВББА{rrvsxЗg\V?bПЛМg9/%Rox|ААА~БПШ╣Ь┤╚с╦╨бВ^H3 .hПк├╙╬├─╦█┬╨┬├┐неЧЛЕНТЩ▓дм│╦┤░ЪГЕ|z}zui`H7S`}РНнв╢ЪОo81,CPii|uptuwowгГНoPQ_Н─╩╗М|nmnks{АЕЛРв╢ЮгНnO< *YfЙПНЮлУВ|r_^d_fxГОЛЙИДИЙЖВЙПУФЭепо╤╒▐ккЪЖНИiJKQ{УЪ├ЛeZKВ▓УЙW;VmеПЯ{VaoС█М`- *SkЫ╣ювu5 *PПе╝ЛoV8PkЕеЭcNЧ▒▓▓╡╕╖╣└░еЯШНМТЬРЛa"7YfБЩ╕рчЬcY-KУЩЯ|GZdgГИНЦВДk)@lp{БДТЧc.CIPo~ГХЫi;NNMpз║ЖpT7hvЛ├░cbM!=]gЗвм╕─╡мй┴╫тi.C=IuЩ╢жаевЪЬЬЭЦУФОМЙК{АЗxp]F]dkНОЙ|\@24Lmuyyxl_MLZmo~Уе┐╩ф╝▓ЧШeQ9$9Де╨щтф╔╘╞╝╡з░▓жРЙl|ОДtМЛУЮм╕▓пЬЦТДЖuzvnk\_bauuКЙТеЦЧndK(2IZlguwkc;hp~ЪvpnЛл▒пБhejsjis{|АЖЛХСб║Э~dL0 $QГЦЯЯМДГ}pk]B]wДУКЗЗЖЙКГwЗНКИСРЪХанпзо╢ддеСБzpjy|Э╢ОvnxРОНЦa4%*hМи└|SN?ЖмНК[FF3[yн─кШ?CpЬ╖Мt^5HfwЪ╗Г  kен║┬┬╗├╡▒░ХЪЩФМОЦНДc)$R~Ый┬╓∙дOJB\НЬЬs2Hor{yЙЦДv\2=l|~А|Мзp*,JiЕЩЮФйt89Qj~б╦ФjT#/gАС╕фй}P0cwГШ▓╕╨╦╬╟╩╥ьЦ#bmИПЛМХМБ|pRMesГЗЗНЛИИИ}ЗКИЖНМКunАРЪж▓│п╞п▓жгКtxЕвеЧдСОРЛЫзkM& -dЛнмkbI?mwР╕z_A3SyТд┐╕N* 2hОЩУЬ[8KXlТпЧ7z┤│┤┬╩─╝╜▓меОРФРФЭЖ`Z?7\zб╝╨├╛еA9_pдМnpH:l|xz|ГаВJ\XIfГЛЙ}~v2)VhЙп╒аЗz;8ZkЛм├ШGRTA]zДп█оg[B.^wВКЭей╖┤├═╜еР2M\uЗФб┤╗▓╖┴└╝║║╕┐╣║┐┴оЮ|S]]Z~ЗКТППЖИ{zwvsvyxuxmXC!%>FhmНЫ╛╕╨┐▒Цip|й░├╧├╝гЪПu]dyЛЖТпаеСРЕwnlkvzИАЪдмдзжЗГzejfknllormkc]ЖЛжУwj2#JXhlZaW]ucf~СЫоy$=L[mrvputzВОеЭгнШy`G' 4]t|МЬЬНЛГo\ailГЛОИЖЖВЖЗЙЙИЛБYQ_}МШЯеЦ╕м▓├╕иПНИИЫЫмкЬЧПМеТp\1 <_lЙvxДM3NeбЪ}lJK]bГб╩ЦnP#?sФ▓ХSLL;`еФv&{о╝╝║╝╚├╢░ждХКПНСдУbB7?fЕЩ╝╨┬бВG)SЙ╡зfNMGf|zzz|аЦH0ZjtЖЦЭиМpa;,YОм┘└zdF/Z|Ле╥бC%Mfoz|У╩▓Y@FJ^u}АЙСТПРЮпжТm4Ns{}ДОТЯЬЬбкейепо╣╕╔▄╝Ш}H>_oЗЫХЬжЯЭЪФНЛКЗzwyzzwpkdP9:./ !(bЛе╟╫╙╤┴▓▓╛╢║▓░дТИ{O),EMNcИЛЪ╖едЖБzumimul~ПЦб╕╕иЦТooe]ddflmmg_Wm{ЖХЛЩИV< 3W]ah[h[[t~ЙЯД>1VgfnpvpyАЙСЦ▓▓У{k_N4KfxПЭФСТДtkmivxwЖЖЖГЖИИГЗИЙ}^\Xa{ЕОСНЫЩХ╕╢о┤йкОИССлгЮЬНМЪЖЖА7")44LdwЫМAIGWОХНЙbVOXyЧЫХШv 2kЧеПiW3/X{БаЧ4GС▒╗┴─╗╗─╝кимЭБЙХТЬШ^JF?mНЭ╢┘╜БoL0XГз╖hQVQg~z}Гw~Х[,MnВПв║╤▒k\J7\ЕЫ┤█╔gRS?\|СШа▓S@_sБ|Бй╡W1GKhu{|ГИЕАЕвХjhP-Tw|Б}~БАГГЖКОООТЧЬЫо┼╞ЖoP5^sБЧЮЯ┤╛▓козжЯдШКДБ~~usmphd\XR>,L~е╦р╪╨╫└▓ШЫЯе╣оеЙp@(?VdиЮ▓вЧШАxlooim~ЙХ▒и░ЩаН~wY]YR]ckgikjsxwГХ┤ЧЕd%4Afehd`w{~ЪЩm7 8Fclrtoy}ЙКШ▒дНМЖpfK*5JsЖХШЬОГ}}xvogb}ЖЕИЗЙЖЙЖДvshYc|ДНТСПДШжЬ╝▓╛│РПКЫддиаЛРМТ░ВKH0&JbАнИiV@mХШиТk]LYlvСг└АC.bБзШtW$.W`}з╝caд▓├├├╛╗║╝зХж▒ЧУбйХS,H\tШл╛цсАHG>lЩйкm=YtxБ~|ЛС{iP4O|НЩи┬▀сoAWRcЗЬ╢▐рp'J^iЙШХДpLHjotА{Це\#FhxБ|z|АБ}Щеb9JSmЖxuzsnslkmlw~Б~ЕИЕЖЭбlOQErОЕМЩЭ└┐║│╡▓╕┤╜▓зжЮШЕИwostnpm}f_b\C,@pЭ┴▐т├╣ийЛflГЬ╬╩╟еЗi)!MnЗо▒║ЪООДyojoАЖНЛНИДОЕРЖkaFBMH[elrnpl{Оео╢sV@ *V\dgДИ|МзЯШ]"/Xcmsn{|ГКШдХгЯЛЗvZI& 4fЗЧХЮЦЙГГ|seFiКЗЙРЛНКЖЗЖГВ|hau}ЙЭЪХПОСАЩЯо╔пеаШжнл┤кЩШСХоЙt_'5R]АзНАnkГИЮ╢ЧБnSMVpКй╛ЗiC G{еХДh%?ZДзкБ"nе╡╜╛╬╟└╖╗мТТЯЬСЦббж[=`ВЦм╦▌ЄМIABxла▓u8NrВЙЗЗЩж{nP-PУз╜┴▓╬&GjpАРЮл╫.>do~ддshMHГom|ЛЫc>kЩК}t|~}~}Неh1FSrР{pzub\NI?Q_gowwwxptТW%PRjжСyДИНФдЯйдп▓└▓╩═╤┤╣зЭХДАpsfosxu}ЖЖРПРв╨═┌│вШЙВl@AXЖШ╗н╛ЬиИiK# 8Xxме░г░аМ|lrx}}||yfdvО╛О}i?80S]{jrt{{{ЗЩЪгГи[2:M]ПТdpЩкй╛tQ* #9Guktu{ВКМНЦ╢ЮдЛyljH#/lpЖа▒МЗЙГ~x\b~ЕЛЮТПНЕИЖГГГА|БНжаРУМwВОШе╡и┤лп▓░╣┬оеХ~ФпФУk2;MM\ЕнШЭН}ЖЛа┴гШuGJ^mГЦкж╗Z FpЯб╡b&5[ДРжЫb(oЪн├╝╗├╟╗▓▒еФЦЪОФвР}]>oСг╝╔┴Ж2He|мРrgJVzКНТХ╕╞|KRINtТ│╟╨Я|e8CkvxДФД}n7Imryб▓u=MPPylWf}tg\1?gПЫШАhs}}ВЕЛe-Kmm~zmrАaR/7N^fjjih`]JHp\`ljmpyyzx{x~АЗПРМб╣▓жл╜│оЮаСНА{wizИРХм┬о▓░ндЛЛК~kW3Hemu{Я╘еЮlRA2 $2dt}Нз┐ЬЖЗВ{pw{yz^;d|СЪЫЮshH*8Q\inntyyeo[~ЭmS0 /]Яn-wШПЬЪБyA /KXjnwАЕЖНЧУФЪНАБvT>2ZСЭММУЛЕЕtoАГОбУТОКБ|ГДГВГ}jСзЯФЗklЛФЪвЩемй▓░░╣▓░еРДЪСЦбpML>PgИСЫжПЕИМЭбЭШva\YhuЕЦ┤з^E)\БеЯY@1?e~Пнw JЛЪЬ╢─├╛╗╝╡огЪЩХФЩеЛs[0:pБНШжзйz,7lР┤ТjRAT{Ржо╖╢▀ШIES[nАШ╔┘ЮtT4Fmz{ЗК}n_0>kwtР└Е>;O_eGM[ebQ/EkwМПЫЬБgvБ}|Гk5B{А|xicl`@& >N^]^a_NNE8eL3'P`flnoa_XX\kjno}НПНУд│о┤│├йдОИzГЦЪЯ▓╝░бХОБt~}wiZ. (*-JjЛЦЪйФЭvX@-'@SiЙХЪМйПГ|v|yukXl{~НЫЯЭФЧZB&!B_kuxygSMMКЧПСK% /cФj]ЭРКРЛЬЫfC&Pen{БЖЕЗЛЖЦжЧНГo`[5 R{КЬбОЖ}ЖВ}ВТОТЭО~}ВБАБГВp~ЫнФНwc}бЮЫЦМЪХдно╕╗├║▒ЫНОНЭиvcZL`uБОЯкНИМАППЧвБyc]cnТдЭДn!GАЮнxT$5eoЛйОFШмЯд╖┐╚╜╝║▓йЩКХХЪмП^YNAfА~ПбТДuE5pЮ╛Ы]XVSzЫе╩▐┼мЯLBafapГз╧гVWMJfy{ПгА[e[?_lmВеОBA`[a_5=PRNYWIeleБНаеЖpРyeiYQ{МxvsaZS1 !:O_]Y[^E(CH7eh.$J`lhdV=2#&9;HNZdjrs}НТжо╝╛дЛПОСзавомеУЗpa^kunoj_2*$ /3ZoМУн│ШСfT=3C]MejСЦОЪИА{knss{}ДНИЪШлЭyh*PozИЛБtsfБЭн┼ЯhQ3NtЭВ(o▓▓УМХе╝лМf& #CjvЖНИЙЛЕЗдоШМГywhJ- :XsНжЯНЖЕЗЖz~ЕКМЧЛЗГГДВ}БВГБОеФНЕifПЯджУНКНЮЭл▒╝╟┴╕ЬШЙВдЪБ|l`kvБЙРГЕПЖМНРббОАlegrАМЮЬаx0FwжеБY=TkЗ░Н>@uФдбй░╗╦╛╡╖▒бИМЯЫдШ\GTZgtuЩО|eNHkг├и\G\nАЬ╣╩щ▌л{E8bwshpЕ╖еR:Rct{{ИнШ]Q^YV]QdУМJ4em`J&NPINXaujGGpПееЙШРjXV^ЖРrkiT=$ 2JX^`QR]P%)QZab3@[niaM-  $09HQVeuНСШеДБПФбеЬЬвл▓ШМhGAF^`ipsj``JA%?WoН│╗▓иСИgR@>5;#*=`ИУимСБlgldlwЗЗ}ЖЦЩ▓░▒КE9/XВУаежмвЮЧо╣╧╚лПГГЮ╕│kkЫ╬╩мЪй│╩╚┐│ЧXRHOHV_~МЧШШЩШЦУОЦоаЪЩМГБl_L)"EoРЫФКТЗЕБГЕЕИФНМЗБ}ВГЖЖИНРРОН~]mЫд▒╡ЭРЖИИЛХг╝─┐╜зЧГЪОПУwltxmSazОЯФИКМвЪТЦwiiy~КУЫгЗO< >rХЬТu&*=eРбЪm JguЛФЮп▒╢┬╡ожйЧВЧжвПXBSckvtuНХfd[Q|Тед^>ZtОШк▄√▌Ъ~M-[zxuttИЭX2LewВВБШЮYInZ9A:<_БP1]nWBGXBG]_izIlдоаСЬЦc\_YtСЖuph`E !9QggeXHFO7&ZdZc2%HejlR?! !F`vk|sММРЬРКДТм┼╕аГTK-3IH\SmivnfYE8*8]uШВндкЩВw\XJ9$)A_ГЮ╣мЧЕmcW]xОНИЛвЭ▓═▄╙Ъ|wxШдл╕╛┐╣┤й║╗└┤┐жлв▓╛╨где╩╡мдм╢╛▓╜┐╒ЭФПХПЙПТак░жждйклФгеепаТМВz|eC0eЛМШОЖДДАzkrФНЛЙБВДГДДДЖЛОНННtfСбй╩─еРЖynzНЦ░й─╕кЭАЖРСиХ{}|b19eВлдНЖАКЭЬзЪumpv|ВКЦиЙ|H ?[КЮ╖p2oИУмЮV|t|ЖНа╣░мнйбНРПЧбгНL*RmoptuОЯcbB1Worh[& `╡╜п╣йV1]vsywywridJ7M[fprlX@30._НbL3)CWnoe:"/OWRr{КШДБ|wshВЭ╝╓┐иП}f;F47$8GNmlodcXG;!)5C7]zМеЬаО}teQ<<>`ЖЯ╢▓бФ{nhПепл│└└└╥▌╙╜жжЩйбеи▓жиЭФЫеЪЦЩЦЩЪЬЬвШСТСНМИЙЦНЖЛЩждСЫЭзФЬЫлд▒кик░▓└▓енн╣│нЮШНИБpW. KfzРНБГБ~}peVt|}~z}БАББ|zЗММНРКБРЭЯ▓с╞еЭ~hf}~ЛГУ│▓│аЖПКСеУЙГmF)NrНзЮНАyИТЭкФxxpozББЙТЖЗV&IxЪйp0*`}ЙпЭ2^ОРЕl{ЙЯ╢╢егЫУЖАСзЦРVGrrptsЖ┤p0LiК│ЮИSJrЕЭМН▓╨ЖOJB\w}}ИИu{V#S|wv}{zХf0WЛKN[[`Йw@&%1V\@Ktuzzokd@Bv╞┐Мj0CuАВД~wzВГАБ||tuuvtwЖМPE]bНРwn`Vagjv|iN= "4QfvЫТДz]C&$!,5GScyКТЬ┤о╣п╣~mV7-9NW`iБk^JKC*%-2lПп╢л░ЫБДКЕЙе╞╚║╫ї┐║╗╩┴││░пЫШТРЖОНД`gЕТ╕кЗm3&";_oДГВГЕxntz|i72ATdnОЗ|yoКкЪwhllpwЛНККОЭзйез╕з╗╣┴┤гsN" 1Sv~А}АЖЖГ}xnkm_cxАЖГАГАБДЖКНРХЬЧХФЬ░╝─╨ОMj}zАЗИХЦбгбдЦУЫШХЧЛ|dgpxОЦПМЖ{wЧеЭУЖАz~АЖЯЬk_?7kЭ▒АSPeЗжкi  Ю╨v$0WЕл└ШK5NnЙвиЩПНОСЭКz_AAl{wywy~lBGyе║ЦyjNWЕИzА~Н┤ИHHeuАyzКзЖXNJYuД|БСДiaR[nN HWVYXh~Иu_TQ_XKXn}{|xvyxutБЩдk.AuНМРТНЖЙСПЛОПООНЙСЛv{].^s}НИ}zuuwvzvpf^LB54,,"-@IZ}ИЭУГ[E2-BQ^{ГРЪ╣╟├л╕БuJ0 /I^l_tmmSG1*KЪ▓╛╚╢ез░╗о┴╩╧║╩╟▓▒▓▒бигЬНtVShiy}yV8\Э╚аv/$J]ovzz}}mАРРЗA8TpУАrtВе▒o5)!/ISR[el{ЗЖОШдЯ▒╛╝╨╟┬ТzLLe{ЙОК}НЦК||{vsrw}БЗЖГБЖЕЕГЗЛОПХЩЦЧЩЧе┤╧╬ДwАzЛЮУНЗБЧШд╝ЭТЫЪЮвСzsuszНТННЖ{u{ЦгЦаМ~ВБББЕХКГАGHtРЭМu#GaДОТ}Я■├R"KgyКг╕Юh_ckИХЪЧСЦЭЧЛb^MJfz~ИФwdgRJoе╩ЬejmcpЕ}zАЙХМKJglrxxЙЭГAK`^o|}ЗУ[bcYdd'#XVFZehsВГГЕm\^O\АГЕКМЙtuГХвuetTBrМХЬкдгЬаааЪЯелагл┤БWV1.^}ЙНРРОНМЛГДВВ~xyke`\SQSE<32-KZaВРЕВnT"  8F[hТйм╛║оЬhQ,43Zlrnh]KI\~Э╕╩╙╩├╡╝┐▓║┤╢гзНФХЪвЬддйПb2 ,?n~~gEIfbе╖СPC]fn|ЖБХгЩЩl! 5eulnzЩ▓Д= ,9Slp{ДКНЦеУ│▒╕дбвТРЧЮЭСШЮЦЖ~Вz}ВБДДЖЗЗЖЗЖЕ~ГДЖНРСОФЧПМЯ░╟├ЮРБЕавУОЖИЛПмеЧЫЬЯжЭНИГsuБПМОРЗ~wФТЬЯЖАББГААДКДТЖJGZbКбаr(WvzЪб-Ш№┴T#\ДГККЦжзФГ{|МСЦФХи▒К^HHVl}БПлХjSRTpЮ╙▒cPlxy~}}}ВЩГM?iscfj|гНG.Zsxz{ЙдКRMdmkkT`w}ВАА|АНd:`kamzuX='TДZ!Jf]^VTgvВ~c\VVMMVllСАгР╣Ш╟╒▐╕┐yXN3Y~УеЭТОБЕyxs{a^KA8/  ;MjЙк╜├окЩХЬ│├┘╧╤лЫyywxxx}wsvИмТЛКФдЮг░╣┴╚╪▀┌сїс┌рїщЎЇїїїюыё√фс▄№√ъОSMESiТ╝╩╢Т}КХЬ║╞╪zS2 "?ZЩалз┤]/ !BdХЗИАВЩ╡БII[rЙКМХЫе╗┤╠├┘░вЮОРУМЗОПСгЦМДБГГБКОХТУЧЧФЩй┼╩╤░дЧУЭ▒КYX`lДНСЭнм╠╜╢ЮvvЛМГЛЪЛД|}ИЛЛНЦЙzВБА~vyААЕШЖuДДЮ╝Г\#Ne|Ы░w лвM, hТз║└░дгЭФБМСЧЧЦРЗИТУf:uЛЧ╕╤┼░|2GtГНПЗp=Lt}||Рй^d^RJ,BN_`IGk}tБУ}teGMtЙЙЪ╝Ъj2F|ГХГ░щчЗ#7bS23*SgstvmГаЖ;Ehs~Н▓╠О&JbddM CO4PИb;77Tad_L# -3*=@w│жАi9TgfМТаойЭХХЬРНИВ~wph^bPR91" GuЪ║├┴╩╫╣┐п╡▓ймГN2Ned|mlml}ГМПй╟╢╛├╩╩╧╒┘▄счхчъёяЄёЄёїЎёЇЎ√Ёї■■№ъп╗ФnkП▒═╖|X`w~На╗йТО:IpДЫ╢еlK0Rpnv}ВЭвi3?G]u|ДЙНХМбм╗┼з│бЦЬЬЦНЗzЦ▒ХЛА~|yЗПШФФУХХХЖР╢╨╖оЬТЧаЮe`[zНМВУЮп╞╛┤ЫВННБ{ЖЙДГБwuГГЖФЕААzunux~ЖЙЗДЗИЛажВY?]АНТЙ' лб@ !_Р║╜╝║йзаЭФЖЕСЮЩЫК|БРg)2lРЯ▒╒╗гp)=sЛОИМmCMv|yvyМеИ``_WM%KY]^VVkvyЙНГu]9OyКЧгдЫЙjF?^jp}▓хС27hW7 !F^ghdhЖtENyt\tТ┴уР$>e^Y@! ;E4LКxI83Fd]Z># 3bj];LmxЖВМН▒а▓б╣┐╝аЦУОЙВАurkjdWWEB*"F~л├╩╨╨╗╕зЪЭЫз╕}%-FVofmg_БЧе══┐├┼╦╧╥╒┘▐тршъюяЁЇЄЁЄЄёьЄЎїюЄЁїьёЎ∙╪ПdМз┘╘x$(?YpБЯе▒╕ЫL-4QlХлЯЗy& :YiЗ}ОП]J8#GfoБВБЕДСЯХб░в░еваЦЙНЮОДЙВ}r}РжЦРКЛППgTЭ╩╞┴йвЩМЫвЕwpwЗОВ{МТк╡╝╔ЮУСЕz{~БГМ|ds|p_ЖЮК}xtoxz|yАКЛРНИЧСДp!9aДЖЫЭEЮа$&0hОк─╞╜▒леаЮХЙЛШааХАxyo=5fНз╝╤┐Фo=5jСЪЙ{sVNrД}wzНеОV_w]C*)b`YbkfoxВЪ▓И_bSJxПв╕┘Яvt^PO?'J^|бШKP`ikПе┴╙╩╞╚╟╦╨╘╪▌тхцёЁюЄїЇїЇЇёЄЁ∙ЎїЄЁё№Ёё№■ЁдlМмш╫К1(,QtГНа│╛ШpO 7`РЯЮгs5 (Ci{nrЛЖhW*;Sm~~}ubityЖШЪееж└меХНИБНРГrvОеШУЙМПИZSЯ╬╪╚┤ндХМЫУНФГЕКЗАОПТем├║ЯЩПДyoyГМЖsntf[{ЭдД|{nx|}xrАКУбННФУЬp)fОНамV оо(JmУл│╜╛╖нкжвЯЦУХЬееН|ziG;dЖв┬╫╛СmLBgНЬРБoZ[sВД|xК┤Ю_Jn{[1*n|c]lxБЗОЮ═░fMS\oИЦ│╫╒Нf^[b; 4]НБS=de,)?LSZ`biaSQnwi\WnХ╣╥▒pOX]H& !05FT\kjK5O\acN*-'4`oМХvX@(*FRsuКЦб┐н╡мнЫФМЕ~zwnngs]LK7($;]vШ╣╔╤╦зЦМ\=2>QhЕЪ─╔зxH  ,gНз╗╦╟╚╦╔╚╦╦╓█▐тцъїЁЁёїЎЎїїїЄЁ∙ЎЎїїЇ■їЄЄ■№▓oИн█╔ШoHS2*S_oВЪ▓▓зЬp#ZzЛдгГXA-YmgРИxi%)FnypYS[^lДНЫд┬▓л░ЩУЛШЭСvtРЩХЧНХСЖh~з╨┌─╕▓ппПВРХагК|ЙПХаОНЦе╕╕гЭНБszБВМПxld_oКеЮМ|npy~~szДНддЪУУЧбБ* $lЛГПнi б╨;GtКШко▓▓│ойжвЭЩЯЬЯ▓╕НymTAdГМм╟├ГpYGcКЫЦttk^sЖ}АА}Ю▓gKfygVTd_V-  "/BOsЯКuV4! .=MlЬЬнпеЭТСМЗtz{~А|yzЖЩ░╝╨╩║ЖX2#ApТ┼╦╩ХzRo╢х╠├┴├├╩╦╬╨╫█рхшшыяяЁёїЎЎ∙∙ЎїїёЄЁёёЄЄЄї№№┬urЬлпел╤▄╥Ц^X19Wk|С┤┼жwh?=АЮйЬРY$.N}СУЫЭl)'#HfzkRT]]\uБЖНСОЫЮз╟нжеЩЫЩЦДRGmТОМТФд╡╡еХЬм╜жДВЕЧнЭ}ВНЩндКЙЖРЦХЬаРКВЗВЗЛБn_IVrОаПАzljw|~}rotМжШЦЪСгпv) Wm}Я┐u к═5"fВШЪЩФЭз▓нкзжгЯХИЦФЬвЙyZBdВ~~НЮ|WTZrДд╕X_py}~~}}Кгk0V{~}}uБкs*GtМСз╤ф∙Г$>jbLCEuХБphb]R/ 1Y|ЩgCXo@,@MeL3:J]m_ThzE JБЯ╩═Н7 4=>Z~jZOAVd]P3  !)7JSlаЕm># '5Kv~│б┬╣▒ШРПЕИКЦЭЮе▓═▓пзвЖ`. (Hkйб├║╩u;0MМ└═╣╝╝┴╝╟╚╬╚╫▀ухчщыЁясяЄЇЎ∙√∙ЎЇёючэЁяьЄ√№■╜tЖНВебй▐■■Ў▓Ъm2;7QrН╝ойддH 2uБЮп═x@B|~ОжйlX(A\ЗnbaMVny~ЕКОМПУЬке╗жмоЫr"4JАОМНЛПЫкЦe{Хк╤жКГЗЪ╛Цy|АЮ╔вН~uЙНЦ┬йХТНxДМАt]@WrЗСКЛz\avz~{}z}ЛПХнЩНЯ╗n=_uЕШеz ▒┐JfРйгааЭвем░йжзвЯЪОСЩжИdcbez|mЗе|R\sxИг┐НVbw{||}БЕЖЖrHMzИЙПЪРРsEIrЕЬУо╨╩РEGdfIAQnбЗmos`E7'Arv}u^X_P$)NTTF%=S[bhik|V $Nuв╒∙Т&zСЧабЬбон╝нвйЬНx{{wxaR2';YwЦ▓╠═║п╝╛└└╞╞╩╬╒╫╫╒шцххэюЁЄЇЎїЇЎїЎїЎїЎЇёЁяюъы№№╨╗Ф2@П╨эЎ√∙√ЇчнНR'7;pУЬм╜ЮsX2^ажаЫЕ7.JsжгТПЕ3 IkkvbblsyДУЭДi\amВСФ░┤ввТбШРМАxИОРОАrУд╦├ЦpxГЬдПТЖАвмЦФНЖxЪЧЯ╕ЬОМДОГБ~V4VnwЙУЧo_afwВВДАДЖНаоФОЮЩ~^TgНХеЭ. ╢╤b PБЯ╛╝зеееддеебввиЭХКПД\]gm|Г{yПЕROkx|Н╖Эcbv{|y{БЙБ{SFtЩд╢▌└ФНjSexwojzНЕNIsrRNQhПКnmpmL@2NАuth]RN??Z]]O%'K[egmsБЖnVA033JTFiО└┌╗ГNKYSTВТ|njmxnnwsmh_hY[MRPWX^WT.8HGjЙЛЕnY> 0b~КдиЭЬХФЩНУлЬЛ{x~x{nkgRC @~├ц╙╖╡╝┐└┐├┼╩╩╨╒╒╫ххххъьюЁёЁЁяэъььээыъъццху▐цф├╖Х39Н╛▐щщ▀фсЎш╜ЩP9-EzУвз╣еНa$  WvЛ▒▓ГE! 1hПФЪ│Б* 3Ro}hflr|ИУЙlSF:_~ГНЯШеомзШЙtИМММК|ЖСЧй░ЫИММСбЩЦМВТбЧХЬН~pБПЩйШФЬКАЖЕЕuI9QfwЕЩНn_^iwВЖАББКгаСХЫЛЙR @sННег0╢∙t EВХз┐╗изедЯгеЮШРЛаЯЭЭДYJapx}|НК[He|}ЖабdSvД}up|ЙКrYSnЦ░─у╪аw^grpoi^ayuQBgv`EWjНТwhkoT9:OxЖwicc`N?E\mfcS@Vcfgppsz}phc\]_eaFZЖ╕╥═КWTVdВРЕpnfhlicidefljgcb\_nx}z`F[p~|xmh\H')" !IgrН╡пеiehoЕЭЯФЭДДzztpwkhZK>w╓ъ╛│╖╗╝╛└┬╞╚╩╧╥╒┌ссттцщььыьъчутр▀▀с▀▌▌┘┘┘╓╥╧═╕нбX (kг╛╦╘╩╠╬═тф╤╞вj\LiФгжм▓ЭЪ~<5ZНижЙ]@ #`{З░▓ЖB$"Pmriimt{ЕНЕ]@#*ZoyМЙМеЯгжХСБИЛИЙИИРТЪЬЯгабФСЦФТХСООУЫЫДnwЙМЗПЧЯЯВЛКВЙ~H/F_rКХЙjg\Xj}ИМ}vgЕЪЩУЪМРЗX>xЛЕЩе@dЙЩЧаи╦Ў╣!8ТЬ▒┐╡лзегЮадЧМ{vЕб╕ЭbG^pux|БМНbKex{ВЦаpPjГБ{kpЛМzweRjР▒╙ы┘ХxYPp|lfaZhw^K`naNMlНЧwlsnWFAMАИihg`abVEXhmnmgzuifwrlrtwsoolghgdKVК┐█╗hT]\rТИyjg\T?H;H9F@M@IAK>\vyko;G[jАslkhkrrh`VTLG;;-* (=PfАЭмЛЖ?*!2@alЗЗЪИМРДГwtruzlfO;* Нш╫▒▒╕╝╣╛╛├╟╟╬╘╙╪╪▌▌▐▌тхххцхт▐▄╫╓╘╓╨╨╙╧╧╬╦╩╔┼─╜неСfxЭ╡╜║╝╛┴├├╧├╩╤╧йХ}zЭл▓л╢зп╠УL  %FГШйОЕSRaС▒╣|\05gwhihs|ЕФz\>QlИЛzЗОРкЬбЮПОЗКЕЕМОПФЧЮздиЮСПТЧввКЗСХЯТxuЕГ|ИСЧеЧПНИОЬo40?[tЖЧДv`FVrАС{R!YКайаТРЯаQ=wГyЭ┼EЖ╕╚╟╦╨ю■╘E%~ЬШб║╖пдееаЮЩТНГmnvж╜yJZtz{z~РЦdFgА}|ЦгtWjБББtkИЧАjijvНЯ╥ьчЦcWRkxo__fih`T`ncPQZБеydz|b=E]АгzYbkhefc_nnruxМЫsbw}fahkklnvja`_`NXЧ╫╞wC\pop{vi_M;     8aWQ<#V~i_SQMWP\Zkepkpkjbj__LK<31*! '7@PZfСЯУСhC,/EQapДЮННК}}uwtrt^YC,  Y┴┌╔┤╣┐┐┴─├╚╟╩╬┘╫┌┌▄▌▌▌▀ррт▄с█╓╙╬╩╩╬┼┼├├├┬╝└╕╡╡╛нзбгЮге┤оккмн▓нп▓┐┤╝йгЬйп╝╖╟▒о╒цЩkV>7#EzХФФЯa$/VТ▓ЮЗvB,lkconryИН|m=Q{УЗ~ДАНФЪкеЩЩЛГВМКОСТШЭабаЪКОФЬ│бПОСЦбТ|АЗА~КМРЮЪФЦЛЕИn?;4ImОЩЖu`BT|Нm$vЬ▓еФХЬгЬPC~За║IЩ╩╬╞┐═тїїivЭлЮлкквТЯвЮФЖДИАo{Еж|W\sx{{tЖлxH]~ГДЛкTkЖАГВyКЭБjfiГНПй╓▐Хm`Wo{le`\gvdTafe^V_rРАboНnMHX~еКk^]knjknkowuuР╡ГcpО^MABER^kmjTC:OFMЪ┌АJVmuupjg_N) 2CA0SЭy\:#!"((1FATMjcsh~wВotks[WE;."!1NPXivЛ▒Д}@$ )B_gv}йКХМ{xnopn}ZQ89з┴╛╝╖║┐├╟╟─╟╞╦╩╪┘┌▐┌┘┘╪╪┌╒█╓ф╠╞├┐┤╣║╕п▓║▒йл╢йЯЯожаФНЛЖРЪЮбМШХаОЭЫбСзпибйклзй░к╚╨▐п╟ХРol\C1gНЖАг┐e; %TЯХак░F&R_}ylsБГТМu1:pЗРЕЗБxЗМШ╝езЩИКНЖИОТППСЬЭаЪЦТНЮ╡ЫТРНХгР}ЕГ~ДРжЪжФ}ИЭtY4GНЫМАZ8_ГOiКЦЪХеЬРд▓MJО{xЯ╜P Й╟╬╧╦╒╘┴╘Ш'iХжаЮвваЩТЮгаЙi~ЗАj|КzN[rxw~|{Г}\_xБГМЯИ[fЗГpБМж┐ЗN`vyЖИГв╬ФParn|hKXdachfbeeaR\pВ|pmuw\PV|лНhelkolfinee_eВеФnnЖY 9Zfo`8#MuГДЖДБГД}ЦХЭйЦФФЖМССРБoЛЬЬвЮЩКВЬЯЧРИЗТбМ}}|uИРПШзСЛПТtT.FoЙКtgSIbT.F\w~ДМПЩдЩСиЮH  ?mt~Эк] г╥╨┼╨┼с╛Н|_:zлнЭН|ВМСТСЯЮДБЫиФСЪyTRtКБ~А|seltВБЖЫРi`zОФЪб▓┘╩pRlzm^^uЩСmh|xvjL2@\`^eijknpgeЕДprААxnerФЬБkpsnswhF$]БxszП|[QFLZrЖЭ░╣деЧПoЖ|NPpИТПОз╔▓ни▓ейежгдЪее│╨┌оhI!&dЖУЫ╕╜╤░гЙЗx}knWREA(#>psWZYWГzuВ|pДpfXG# 3Y}МРНДМ{dlГ▒╟┘─├╩┼╩╞├╩└┐▓╢нмаХн╡│к┐╩═╨═╓┘▄рышёыяэЁьэяїЄЇїїЎ■№ Ёпp%7y▓╙хьЄюяёёёЁььщъщчш°№■╝->}вФНЗМОТЕtyВУЬЯв│┼┌╥▓Ц_G,%8▓╖Ыp>Ecisy}ДКИЖИЕБВВГДГДЗКЕМИНеЪЫ╢еНwn{ОЧдмеЭЦmЖССУИБССЙБuxБw{~ГТЫЮЬОАyb.E^hЕзМX@:Ln}ДЖА~|ЙЫдаооЙ@ KuuДЯ╕А ZЛuL45RЖ╛жТratЕОХвлЪ|ДЦФУидdPrДБАГzxn_uВВЖМб|SnОТЭи╜с╤xRexpd[dРбs`{АvkH4?KVajjgknstxДЩxm}Гsn`kЙгКuponoojL. QtovwГЗФРТОШм▓╖╖╝з┤╣╝ХТSWWSdrlemlm~ЩШ|r}ВubPRoРИzutrltuiCC5?FsСrnw}ВЕг└╜╕жнжкКЗjnjЬ▓ЛY2[ГДЙп╖zP2 Fwd@IPez\F>?ACIWXflАГжФЬЯ┬н▓кеЩЮЙВeXVMMI@OVKoЬuN' ,BOtvzsucVC0' ;g~Уело╕╟═█┐╡│▓▒паРЮЫд┤┤╗┴╦╩╧╒▐▐рш∙ьюЄЄїїїїїїЎїЇЇЄїЎЎ√∙∙Ў№■╒И~веел╡╩ыщщяїїЎїЎЄЇЄЇЄёЇ√∙■■№Й$NuЧмзХxM *@SatzЖЯйд╖ЭбЗra3" 5tЦгбЭR!JzwlzГДЕЖФЛАwmglvw~ГЕИp~ВХиХРОАИЛУУб╖┤аИvЗППОБyБЕДБВng\]Z_w}ДКФУЖЛНe-%2PxШЯz`E)Ajypc[o}КевЦ╡пv4BnАКЫ▓s ^н╧s=HewНЛБwXS`tХзеЬЭШИБЪ░ИRc|z{|||m_pАБГЗФ~YtТЯгв╗▐ЇОO[wre]`~Э|]nzwi10MZ`dlmmmtphУ╕ГdyЖАlB.PkvspzyzБДГtuАЙНЪ├ПrsvuББл▒╠зЬЖБ_J*cХg3Wx{ЖН├─k!79NQdС]3 !%.4?KOlrНЗ╝а╩к├▓╟└╣t{XGOOoбнw4/NRulИ|Бc[E9, 5fЙа├ф═╪╕┤╖пЯУаЦзЯкопп┐╞╟╬╙╒┌▐тхшщъчёёїЇЄыЇЄЄЇЄЁёяёяЇЎЎЎёЁ■шПsбпп▒╢╚┌рцюёЇЇЎїэЇЁЇЄЄюїЁэ■■№Й"Ji│╡вЙp3.:BT}ЖФЬЪе╩▓═Иy[4"YzЛСл╕QInl{Д}{yДбНiB7HdtvБЕЕАzyНПУйЩЩХЗКОд╣╖йУzИСНМВuzАГЦy\VTLQen|}ЛйЦГНЦe'$$NyНдБh?Fgi^iz}yМЪФн╖еpG WtЗЖИпЫvо┤};Vu|МРЩ|canzЙЧййбЮЬТИТоНfkВДАГЛАx}ysxГИРЖmtО▒╚бШн╥ЫPcГziWWvгД`nАwc8#N\^ismnsrxyЛ╡НerБrL5amrol}ИСЦЪаЩек╫╫╨бupSCIXmxРГpW@ ZdXaБsYyМ╦шl -*I|lnV* $#?@`k~Щ╤ьХZX?\ntЪ┐╬ЬL! .7NddsrxkmJ8!  >fТ╞├▀╥╟╖УадеТЯмо╢▓┴╛├├╨╬╬╙█┘▌рхчящшя∙ЎЁёЁыёЇЄЎЇёёяёЄЎЎЎЎЇю■хРsвмей║╦▄ущЁёёЇїїЁЇёЇїЇЇ∙ёьЁ№■ЎК.&]ЬбЮаН5=f{ЖМЙШТЬЪЩм|g]uКФЦЬнХX0 @]mД|y{}Рдk!B]bgpuvnmkuН░Фegyzw^32JjtywzМз╝▓├▒║к╛шю│ЗГI/H`veQ.;TObЙГbWpЙ╠ы{ 9;;@nАwK#  5Qx┤ЮgZOWwvОЬ╦▄█ЩДR>* '0Fdi~}widC1# /Khзй╩╟╝╕▓▓ЯПЬжлз░╖╝└┴╟┼┼╚╤╧╤╨┘╪▄рушшшщыёюююыуяёёЄЄЁёьёЄЇЁїїяы■∙аnЫйЮб╢╩█тщЁЁёЁЁЄЄЄїёїЇїЎЇёыЄ№■ыИ= OЖР│└ЪA 4ftХРКrЗМвзТгЦЬеогЮбХk=.\nД~w{ШЦ>As|ЛКБДЖИЕЗКАДЪФб└дЬЦШ▓╖╗┴ЯКСРПИyojxОбoNN^[]gryАРЦМПЬЧlS,OwОСВs<$EapАЖЙwНС│╬НVOA#SmММЪ╟Л!wйСЙT:^БМЛЕ}sxАЛЧнодбЯСИПйЮsf|Й}ДЕЖА|{ГЕЗГЙПprТУТУdlЖДunwymbRgОДfpЙВkM$.Q^`fksvmdVTnРТecvyxpWK_gspuНа╞╢даТП|м╪╚НБО\,MhaE*/NR[oБydKjЖ╩їЖ -?.Q|~^I .K_xT_rbe]=YhЕШ╕╣пгД~b^1&/MT`lug_[G.@PzМи┐╛нЦВАа│егз▓│╢╗┐┐╛├╩╟┼╩═╬╧╨╒╓╫▌т▀┌рухчщщыътъьщяЁЁюэЁЁЁхьЁьъ■№лwЫеЮЬй╟▌уьяЇюыяїЄїїЇЄїїёёЁэшя■ ▌Н8GcН╝╞СT# .N|ЦУВt{ЗЗЧНЬТШе░╡вЬжЧyG &Pk~pv}Щy- &9yНi7 :>JQGIw{lO! !*LcАЖЪЬЫвдЫtrH2%GZhrБje^YoЛдо╖╕ЩТfE:eй╞┤▓╖╝╖║╗┬┐╝╝╩├┼├╩╬╧╨╤╧╒╫█╘╤┘▐▀тртцх▐цъчььяЁЁяЁьшхЁьщ№№╢wУгдЮж─█рыюёЁъЁїЎЎїЇёЁёЁяЁыъч№№■█Й7(NЖ╝╖НbB IxХНЛЕИАytoxДРд▓оак▓пН[?g{rlrСw.5ey}{zВЗДГ~yvЕЕПЬЬЬгШЭ╝├╟╝СЗ~ИКЖ_Tc}ЛВe^W?1Pblr}ЕЙФййЛoT*%KpНМ~k8%=\s~zy}ЕКЭ╩╞8 SЕЦОпcSЬ┤ЙwfG3FkxЗОКЛСЛМЩеЬЩЪФЖДЩЮ}czД}|МКuz|ИИИМПНАwwАxL7]url}ИwcPZyЙxuБ~wi_ЕПjhy{kR5]В_HhГЙЛЭЭггЛЕxltzu|F34yССИН{-!AWeF&(XWZ{Йk_caS]Н╘ ├)M>4bМf@ !HY;NOJmДZJ%AJlkЦЯ╛╡╜ЭГhJ58Z}ТОТЭЪе░╞к│ЩrE"j╩т╜╖╜└╣╗╗┼╜╗╣├┬╦├╨╬═╬╬╩╒╪█╬╨╒┌▌р█▀фу┌тчщъюэЁЁёЁяюшЁЁы√ ┴yМдиеж╝╪уыьяяёЄЇїЎїЄЁёЁЁЁЁЁяяїю√■сН&;ЗжпЪРQ8xРШСХЛpVLC\iЖЦбЬй╣═╟п]3kwsspЛвm94^vy{}ДАБГ}|АВГЖСЧдЬЦп╜╠╒║ЬЖООТzXH_oМz_YI4;Tcnv~ЕНж╡ЬТ|R#&SoНЛ`1*>[ttzГБИ┼х249"WЙИxЧ╨bu├п{lmb>3Ws~ЛНОЦгРzЛТЦУХШКВФеВixМЕ|МЯЗx~ГИЛБИЪХЖА}xseJ7TpswГКzkMSvЕwrГЙАz||Ь▒sXrНДyS(sЖб╢╟╗o' ,Yf]hЬ┬RЧ╤╛ЖQ[t\:?kЗНТЫзовОЪаxeКЫКБИТЖrzЙ}oВЩМДБКАkzЖДЙГv{Бye=2bpuzК~iI)L}ДyxАБvgi|гПjs}{reGAKNx^BZnyТzcbxгзИvujK! @hРигЬp'EV[B#GRP^xlh^>#"<;F{е╨╟v?*5BVHCMWdГП|lj_[SVJTQWMJ>LFB4=2-(*)5JfWIJ5CМЕF /&22jУ╜┼ЪЖБvВв▒▒б}Z 1J\vdbИ─╟╢╕╗╝║╝╝└└┐└╛┐╩└├╞╞┼┼╜╦╨╩╠▐▐▌█р▄хээыычьэьЁьцёюяЁьъЁЁэщё√┴ШбОnКШй╥ЄчъяЁяЁёЁЇЎячюЁёЇїэёюьэьщэЁ№√╒в@ 9mм▓ЮuZHwжойЗ`(GfnГЪЧадm^RZu{~yvxНЪW Ia^eyГ|z{}}}}}nwАЛзо░└╧╛йеНwadHBJXE:C;O^ku}ЗАДИИКЪО^H`jO;ZFMФЕRОН▒хЭ",JMKgп╟EЫ┘╜КOSrhGGhДМЩз░┴░ЬРШЦyxЪХz}ЗН}|ОЙsxЧХ|xЗПЛДаЩРЙ}x{zhC*^ms{ЕКrT-HxАw|Н}oaXmФЩynД|zpd|ВЖuIJ{sl\&$-eРЧГoiQ4`ЪзЬv1@VVJ&5SR\rЖvnld\JN\VOoПд╖КdZkАa=K^dsААlgkjfmihedji_a`b]\Z]X^TY\i\4IVLЮv> %lb:Tg3 7nФ▒ТЫеЛИЩг▓┤<8Jp┐х╞┤╛╛┐╣╜╜╚┬└┴└├╚┬╞╚╞╟╩┬╥╒╩╙тхфцщчЁЇ■ЎЁЁЄЇёЄёэЁЁЁььы∙юштю∙╥вЫaKuжхЎщцшшщыїёёёючьэЁёёЁяЁяЁььщчЇ■№Ў╕L$gЩиЮРdAsХ╣╗Уb, .8VvЗПеМДРzНЕА|s}ЕЦХДKGZ^fuy{Вzxx|xmr~ГВЧв┤═╞┬┼▓k'ARRL.rT4=Lj|ЦЧЖxАДЛзмЙhehK]xWX|I@гЬЯ╙Л4#,3VМ╞╗A(а▌╙ЪVHhuQEkЖНЩк╝╩┐еЪЯЦГ~ПЧБzГЖБ|ДПЕzИЧКptНад╖┤ЬТД}Г{jLVppxМК}gJH{Кz|НЗoQ8MzТБsЙНЖЛНЫн╝ЛAAo|]=$rНЖyrP#5[zУЦФАF 5]cSG-(MPMZo||rslnei`k_TkЕХмНjpКЗPЙ╣W*4CVkЧеСQ$ ?pЩ╘╬│ЗjL [╦ф╒╣╢╗╝╝╛┐├╛┬┼├┐├╞╩╩╨╪┘▐тцьёЁЎЎЇЎЎЇЄёЁыщччфррр▐┌╓┌╓╘╨═├╟╠╩╕╢┴ТuyЪ╢┬╔╬╞╞╩╦╨╤╧╨╨╨╨╨╥╬╤╙╓╒╒┌▌▐уэцт▐▌цш∙ЁнМK2^Ш├├{<-pЦкме}JZt~w}ЕЙУЩоЮРКИГСФt3ItОO RОГwm|ИНПРrw|Мм├╚╚аoАлЮ<Hu║╫S9fЧ┐╢ЬЗot~КШ╖мwSRiwЖбy#,<7IvЕЧЯАyv~УТк┤^ :tlYaШ└Уgейз║{@XwdBlКТЩвк╠▐▓ЮШЧЛ|НЩОКЙОИ{ВЗxАБГДЖИНОСФЦЬЖnumeW!*eps|СojjМ▓О}ЖН\! =^kyЕТТд╩д─х▌o&Z~Q( <ЩМy}t0 3Ja|аВtpiQ0;XbsБymtgjewДЖcHbdT=$ )_НЫйббY%OzГg@;oФ_;C:O~>"1/)!B`siyда<>FQhАР╗xe7 &Iu┐н╒╝┬tKp╣╨╝▓┤╡╣╝╗╜┐╛┬╟┬╣├╚╟╝╥█▐чэяЁёёЎёЁЁьыщхцх▐┌╫╘╨╨╬╬╦╦╨╩╞╞┴╜╣╗┼╖╛┐▒Ьйе╛╡╕п▓╖╖╣╛╖╕╕╛╣└┐╠┴┴├╩╞╞╚╦╤╒╫┌╒╬┌▐╓ьЇ┌▒ЬP "Mе├╤НQ",pГЮ╛╣}Q*MfФБw|lКЦ┴ЩРРВББyh9ax_-ЧАs~zПТЩйТАrkНЯл╒╛оПАH Sвун 7wЬм╞гВ|ymvИ╢Юz]WoШЬ{ 9Ts|~ВЬwnhpП╚╬Ъ#9Й]:5zЧ╔О nизЭСИd[nkTnЯЦЦае▓╨┴йгЮЦМКРОЖКНЛБГКЖГБЕГ|ДЛИНИГРУНВ{ЗjZ*!WlzБЙЗslsИзЮЕЙХ^9YcrМй╝ЩЩД~е╕ЕJQp\*){ХДyk71JdГЙАvutpf]Z_krxdcPFAXyВkSauoN4 !Ej|ЩпФg-@wЮкНpSH>>:9:;884300)9Mc|c3C\aaI$$""$!&3,IMZзЦХд|>2)."@QWvаРW$?MwЪе▒ТtKoЫ╖┤│╖╕╣╝╝╜┐┴┬├├┼├╩═╨╨р▐фыїюьюьящщшхт▐█▐ъ╓╬═╔─├┐└╝┤╗╢▓▒▓▓│й┤жйиЦre}ЧЯбЛк╢кУгЧЮЫдЬдене░╡┤╡╢║╛├╟╒╩╩╦▄╒╤уэ╙░▒ЮW,JЩ╩┼Мl(#N╝╛зДd1 8iЛКАwwЕВШХШиФИГyzf5 LfSBhНЧФвЯв║оЗwsxЕЙбйзФg v╝уPAЭМБМСynYWdzФЦАnbgЕаS;Ygmojna[KVv║цt,' Tк└} uаПЦЯ\hvl\rЯиЪЮек║╣мждЪНТЫСЕЙММЛЗКМБКМКЙБЕИЖ{zКЭНЕАГz[/SgnДСГ}mnЕйЭИЗСk( 1VjwДЬ┬ЫzK#fФ{PPn\1 !lЗЙЖ|?  0GbДкБivuunlregVVI8&G{eH\~|kZ4!'104034LRaП║v;BnУ╗╟├екРЮНЭЗФНХИЦВДvБht_jtКt}`/;_ВЪr;'*%%!#3#,#!,4E}▓╡й╖Ъu_ZK=YbxЭЮ~Q&LdБ┤з╢║╞╗┤╢╣╛╝╜╜╜└┐┐├├╩╩╨╙╒▌тртхъхххчтр▐▌щ╪╫╦╔╨┴╝╜▓пмз▓ебЮеЯзд░┤╖╡пйе.HВЩаЮ▒║мгжбдкЯЪФЫФЧЪЮРЬЭддйе╕╕╢╝─╔┼рр╪╣┬╬лpE OЫ│неГ(QГп▓░Рs27fХЗА{МxЖПг▓ЩТМИnPE'V|n&\│ндке▓╪й~w{nvБИХевЖ22vвоI N}lc^rgQ*@WtАЛУБvifЕ] $NccnX]L`NJ;oТ╩Ъ ;ЦvИj`УААННn\rvksХкаажлл┤йжбФМНСФОКМКИЙНПЛЛЦПМИЖЖГwm|ТУГЕz_2 HfiwДЕvtn~ЩвКБКx2 F[buИИРВC, cyZRaZ-ZБuЕV 0J`vСФplywonkgWF$ HfKJnМЛЖ|a\Phcty|Р`2.N}ЖPFf|ЬдммЯдЧебпбп╢╕й┤ккШаЫаЮм╗Фi^88]xЪ╖ЧeZJGESH;0,?94' [о╩┴╝ЩnY_RTntМЪ}e: $jИ─х╪╗╕╝║╝╜╛╛┐└├┴├╞╙╨╤╒╪█т█╒┘██┘┘ч╓╧├├╨╝└▓пдйж╕йлпп║пкз╖▓╝╕├┼╨╬р╚пf$|з┐█╩├├─┐┴┴╠╣╖л▓к░кеЬдейаУЩХаЪаЧмй╛├╚╝┐ы┘╖БY3*RАЫ┤▓s&Avж╡еХj4 -cГЙЕГ}uowКЮХЫнЩwge?YЮЬ[v├нж╢л╝╟Цnc^Zg~ГЙЪлЯf/HlБ~_";_lhd`lgS@TiА}НД~zuЖy_HcnЕxАp~kНmtfКИХжi  &H4S╡pdwotВБmcoofwЩевЬб▒┴нЭелЩ{АРПКМЛККБИННПЩЪМЙЗВБubnИН~}Г}c98^htЛvioxСЧНЖГГY##9n}onЕГsb0?cWWka8 Htsr~i!4M[uРДihwvpjobK3  >SKKjДЪд▒ддРЪбзпмШжоy>:'TaHHivl}ivivpzyОЪгж╖┤▒░┤▒иеил╝╚┤vL*9dyЖа╝овШЩКЛЕГdSJbiaE0б╧╗нБQR[^~{}ЕЗnfK2Yнс╪╝╢╢╖╣╗╜┐┐┴├├╟╩╒╩╨╒╒╒█╒╩╥╨╬╩╩╓╟╢ЮеммзйзЪз▒┼╣┐─╦╔╠╞╦╥╒▄▐▄▐тх■я╛mv╡х№с╫┌▌▄▌▐х▐╓╒╫╓╘╘╚─╞╚├╖жкЮдЭФЙТТЧбгле╬╟╩▓ЩЧ{lK5TАдна{=5tвебМlE"aУИvwsj`e{ГП┤▓НОuA53:|▒жИvЦ└жеоикаЕfYILk|ВГЗбжГeNevГytjcju{И{xnjt|НТtsyБЛбЭНННМКШОТЫаРеСЧедМ{ЗМlEHLThoАК5,Э╦X`wmkuБpenwjhЬ╡еЩНг├╬йФбоФsЖРНЛЛМЙД{ЕНОЩЮНИЗД~t`b|Й~zВЖi@ -\clЕФzedtРЮЛДЗИpRGLzЮГzЕЖgM!/f[Pf^:( 1FtЩен{KHZuЖШ║Тywy}xЕШЖi@'QoЙмХ}_fzНд▓ЩС╔╛/"KООx~ШФ%5uQ]s|ЗЕ|xВ}wФ┴╖йвККЯзжжзЯАБРПКГБМЦН}xВПФПКЕВ||fM^~Аx}ТwH'$]abwМu[- 9lБux}sewГШ╢Ч}zКwJ$ BuymrN$=^ГТгоБddnrrtvwsvpfIatzgr~|ZayНзейалмпее┴╖|@FtУ╢╡ееаТКДУЕЙБКДОТ╡РycBSwМЮввл╩╩│╜┴И3mаи▒╕╗┬╝┐╒─║ЯЙZ9bkБЪн┐╙╣вa<-((  /5Ю╩├┤╕┐┬├├╞╩╨╟├┴╞┬ййЬл▓н╜├╬╘╒╪┌█фыыюсьЁЁЁЁЁЁщьяюЇЇЇЎЎїЁёїїїяыъыЎЇ├НЬи▒й│─╥уухъюёЇї∙∙√√√√ЎїяёёЁЄЄёЁыььЁюЁЁэщшф■■╦x2}ЙЖdQ[iw~СЯейж║▓╝з{5&bН{САg% nТZ!g╢╚х└вДobr}Из╣ЮA8nЖКНВ~|vpw~БДЛИЕЕzs}АБУФТЬбМw\GXm~ПХjIGSmЕеШiMJTmДблСЖ}rnuЗЬ~bC?_{СШ}rjlГЩ▒╬z/]i_eynlйЙ >И^ZyДЖКГЖЗКО│╤╧▒СКУЮбдожЖМЩРНЗДДПИ~ИКПегЫЛ~|}nTVeielz{lcSKoo^W\jiY8$=X`a_aVbв┐╒├m8S[INdSL<^efS]P1HjjТо╛СiF<5;mУ║║╝ГV^rlhrzВТд┬╕п╝╟╚о╣▓║╖╝┬ХA.fГШз╝└╝├╦┼┐╜╞╞╩├╤╥╟╡ЪMbrНквРI5GgКМЕДВ}sx}БИЖЙЖВББДЕЙСТЫ│ЩЕsf^XnМЩЙeOI^{ЫЭЖdNI\wКдеОЕxlsГУЖoa@MhБШЩ~oezНй▓kO[P!)И╤▄е)8^ЪдлйЕ9 *5"?Ве╧я╬ЛO#YЩ▐юрНLAjpdlyЖУ╢╒┬╡╣┴╝к┤▓┐┼╨дP(OИЯз╕─╟─╥т▀─╤╒с╤▐рц╧л}NCbГЦжй▓│аРУОЬЗПphYrWaauДМНМoK@tc$  ,=Ocnxr{oSMjryНСНе╗гТСЭЩД|SE2PTdxr_N?\Ъ╦╩╜╝╞╘╧┼╞└╛омдк─╚╤█рющхтщххщъъъя√ЄЁЁёЁёюьЁяёЁЁЄЇ∙їЇЎїЎЇяёЄїЁёьь√╦УЩ░┤ми╞цфрсщэЄэЇЄёЁїїЎЎЇї√ЎїёёЎ№ЎїЄЁЁёё∙Ёыю√■ ▐` :~СЬЬМ_9!AYmАГд╬╛ЭТ|nO8  3G&'?vmQ$3J|░╪╟гаадФДT1WtНХУЬРilo|ЖЕДЖГБyy~ББЖИКЕЗММКЗЛМШ┤кСИ|hSY}ПУГgX^pМОФЙcOXl|КааНБz}БАИРv]KQnЛЩП{puЖСЛzХлb n}А}eQRZP#}╔╦Ы];! WЮ╞ФG 2p<2╜▐ 7ж╫ъ╨y<@Bt║ъїй}K10 IП╩ь█ЫgFgsu`VWzм║┬┬╗╗╢│╢├╧▀╟f1HlЦк╝╗╖┐┬═╪╙▓┐┬╨│╚┼▐╢Ф`?VmvЛТк╚╨дh,1.1*(/Qcxxhl[K`w$ &.>JWdd}Йw[fQCbmvx{МОн╫жmlnен╜ЩЧxR;  !2cins{Т└╫╧┴┬╩╘┬╝░╡│вжк╨┘▄щїёЄЎшцччшчшыыЁЇЇЄёЁЁяяЁЁхё√ЄяёёёЇїїЄЁыЁёёЁЁЁ√№╦ЦУ▓┤де─▀х▐▀чыышьююыёЄЄЄЄЇЎЎ∙ЁЁЇїїёёЁюяЁяэюыщї■■╗7 Brз╗┤И< !-QYvЛбв┤жаАrj<"LM_ЙwАВЗд▓─зЭАДЛ}C ,VnКПдНЙИГЕДИИЗЕ{~|{}БГЖВЗОНООЙБОдкЧТКw_TiЕКЙxjcgiБФЭАd`hv}ЗаПИИЗ~{ЖШЗo\KXxЖФЙ~ГЕАЖ─╨АCВН|oЖаTOеtQsйЮЛДwВОМа┤дЯаЮФКЪа╡┬ЪwmV\~oИНsNOjБЩ╡ГFP,lХлМRIw09┘сК*(>Т╧Ы3!КMДс_9$З╤┌─bF_d]mб╧╝Бk`G\cRGlЧбкСНИФМЬАrkteaiЗ░ЙaO_^EKcЯ╤хж<'JgweMOWms3,3@QN_agfmЛН[9KJlx]dc^wГкЇ╝;Fw~Пв╝ЮФjH9 )SgzНг╣╒╓├╜─▓йЯЩл▒╡╜╨їцшя№Ёыщ▄█тххтшшчщЁююэяюшЁЄэ╒Ё■ЎьЁяяЄёёЄЁъюююЁЁЁ№Ё╩ФМо▓аЫ┐рт▌фшцутчщщщыЁЁЇЄёЇїЎяЁЁЁёяяюяыхъьъъчч№■■Д .iм╥─y/3LeЩеФПСлЖb@0TПC?▐ф╓аФРЛДfLHetЬжНL'MpД|ИУПХРЖИННМК|zyry|АovИМНХЫ}ВТТУЭЦЗxeeuzz{{n_JbЖМЗ|mbrvxДОФОИ}z~ЗНЖw^Kd{БНЗЛСВk~лр▒1ZНЕlnМЩ)R▓|ImЧвФЗЕЛОНГШ╜ЮМШЩЧТЩвд╖жЛАg&/lЖУЬzXYRczд╕P4&OУдП7Lм*Л╫vIJ g╣ОF Йеwоy4А@%OПп╝Юm32dtus~ЦвЪkZiktztnБЖРТй╣РxyПdZ│┘╟└ЬзУ│─╪К\Zbk}itTMEA?>7'$$nеmEh{E-?gУ╞Ў┤9 1Oh{c[TGfгg  #09FXXgbagpni~У^>OQ`ЦJ&/PYlwФъу8$0CoЗок╪зжfF. OnБЩе╢├╙╡▒пХУНе▓╕╔╒▐щыььъшхт╤╩█тр▄фххрчуъьыьёЁЁё▀ыїЄЄЁЁЁЁЁЁяыцъыыьььэт╚ЪЦлоаЬ▓╤▄рхфт╓╨рхххщьЁЁЁщёЁЁтчэюыьхььщ╫щьъхшфь■ Їa.h╬▄├oA0K{МАЧк┴ТИk]─▓ A╤№└ШЕ_R$ Fk╗├▒zB)\Бx|ЗЙСжХРУУСТКБuosz|БvltДЙЛЧ┴Ъ|Г}Р░жОБzlinv|И}mM>gxЙМw`oynoЕдЭНЙБsyЙЬЕw]Wg|КСЫ▒cMmР╬їД#/hЛГpsЧЦWкЕPiЩдЪРИПФНОб▓Ю{ИШЪЧУЧазжЧОХVWХ╣ЖbixrzТп2 YДO3oС{H(t┬izЭwSP`zA-7bПЬПЗtt~ЖЖИНЦЛw\\t~~ГГИМРРНУЫДzЙ▓К .╛┌з|Z<%^ТЩiesbWE ?|`eКo1.IK\Д▓Їцp0';:C=IFNNdsНiHXfcРjK?750/)0/59OMVZnjgmkllpmpwW'Q{aX<)Rdzв∙с: #(I\МжзеЖМV4! 2IkДУл╖нп▓Ыемдзз├├─╫ЁччэЁъщхх▀┘╫▐тххьщшщЄъъыяЁёЄЎЇЁёёЄЁё№ЇЁЇЄёЁяЁЁЁёЁюЁц╩ндежег╝▄щЁщхх╙╨тчъчщыьЄёёёЇ№ЁяяэььыээъхыыэышщЎЄ■ р<%p╩┌ЯcC Fzzn{ЖЦОРЭМ╒чQ,l║╕НБv`(GО╝┴мwAWyД~АЖЖТаЧЪЩЧЦОЙxvu|{~}uuАЙКОе╗ЮЗБАЫ│ЮЛБxk`tЙУР|eOWxТПАwzyslpОкгЭЕbiАНУГnXV{г│РV2]zз▄тm 9lЙ|nДлКZ┤ЛXkЮзгХИПЩПЖб╥дx|УЩЫЫЬЪЮвЫРЛС^SЪФtnА~ГФнМgM@CrИz[lznb]uЭuKor{v`dtkoАk\h^2)SБw_mxQ&&#"5nШИБДЗОЫШЫЦавд|RWb~ПККУвг░ННПЬ~tЛ╞Щ%▓▌Ц=cМlhl_8 7trjiАЖrV`h]ZzвыхН^^hkismgih{ИuRN\pВ}|smgg\\[XXYZ]knjltnooppyvghW*B{Бb*A_|й№яF 7Rh|Хп┬ФАI74Of}Мгв╢пЪаЮЬго│╡▓╟═╨▌ььщъъцт▌▐┌╪█ттхшээщшюыыэЁЁёёїёЇЁЁяЁяЇЇЄяЄЇїїїЁЇЇЄЁЁЇ╨▒евЪдж╣╪шышщщстхцштцшщёёЁї∙√ЎЄёЁюяыюъэыяЁьыьыёчЎ■ г"w╦йvo_#KweazАЖИЦд╜щеjzЖЧПББxl-XШ┼╝ЯkE ;_tДЕБxwОЧЩеЭЩФПД|x||zz{y~ДЙЕНл╘зРААЯнУЖДzfg|ЭХxncvМЫЕАА|wmkrТдгЦyfm~ЛФ{`Z{┬Ёf 7]pЕйх╪KCwИ|КМЮrSеЩcbПмеЫКМЭЩЛФ╡╗БsКШЪЬЯаЯЮЫЦОКДv@#dВim}|nАбФcdp\HXXyГphnnhbuh\]d^fГpLctЛЪ_ZW1iОlbnM$*KВНxxВВТЮеЫШмжО^SdnАНЕОо┬в|LnБК{r~дН(;╡▐з;X~~o^?%Arthmz~ztroo]EhР╔╒ЦonmwrxnsnxИsMR^ktАvutrpplmhhjhgjlsorsososyАhJN@G|МmJ  .[Б▓№№V *`Е┼└лБhgwДПЮйа▒еЬдбйи┤╖╕╕╩╤┌хьььчхрр█▌╒╫▌фтфхчшшфщщыяЁЁёЁёяЁЁшэяюяюющёёёЄЁЁЇёЄЁщїт╡ЬКllУ┤▐х▐фюыьхтхурфчъыЁЁЎЎЁёЎЄЁшсюЎэщэЄььщыъчуЁ■■▀JuЩММНc%&eemЕЖЗГСФ│╡жЬОНМИИ~}P'lн┤еВfK9F]grЖ~xvmiНПЬЯШЦССЕrw|z{{t{АДБ~Н├╩кО~ЯЩПЛДw^R}МЗzyuvАОЖГАБxtrltНХЬПvaoДРГmhН┘л.>Zjr{Ййяо3LwГЗ|Бб^LеОhcЛвзШИИЪбУС│▒МtЕФШЭавбаЯЬХТНДzphsphrumjzНw\nuY-!By~bjxrfYejВ~c[lw]OoО┴дfal; (kwnzS$=OГНvlomrБТЙУнУdPeywsЖ~Д┼цЕ$Zorntmtl7%x└ц╝j Fcn}zR%()7=NIK_АЕjlvzxxtsob<\Ж░╬ЭyjkuttpoxЙ}RB^pxzysuvtutnmmmmklplrmnommoyЗtK3:IxЩИcH(QД├■√g)ZФжФН|ГЙОФвдгкзгнппп╢┤╖├╧╪ршюъчтр▌▐▌╒╨┌▌х▌ттухч▐шъюяёяёяЁёЁЁчьюыъчщхыюэъььЁщящфёъ╛РWhнуц╒рщщъфр▀▐▐рррцщюёёюЇЇїёъ▐юЎящщяъххчххтцЄ■ЎП,cХднШe$/i}ФЬЮНГ{~w}ЬХЬжХЪПСНЖjHLЦдЫНВpemhky}{kefkwБЖИХЩФФФКyv|||xr|В}|С┬╒мСzСССФГb9JyРz{zx}БГЙГА{}zphzИЩЮТlh|ЖЖАЛ╡оI:luxvuyБ╖чЪZzГz{ПЬ.=ТЩpeЕггЭИГУгЮХп╜СxЖУФЩЭгйждаТШЭХС~АВ|xyuulzwmlwrb=M{e[wkXLc~РpgfmcYpК║╒Б\th>azДp$=dЕбГfdW@GEWl{ХвoN[wРm:n}В╩шdTfkvvbYM.%HН╩ч╛1T{ijА|T-"!*5?MTS^arhkБШtj~|{y{xwrvhFXДл╦йБllvwuovЛЕRAXpv|wxwyvssrsnlkkmohl^`cghr}~H5EBhКМ~iXM<):PБ╩■№zM|wКЕМЛЛФип║╖┤о▓╡▓│╕│▓┴╤тюэюъф▄▐┘▌╪╫╬▄▐у▄рххшшфьыюЁёяяёЎёЁЁЁююяЁртшЄътхшччтцфрч▌╬О)5есх╧╓▄ср▀█┘██▌█╤рцфчъьяЁё∙ЁщЁяююхшххутутт▀р№ ▐xoа╛╝аW dЛе╖ййМЕБzmi~БНйЩбвагСwjA RДНФХФИ|wpnk]`VS_hy|~}ДХТСЪХТАty|{{{|ВВxwЪ▐┘▓Щv{НЩгТtJ4_Н~u}y~ДЛКx{|urp|ПЦбОut~ЗУ╛░S9eИД{znrwО╘√p .cЙ~{ХЙ8КМslНЭгЯЛЕеибЫл└ЭyХЩЧЮвз║лкЬЗЬеваОКИwxzxyКxbrВjJ.YgamДnS45cА{hoxscЕРб┬Щjou, =gi~ВATПвГrmT% :[МФ|^bj{еk ?zП╘╞\'?^lВРБd?TzЭжЭМБwr{wuxywh`_k~│ья╙Ю~~ШкЛa?H}ФИ{xxАЙУ~dkswtswЕМФНКкЩQ-5aКБzДКДБzpk_Б░┘Ъ&R|ЗylАбSpЕpi|дйЮДuН╖▓ддм╕ЪunБРЬж┤╡здбШМЕСЩЬй╢еyShy|wxxtpllP'%C`lwДf:Qojj|еЙ^SGfНЗГ_'B{sipsh[Wdl|Оxgx\ /Z|ЩЭБk^rxyspkMNzФ┤╟Юsbx~woicWF=-)%LbАГdLft{ЗБ~{wttturmpzvv|ВЙy|ИМЙККЙЙННСИoT-PД▓║агн╗ййo5?dВг░└│╜┤╞▓│и┐м╡д░д│ЩЧvsh|uБg]L7ZЮТF &=IOnС├Ў╩|XIC93/5AHMYPXxzПa# 9│ш╒ло╖╡║║└╛╩╓█тртф▄╠├╘╤╩╤╒╫╓╤┌╒▀тхшщяЁяьфчхчфхт▐█┘▐╤╩╞─└┐╝║│╢╕озвнзЪЕгзеСykАФЮОХНЪНаТОРЬФвбгЮдйп▒│╢╢┴╣╬┬╫╩═╨┘┘╒▌▌▐▌▐▐рр▐▄ь№■╨s2  >Ъ▐р╛ШСКГД~\,cЩ╡ШБ[0 Ftz~ВЕРЫЭдНВ|siV(.YuабШЖgA^}ЬЗc0&JvКЬЫЯБnvztvxwm_amlА┬№№┘ЧuvКЫаeQZВФtuwzННpinsxx|БЗКМд╜Ю@JЗКxsvЗОЖ}xtgvИ▒┬Л$]ВС}oОЫ(hЙ|tuЛжжМoЕ╖╛егеегШАyЗЬоо│▓здгС{ИТПХй┤Ф\Wz|s{ЕwkppjJ;PafwЙu:!Fkxmlwl05;RЖЦМt: -vГhgruphftА|yoosO';_ЖйбЗvidpvssrjLMwКЯйН{r{{tsnkhc^][XdkХ~n|ББЕЗЙЕАzovw~~|ЕДДКИЕ}ДНЯбйе╖ж┤о┴аxG 3nШ▓дж╜╦оЙI@ek|ЙЧЮзаЯеЯШазйЮШЭз▓╛нге╕├╝АCOMMН┴▒kA.HlО┬їрЗdc`]eWSOKZmlГ{WH:╡х╩м▒┤┤╡╖├┼╨█чхцт┌╙╦╔╨╙╙╓▐╪╧╬х┌▀рххшчщцх▐р▀▐█┌╒╙╧╦╩╗╣▓мбйдйеопйЪг┤мЧФ▓│дМOHaЙЦФаЪгЬйЮЩЪеЪЭдеЬСЦСЫЦаЧеЬЧЗз▓╡╣├▐╩╓█ч╫╙┘▀┘▄▌тя№▌Фa<0R[До▌└ФЙЗЕЕ~L 0uкнЦ{[3$Xtu{БВОПЯЯСУЙykB'[КЭабЖMHvЬЫo99iЗЪгХ}}Аuy{xnfhnfnФ╙■ё╢Нs~ЕЮбГr\bММ|tow}ВМАslnwx}ЕЗЕЯ╣С;*fЛВ|yvzМЦДz{ztnН┐╜T;uТС~|ЭНdИВz|ИПЫШsoб╛┤ваЫХХХКПЧе╕┬╢нйпбЗyМЗ~ОйвА_oАzuГБlkxtmXbs~py~T'TЕЕwjbP%HИТ|Дh"gМniwtppopvЙ}kdls\QfuН└├ж|ikmuuttnjIFuМСТВ}z~zwvrppnmnkmnsУГ|ДЖИНПСОИ~wyЕЛОСУЪЪЧТМЗГЙЪк╣л▒┤╣╢├╛иsM!BlС╖еЭ▓╝ПSCkcFPP[ZbTZZ[Ygci]]`rУМЫ▓╒█мL/N[~д╙╦▓ОЖfY@B/& EkФ┴ЁрЗ\[musbZJNuКФУi7 O╟у▓ем│╖┤▓├╨╪тыцшс┌╨╩═╥╘╒╪у▄╬╨шхтфххср▐█▄▐╫┌╘╬╩┬╜│┤гебеЫФижп▓╝╝╝о╛╟┼▓└┌┘пОC$PКб╜┴├┴┼┼┼║╗┐║▓╝╖павЩЮЪЮФЩГ\WiКЛЙЕ▓о╗╨╪┌═▀╥╥╘╒рть╙нРГКШМЩз╖ЩkmyЛКТЙfOЬлеОw__psy}{Бw{БЙШЫгиПwP#9iЕЦеЫsQ &\ОлЮN2k~УЮЯМИ}|{xtpnrhs{Т▀■█╜ЙyzКдеОr\zОМxoz|АБzl`my|ЕЕВТзЖYb~Г}{|tГЧНА|whrе╞ФAPБШФ|~ж~f}Е{|ВМНШБmИк╖йЬФЕТТЧаей╗╚│мм╖вКНЙiiМЭЕzv{vzЕДmbs~upgsИНrma= 1]Едm]B *xеyizPVБthn{ppsvxx|zeWhw{{УФй╫╜Ыh_pvtutpnkCeyОЯУЗt>  =}▒▓l##KkОаЦЙЗu|}wwzzjj|│■№┐ЬxjpМзЧИАГЕЖДvspyz|wjfgv~ЕНИЖЙЗЙМВДЗИБztxЙТБjernwИкдN%`МдНwКк1gОР}|ГИИНМ~ЛЯе▓бП~hlБХеЬЬ▓╟╖▓омзжекдТyДЗ|mkx{z|vinzrnpyДЮzdhjH'cУл}etk!J}ЗvВО1 1cupglgf`eeiКЬoKapЙбж┴ЫРЫйЕXbvwsusrsroP7vеАm{Бyutnmuhj\a\ggx~}x|ИИmПЦЪбл▓╜▓╛з║аЯкбО}Q4  ?_xГк╝лnCdТ38QjЙX%PПB!'7GV~|дЧ╩╝Ў▒^,iзЁчЭ][SGcpjwF?HdcИДZM; Rб╧╣кп╡╡╣┐╕╨▀яшр▄╓╙╧╩═╟╟╩╤╘╫╓╘╘╤╧╠╩├├╝лкОЧСодп├╟╔╠╘┌фр▀фтфчыщщъьяЁёящфтёь╛еЭаЦз╕─╙хшшччычуфурт▀т█╪┌█┘█╒█Ё┘х╥╦мвЪМe72.?jРл▓╦║├╔╙░ЧФИ|[;~╗оШАn_WJ[irГОТЭК}{gF@ШuxwЙеЯкНsR@`wВЪЧТВi: QЦ▓┤fGwХеРХК}|}}}~}wwnЛ╨■ф╗ЧnctМбРИБ~ЖИГunxzБytj[`yЬз|slyГХНЛЭКtv{ДДmQatooК└СH4xЯп}uЯйPННДЖЛПТФЧТЩЩЫбФЙopЖОЩаЦл╦┐▓┤пойее┤╜ШДКОz`p{z|xglvwskr|ТЖkpsnR@OwЯФowГC=aВЖЖНN%[tmhe_JAkВЬПвЬжп┤╣емиаБC^ЯпгСvonlopyzЖОФЛЕkAMxБЗ||ЛЛЧзПmjrДПЩаЧГk4"[О╜└\LЙЫОУгПЕx~АvfАе┘№ч│И`d~СЦНИЕЖКЛАsr{y{o\S}║ЧT54jУгНВРУДtps{|y`\ktrsЧ║Д)LЛбЦ~{гДCЖЩБДЙРФЧаЯбЧУУЩЙmmБНЦЬбд╣─┤лонкйвж║еНКШЖjl|{zytisutrtxЕЕv~{tccxТХЕ{Л^.ZvНКНeC}ЯxhbS8$3FdО~^\pГбдЧМААИЙzrtytsomjfkfkuЙГnvЕЩРsgadJ5 GjknАЫ╜┌нУiyКЬСЩ╜─~$3sззЯЕ? :[ДЬ╢Н]dГA ;bno^LXЛ[ 'XRFI^М▓╞СZV\rЭ┤╡k,>Pkjn]\М╚╚░▓┤│▓│░┬╨▐ЇЎш┌┼╔┬╓╓╤╘╨╨╨▐╙╧├┴└│иШ▓├├╩═╙╓ртфЁщьъЁЁЄЇёьЇїЎЎїЇёёёЄЇї∙їЁя№я╚╢Н`pЦ╡╬╒рыэяЄЇёяёяяэььшчхр▄▌трхцъЄьёшЎщ▌╨┐▒ЭУОЪаеЬЙКАОХз▓п─║║АM&^Ог▒ЫЕВzuspz_VTxНиЦГ{e!KМШЛБ}ДЦЬФЫГyЙНФеЮЧЕk%(dв╨╛H"fЛВДЪеПЗБГА~~sjwИйх тзk`lДРХОННКНЖytyz{Ж|iYxХ= 2n}ЖХЭКЖМН|rpy~ББt^_pyotе╣j$VКгЮ}~лi4|НКББДИНХЫЮЩЩОННЖnhsЕСЩЪе║╝│лвймздаавЗЙЛМmiz|{zyujsxtmw|Б|zБВАvpГебЗА{n)LkЙЛБ}E@cМШzb_8 4`ГНwii`Wgjlncev}mmi]]b`cX5#MlzzyТ┼└] 9WnnXa~ГХМfI Q|╗╢ЙkPMxМШФr% %:NdКЙelЖSAik\TPZgI .LmnaXAHy}de~Ь┼╗ЧИВ_M  3p╟╫нй╣┤░е▒▒├┌ёы▌┌╫╦╠╩╨╪╧╬╞└╣еЭан▓╗├├╨р▐▀▀шфшъыЁЇёїюьчъё√ЇЁЁящьщьэёёёЁЁэщш∙ь─б~ДРОй─█чхчыэёьъъщтчщчщчхх▐█╒┌▀щьЁЁЄЁёэхчх▄ц█▐╒╦╩╬╚║лбЬУгЩРМНнЯиЬИЖМОУЬЫФМИ|siC AУ▓зС~kI NН╢Ъulo{АЗРХФСКНМНИДR@y╢╩ИaJ5Rr||y~xЙПСКЖЕАvyw{ЗИlXTcmjfиЬ?3rУлЬyЗЛ|СОzwЕЙГНЯиЪТДЖЙБjwЗКЕТв░╛╜╝░аиеЩУФУ}vГВzioyvoz~opxzxruzВЗxpxЖДГа╩╧бrX, 3OeАypvpE-IfvШБhe]$ /ZnУДmrc2%F\_X@Ym|neT>GX[]V2'>ZsyЖЖЩ╙╓S ,Ko~ЗЙ]Nhv][* #`┤пj9YuТУСzN  !7LaГЙb^ЬЫ& !ArxVX\VTX&FlwQPE:vбj8;MЗ|ФЬ╕вЭkE<^╝╘╡л░▓пе▒╢╬┌рс█╘╒╘╒╧╨╒╝├╖╢йаже║╚╘╥╪▐хшччыщььЁёЁяьюътъэЁяээыхюс▐шЁЁэьыыцщ√я╦кЭзЯМг├╫ъщчъъъщщхх┌тшшчшху▐█╤╘┌хьяяюяяюэыъхфт▀▄█╓┘р┌╩┼╝ппйТЗУФТ░ЭеЫЬйбЫЦФНИ}dEnд┤ЪГzt?$oн▓МoflxЗХПТЩОМОКЗЕyC PТ└╘h Cpus}МТРС|t|{thilУ╒ ╨Вl~АКПУедЭО|svvuiJIR?3mНБГЛГyВМХЛЖИГГ~ww~РВ`MWhiijЙ║Д,LВеп}eМПlФО|vБЗЕГР▒░ЩКyАЗГ{yГМРПШз╗─╝▓нопЯПФПДkwББwt||vА|pguБzsnzЗК|opxМРФ░├├НzmC/Ybispt|kNTltГВskkY&9du|Кpx[5W`E,]osoc?,4V`a\SPTozБ|АЙИШ▀╓\>cЙе╠▓УgNff> 2ГЬ_@tГТУW 3LcДЧlRy╘Ъ $GtН\G[plH %BoАP7ELo║┴S "'AgxНТХДШrZ< _╛╤┴░о│▓о╝╟╒╤╘╒╤╨╨╤╘╩─мЬек░о╛╩╩╘╪ыртцчщьыЇЁььЁЁыэыыющыяьяЁяЁяё▐▌ьюяьэюьъъ√Ё╧┤▒▓йТд└╒ушхщъшхшчшхччшццчч▀▌╪╒╫сшяыыяЁЁЁёёюхттфтс▄хЇ▄р═╟├╣пЬПЧОАОФФЦа╢лЯеЫШЦДu_/ 'ВммЩГzk> 4Р┐лЕfat~}ЕКОЬФОРФЛГАmB"_Ч─┬YSlyuБЩЪвС}АzojQgеё■└БzВЖЗММЧейЫПwpyvrrO:JmДБ}ЕЦУ{{ДНКРМИЖБvxwБЦ}OKcjklkО╡~%cЩеКuiЧboТРwx~ВДЖИФи▓Оy|ГГwГИНУЬЭз╢╚╣░│╗жФФУЗol|~}|||}БР{eozwnfГЭirАНЩФШеиТБzy<%Tfnspuxd`nw{vvsscNj}НФНysu^#C[[JYonkrhB(C_fjkmjsЖШБv|ЛПШ╦√ХPPxТ┤╢ш╙┴{M`ЕBZwoOIbpЮб21EbГвuPfФ╫╖3 "(.GajkjkЬ╒l>zбЦНuxШ3 \ПО{uЙБГБКЦТ|l~ДБwsГОТЩбЭн╣├└▓окЭФСЙplvБvp{|ГВrnxzsplwГГbhВШ╢ЧНРУОЕБp?3Ngo|xyyywodl{Й|xvuvgcВЮкаopvfABaffiytkpulQJ]iknppsМИ|ytГЦЫмс╫ЪЭ░╤кЫлЯЙebЕY*ZБНh[oлХ$8GZzТ|bb|Э█┼`13335;MELCA>OJMNXrЗhclljxлпQKДвЩВtГТ RЙЛ|o|СГyuzwККk`БЛznАЛСЧЯвз╡┴─┤жеЪЪТН~irВО}mv}А~vttwtkmvАБzivН▓лСЗЙЖzВ~|p]_brДТyyvwrhmЖаkklpl~Ы▓╜Л`iwsladlmuМГwtuvphhjrrprr~УЙ}{|jhСЬе┴╤└░└│ФЛИБmi~r2 QНН{mvлмC !-CQ[tФ~bi{ЕШ╨рАZ^dYe]jeicf^dd^_`uНlCM\gКИzbmei\_V\MPELB?.)%=c^[N,Efo|Жо№№}  .Tf~о╟╧╢иммп░зк▒о▓║╝╚├вЮан╣┴┴─╩═╥▌╪┘▄▌▌▀█фчээющчххххуухшщцфушяцчьэшэяюяяюээыщшрця═╡иШtОе▓╟╪┌▐сфуххтхххтхрфхшс▌╪█╒╚╬сщъюъъщщъъщццсттхх█╒р▐█╫р╨╕йЬЬПЖyiy}{zu~Ов╡┬ЯЦНzLQОЩЭЛxpb"*y┤г~kkoplb[nwВб╣ивИsnYAtг╖Н@lЗ~vzВРеК|mc_^_lгх№уКi|ТНММПд░ЯУШлЙ@8dКГV2Ss{ЕЧиsNhБЛСРТЗzxz{{ЖЗAEimmmyйк5cТлМvpФz>ИТ|fuИИАxiim}З`oТЗnxОРФЬбзм╜╬╣ФЭЭЦТОЛuh{ОНysА{~}yxxzreo{~||ДЪгХЗ|ИБwz|xrjlo|УРxz{xsnm{ЯЪteoyАВЮн║гi_nysonoptДСВzyxvsrooomtuzЗУЕ~}~jjМЪл╜┐░аеЕААujt~N$eНА{}Ад╣В9 !--:9EGQYbnРЙrjv~ЕП╤щС]Z][YNRLRM\XbbgbtТ|JMl\QaVTW\^_X`gf_cadd_VLQIC>>QjfMXMImwmpЖй№ Ф &В╚▀╞йийжЯЩамй▓▓╖╝мЯио╢└┼╟══╨╫╪╪▄█▌▐р▀щцщъьъщъхтхфшшэшчцщщшцъьЁъэяюыяЁяюёъхршёш╘┤PXЩ╡╩╪▐▌▐▀тфтутфх▀ттыхцу▀█ф▌╬╔▌фчщьыыъээщшцхтфчр╪█эт█▌ъ▄░ИtМгЦАmmxtmPRk~ЛдЧФддТOgМбШГywK 8ЙмХЕoann`@M_lЮЯйЩД~uELАв╡d MБО|vwДЫХЛБphb^_v╣Ёё╡v[{ООНДИе▓о╜ЧA5^uНМf8>eyzКлУc\uИОЧЦНГsoy{ЖХn."MkoklГ▓~#4|бЫ~m|гQ&uФЕkjДЙ}{edpЕЖnhОЧrmЗТМШЭгжн├─еЙЮЬШСНГrlБОВz}Д~Г|}||yscp|Г~}ГНУЛ~|ТЕx||znlr{РФАy|yyrlvГЬЖlrГЭРЫзпеfltoownonxИП~{{vwvpjihfmwБЕИГБwv{Н╢╒╢ОЕГtux|sm|А?>wРz|АВФ░еА^M?;FPY[d_`ccdhЗН|szseyХ█юР3#,#$-AR_`lКЗREmf8'(3)0.LHQTcdpjikjdkbfwsMHT\uЙБk[yж∙■кG╖х═нЪЩЧЙМЮжмоинойо║╜├╟╔╦╬╤╘╒╫╫┌▌▀ффчышщщщщьыьуыыьэёьщччшщшшшёююяэцыююЁёъчхцЁ№ЎН {╣╘▄срррттрт▀р▀тфхьчышттц█╧┬╘▄▐хыяёЁяЁэыщцутчр▐тят▄┌їЁнP3_Ц░Рwjroe>&9S]zБКи└┼ТW. 9uЦЯП|upS LП▓в~dgoj=%4McНдеаЛxeB #[ЕзЫY&mУФvw|ИХЬНДxfaZ^Г╤∙┘ЦY]ЗЭОБzП▓┼┐}4;m|КПz]I^v~ВХЯИcdzЙЦаЦР|mv|ВСМ`!'XnrurКе OЙеЩpfПеsФЙlfxЖ|y~|bjВОneГФtd}НГИЪбжк┤╕зЭШЮЬТНЖzkrВА~y}ЖЖ}yytgmovГЕxГЖБyhyНЯЗ}{zunjxАЧЗ}}{uoljwДЕ~l~ЭлСЦПЪЕszsnjmpd_dsЙК}zwrrneeb\VgwБДВЖВАГА`Cw┤▀▓fmntБ|mlИЕC2YuЛyv|ЖЭЮзЩЗmfbe]geldj`erЕzvxuWNgФу№К(J\g~ЕTGht.   (7JXgnsx}wvy|}|RBR\nДИЖoM]Юя ┼&;╗▀╝Ъ|ЖИБПвйо░епо│╝┼├╞╩╦╠╬╨╪╫╒╒┘▄ссцчхчшщщхыЁьщЁЁяЁЁЁычъышщщщыююэыхчщьъыъчтщы№щS\│╒▌▄▄█▐▌▌▐▌▐▀р▀р▀тхххч▐┌╫╩╣┼╤┌рщяЁЄЁяшъъъщ▐ус▀тт▀▄█Є■╟Ae┤│ЕlrojH #L]yЪ╖м┤РvS**_ЗФФБy~Д?Xж╗Пmeit`",_sПЦзЦБvj7 5dНдЬ<M|ЫЗz}|ЕЮЪМБtdZRhШэ√├|PcЯЬЖrЕЪ▓г|XPiuАНГwketyyИЦФvZb}ЛбгЫИxyvuИЧ}84aw}mvЦ╝_iЯ░}aeжЛ cНЙpgpz}w}{a`БРxZtН~`sЙИ}Увейо╢йШбвЬШФМ}hkuААyuГК}usnWMhzБГwxvvnod\|РКБyrkpriw|Г{{}vgaigu~{rlЕвНzmuБwtt`Z`a]F3SuЖ{wtomh_VH?*0VwК~~АБМy7`Ь├▓OOk~ДmawНyN; *Qnmr|yln{АМо╗Хtb=7>PY]^Q`nur|vJ0<\Ощ■Н5TgВЕS;gЛ] &!:=W\t{АЕЖ}ВИНxF1Pgpwx|Аn>C▐ яS e┼╛ХbVtАПбжп╕╣╖╗╝╝└╠╞┼╚╩╩┼╙с╫╤┘▌▌▐стх▀чъчщчщыыьэээьыщщщшшхщшьщьъыЁчхццухус▌х┘▐╛Kaж╤╘┘╥╘╫╘╙╪╒╪┌▀┘╒██▌█▌т▄┘╪╤┴╗╞╘┌тщэыьш▄чъщу▐сут▀▄▌╪┌я№■z$В╔жspsoa13cЖТБРжЭЧpLG`zЛОЖГА|a2!k┐нvefmyL #NkxПЭЪВxcC$FlЗЬykkfTT^`g}~wzkOQhosw{|wwnhWWglvКxmmywkTNpИmbQ4;NRGYГ|ovslf[Q.AyХ~yЕyХj#4oЙ│▒v04lЙnTjВАwc\; /HkОocv~gbal~▓┐гСЖS 0LWXSZmpwНf")<`Нх■Ь!!,1@ZcjЗРV%\СХj9$.=HQZ^egjsv~ДМОСХМЗ|ЛRChtvwuwДl&#_─ √И5 5ХРИl:aЖРЯй┤┐├╞├┴┴┴║├┼├┐╩╦┼╤╪╫┘▌▌▌▄р▀хцчшчшшчшшсъьъщцсчшщх▐▐эщ▀цшчшцф▀▄┌┘╪╓╨╧┼╩┬Ж<%JКп┴┐└╚╩═╦─╩═╧╨╤╟╘╘╙╙╙╤╘╒┘┌╙╞╞┴╟╬▄тчщхффччч█╒ртрр▌╥╪╙▌ї ╨%GЩ╨Цsoosr*JwК{yМеадИpu|ИОЕЗ|ppi$2Б╔Эjadmz=NayЪ┐НВ|oJ"$LxлЬn#^zШyliuЙвХОБfQQdЕ╡№╒ЛJGЖ▒Й{ЖЖМнб{RKhtyМБ~yxpwКДrYWpДаеПЕxrjwМЭrCOypihБвм0 GПаЧhKu╛:{Вppu{xuБЮZdНТzl{Б~yАИОУжеекл░леебНХЬПАnp|~z}yБАnxДS"P}ФЕomdF#E\\cno{АS#Ciosy}{xnRMGao}Н~ok^_RN7Yo|s\.$IO40nЕtuxun`M)AdНЙw|Еl^eX?^t}л╩u)etffmmjiif_?&#2A[lВ~gdkZ>/)>dО╝╝оП]%Ychjnw}МЛgPRViМ═■╛pa`pftoЛ}ФРгеаc"FЕд▓ЯНimgzzЧКРМНОЛМТТЦШШЫвнн^S4BkАЙ{tw|ФД5M╗ √бrXI9?-$bgWlfeВЦЯм└╞т╪┌═├├└┴╞┬┴╚╒╬╨╒█╪╪█▄▄▀▀тцЎыщыъыыэыыыэьъщчъыЎьуш№ьтфр▌▄▄ч╙╝╠╨═╩╩╧┼┬├╕ПЗНим╡│┤╜╟┐┴╜╛╜┴├└┼▀═╨╬╦╠╧╧╘▄╥╧╨╩┬╙▄▐ххчцшшьшхрут▀▀▄┘┌╫рЁ■ё^Wм╦Хoktzl!OФЗНТЦбПСТОПНИАwyuS BЫ╞Пf_dwr-:X~ЮРКЙЕsR8AdПгН:)SВФygkyНЬЬЬБNLQdЛ╩№╢jWtПИКsKhН├СL9[oj}НЗxutum{УДbW[|ШгЫНГyz{~ПЧ` -]~p_oОеo_ЮЮ{RFФвgvvswГzo{ПНsd|РГvn~Л}vЕМПФбгк┤▒окддЬРУТЖvo|Д~|ААДВ}zЖ|O4JlСЗty|NIXW`nuДj7$KhmsА~zscHBXjwПЖrlbL??>Jlmsvb%)NVB;\yБwztpdQ7 lСзЧЖpfmxxНЧmKvtjwЪдn*cЯСR=VЭе,e`evx{yov~}jvНЦx_АЛo]АЛИЩв▓═├аДб╡ЬУНЗrkpyssx{x}БГББ||ГХШf`ix`<&9FAFT`tubVSX__][iyГu^dyЗykky}S-38-CfrЗ}G#Hbins{ГywihdeaWXiГЧЫvsИОh> (YЕSYСМ|popX1#A[fklnnppprr{{lk~p0 !%G_АКЕМо┤УgpКнгНvmЕЭи▓╜┘т╜kbТ┼╧▒зо░ппмзл╝▒^(R|ФЭж▓╕╛═┘╥╩╚┴╗╢▒еЮЕuautyi|ВYGIXtГР╖╗│иЭШХ▓├╩мИ|АЪ┼╖ЭЦT5^{ipSAVe{ПСЧвез░╩╨╒▌╫═╜п║┐╝╣┼─╞┼╩╬╬╒╪╨╤┘┌╫▐ухчт█хшщышщчхх▌┘╪╒╬╩╚║╣▒│▒м▒к▓лое└╝▒▒╩╩╔╦╧╤т╬й{:ДШо╥╤╩╚╩─║─╩┐╛╢аПбЬлбабжИИМбХЕККли├┐╬╨╧╘╘╒╒╪╪┘┌█╒╪┌┘╫▐√ ▐P [е╟Ч^[vГr0 LФ╩░Бvpvw}ЙСиЮЭХЗ{zt\!JУ╦СJ@cyДF Iz}t~ЫСВ|yxvokБ╣Ц53НжИxujt~ЕТеФ}^Rwи╩╫┬ШG&@R`nuЕОбФДБzlyМРV-X[_tЧm85TpЭиТГnepuБЧШC(_yli~зЭe7~з~J7aоБ_nkkr~НЖtsД~ljЙбГhtЛВmwОЙИ{vЪн╫▐оОШабЦПК|hovtsvzxw||ВДАКОШСz]`foW2-@E>CTb||e`^XMNRRjБЖugwПЮxclБb=;>24^БЛП`*#A`hjsxyxyrhabfnptРЩyФ~jxШ~M% $VzIB|ЗstuzkXRinpospmswxxyГsewЭВBF`iyВде╚╣ЧКЖЭ▓}5:wЧФГyГУЬжп┤╒я╚cGx▓╪╗м▓▓омкг┤┤u>LxПЯео╣┴╦▄▀х╓╓╚╛╣╕леЯЪХПНОЛtJ-RvЕД{Дб╣о░░┤╗═┤пагЛrН╖▓ЫНf&^{h^RFavЙПЮбенкн╜┌╫▄╪┌╦└╢╟┴┴├╩╩╩╩═╧╤╓щ╒╨╫▐▐фтуфххххххтс▐█▐╒═╚╩╝▓йдне░▒║║├╟╔╩═┌╤╥╒т╪┌┌хы■▐лy%(]Нж╚ёф▀╪▄╪╒╪ч╓┌╨╟╟╒╚╒─├┐╣мЭдиСb`VmАЧЭе╢╢╚╟╟╦╠╨╨╥╥╘╒╒╓╒сш№ёШ2o╡╩НX`o|f*eл┬ШyuuvrАЖМНЮ▒гВvГtK\м╛А5>fЗ|9#_y{rГОНЗЗБ{tpnа█ZееАuikzВНЧжХvfgМм╔╚p3m}yglxyЖгЮЗАy~ГЛsF%>_alЕ}_9EX|зкС|`ar~НШs* ColilЕпШETЬлv.1~╡(Mu|ДlbКд}hГгpOzеНvtБДДЗМД{zyЩ╞∙├ЮСЭЩЧСНГxnplortuvwwsvАКОЫЮЮЖuY]klF-XoИxd`[3&2C]lyЕznН╣Нrhfi\IL2.Vr|ГoR(8]mfel|vxvtp`\lИРКЯZG_doЖТr2PЖQ#VГoexy}{tv|}ympls||~~{wjj~ЭдТаг├н┴└╠рш▓ЫСНМe_У|pАОЧЫгй▒╧эщw,_з╘╔▓▓░пидй╜АGWxНШео╢┐╟═╫▌┌┘╧├╢╖│окйй░ггди]%ArПеНpЖЬзл▒┤╝╨╝ЫУКТЗjyй╜ХОuLFg[Z[I\ЖНк░пзиоз▒║╨▌т╪╥╬╝▓┐╜└├╞╚╩═╬╨╘╓┘┌╫╘▌тсххр▄▀т▀▐┘┘▐╬╟┼┬╖▓╣аеЯ╖┴╝╟╦╧╨╘┌т▀сустхфхчхцЎ■шмК^`yЪп┌ы▐▌▐р▌ттр▐▐▄██▌▄▌▄┘╒╤╦┬╛╕нТca\tuБ{ПМи┤п┤║┼─╟╩╠═╨╤╤╨╤ь■╩z"!Г┐╬yKZБ{n"#Зп╢РynwuunxГбо├НpyМuS#▒╧e'F|Мz' ?mЕxsЕЪМОД}}{v{╖╙N%t╗ХxlrzАГЖФкФВwАПв}M2M~в~VPjolЙ▓ЧГ~z~ОКoA$HfmДЖxS9LgК┴мИgWguДЬРbYmmgjП╩Ж*.Ео┤PNлж ,ezЗtZuЯГRuФL[ПГwБЖДДДМУВaXlЯ╪▐нПНЦЦРНДoori\dluuvrmer|ОЯвкЪ{]QdtZ,5EA009^yДui_5#I_ipxwДЫВba]ceWH:7blkthO4Vm_]V^llpvsp^RВкb48[~УКH>lk\gn^k{ЕЗНССФУМВГz|ЗККЙ}\XrЛй╡╝╢╡├┐╟╞╨▄▀╔оЬТЙ[ "avpwДМСЧЦЮи┴шсАA]б╨├ппккийеLVНЪгм╡┐╞╩╨╒╒╓╩╜╡м┤│лЪеомеЬМg/BiДллЪУЭежн▒▓╖╟╕дИЛЛzcwо▓РОМuXMWK;_g\YZ}┤╥╡йиол╣┬╩┘э╙╠╟└╖╝└┴├╟╚╩╩═╧╘╙╒┘▀▐▄▐▐р▀▌╘┌▀╓╧╩├├зйе░ж╖┐╝└─┘╙╨╪ш▄██▐р▌чЄшчщшщщшьЄ№╫Цy|zМЫ░╨я▐█рухфтсурр▐▐▐р▐▀▌▌ы╫╧╨┌╩├дЬМНУЭШЦУОбИПУз╣╢╝┐├╩╩╬╨╬▀Ў∙иT.З─▓f:T~ВR7К░┤ГknneJMg{КгЦГОМi> 2x╡бXJЙН]MzГ|zЖЖИГЗ}rvvИ░Ч5:ЗдМslx|w~КЦеФЙВГ|K7LmИХМk=RegmМЦОВ{tБН}X4:Zj{РГ^@>WmЫ╝аu]WdtНЭy(%cohgpд║c GМдv@-l─rc{Ж|eiБЖd`}ЕhTpИК|rЕНЕ|ЕУХy?к─лR,bЙzE HЩ╗г|nkcC&4YlНТХНЮУxY9AЪ│У?`ЫБN$mЛРxvБДЗЪБfjtxНнР%NНгБoxztwЙЫпЩИБs<#Y{ЕИРЙ\M`oimЙгМzsrВТoXП═▀╗ЛЩФМЛЕ}wojRGf{nbYeuДОе╢аТy2=nzZEEF4&0AVnxcR$ ;ZtСЫ~nf-"2SnmSE?,,Oao||e`h[>"&G_pomОбДДh JuШД:8N\gНЖj`pМЧдп╡╙▐╤╖йвблл▓йНhIXГЮ╢╩╒╨╘┌┌┌▐▐┌▌э╙╕йЭК}j`cms~ЙОФСРЯп╩▌в_iП┤╩╢нмо┐дkPtНШбй▓╗┐╩╨╫╥╨╟╝╢▓▓│пнмжедЪГuNEk}xv|ЬелйййкжЫТее╕░ЭКjfdО╞╦┼╗Г?KAFЗХ@a┴┘▓иийи╝╚▀▐╫═┼╖╕╢╛┬╚┼├╩╦╩╒╒╘╙┘▄▌█┘╪▐╒╓╨╦├┤╗▒▓╝┤╛╕╬╤╤┌ш▀рфхъЎщрчяххухшыччыыышщьЁ№╩iFgОЦЫ▓├▐тштфхуххфххххчххфтр▐рф▄█┘╫╨╬╚╚├├╟╦╦█├▓едНЖОПЬЫнл╣╟┼ъ▄╦╨еn4 aо╩РF=rРp.aй╣б~neR$ !5h}РПЫЮКr_F"pлмr24vСy0:~ЧЗz|}ВЪСsikr|Э╡p!hЮвЕvxuuxАМз▓аВb27mЙЗМЩХ|ddoomzУХГzmoКНmC?Yl}ПЖe<3RlГопБSHaowФЙ9SnrkjВ╢Р1-wЭЕG$T┤п!xШМvjyНyef}БwjyЛХzjДНВ}ИФвt^з╓╧аИЩОМЗБ{toaBIsЗrdVWl}ЖШ▓▓Ш}BMsgRNPH3)5KbАВyX9 "JiР╖▓ЛN?БЛa#w╛┐Шvjd8 ,V|ЙНШЬЗ{iP/@КнХl1:xМ^% NНЩУ}{ЖУНtkmmГзз]:ЕнЫ{xtxyy{К┤┼ЖI?_ДЬЮЬЮФМБtz|zxАУЦВzo~СЗZHTgtЕСГM*CfpК▓жcCMdevЩs#^|vhmУ│АLТа`17y╨g cРЭАot|АwiixВokАНБt|ЛЖАДШйР1'y╖╘▓НuЕНЛИГzrpgI@^~АiKMbx}П▒▒НЕ])2^m]JPRPF03XyПАnH&5Wо┐Ъr -Rnt`OF/'@aoЖБxleC! 1RozЕ┤╩|R=vЭv3RЗ~xtz|АzizПЩеп┴╔╩╓┘╨╩╦╞┐┼╪╛ШbЗ║╛Чwd{ИНВ{mojV5Ij~yd7Ej|Дй┬НmdB(IfgK>TTWP/3bПВiQ4 .LcР╣Ъr.9`pkVKB38KcxЙrgL"G[lДй┴}7 &OЕНMQООБyyЕБg^{СЯз╢╞╩╦╬╤╬╔╟╩┐┐╗еyIPsЩй╡┼╙╪╒╘╬┤╖╩╒┘╪╒фч╞кuHbБВssИТТХЧЦЧФЩдеГrМо╔┤иеГ\bЖЦЯи▓╝─╦╨╘┘╠├╜╗▓│▒вмом┤│йЗZKMnУУ|rY7I}─щц═│Уk_]_lДззwTnmvМЗI,]wН║ёї─pVВй▓жзнае╡╨╙╘╓╨╞├┴╖╢╜┬├╞╔╩╬╬╨╤╤╘╧╬╞╜╛▓Япо╕┼╦╓╓╪▐яфртхухцъъхщяшшщщшчухххутччххцфф▐ш■т|LvЪЮХг└т▌┘█▐ррутххттутт▐┌р▀ус▄█▌▄▄┘╪╒╩┬╨╫▄▐фщъшу▐╫╤╩┼╗▒еПoКЗУЧЪ▓▓лЭh.QнкS$LНКFBд╢М}~oG3|Еn~ЙМНЛzlWFQ{ЯЯp5CЕЖ= ,АлжМnhyВПЗncfwбиmaЩЮВmhttm}ЕОЗЖКЙС▓№╔ЖЦСИysz{zИРЙДБtБЗs]\ovvИЖa#*Riuб╚$(X_ZnЗ<AxugjxЮЭGHИ▓x"Q╖пdБЭаxazМodyНvbwВ~ББДДДГОТ_ VЬ╢дВamБИРБwopdJ=XpДm_>EpЗг╕ЙkbR/%YuZ>KYjd?0SxБpXA!:QpЪСw==cx\KPQJQ^iЖРyjW> :XbwЛ┤А90cКД1JРПЕy{Г|ГСxNW}Цго╕╩╚╩╦╩╩╚├├╗мЫАWShЛдо╝═▐█═╩├▓ен├═┘▐ш┌╣АVRsГБyyЗТФУЪЧСМХбЦАowФ╧┼кРjcjРЬен╡├═╤┘█╙╦┴йп▓▒░олмдн╕НuJ1bСаФkVI:u╝№ёсаЙrYV[b|Ю╝t@^gcaJ2Z~Чм┼й╙╖╓┤▌├мйегЩв╢╩╨▐с╩▓╣└╝▓┐├├└╟╩╩╦╩═╩╙├┬▒Шпо┤└╩═╒┘▌▌▐рхххртур┌ртттухххшцх▐хху▌уухххуу▌тч№ёШWvЫЬНб╗╩╤╪▐▌▐руху▀┌р▀▐▌▌▄▄р▄▄▐▄▌┌┌╤╥╓╬┴╩╓╪╪чыщщх▐▌█╪╙╨╚╜│бЮТrwwТмж┴ЬАO0yвЦ|=XЪ|Ab┐кРЕЕfC  EМБm{ЛЙбИ|pc\oР│Н`$\еt4@а╣пx_cwДЫБidoИ╢ЩY,СиЫt`kxx{{}ГбУЕДецЄкКОНЗzdkntx{ГПКБ{~БИu[huu|УСE3^gВ┐═] 4`TOs|\Аl`iН░О'ZЩ┴R "p╦X ]yМЬВdwЙ{Ygz|opЗ}zВГДЖДЖМЬН:)┤─Пbi}ГГЕ|wohW@IfАГeL;Yй╛~NX[:,MlfJL]k|\0;e}xaR2,<4IbБДjH (KmjZ[ba^VcvЧИn_R/!9;P_vxwm;!EtФ^FСЬЗ{zДГЕКДk\Xwдео╛╒╦╩╩├┴╛╗╛│ЯК`Tc|Ъм║╔┌┌╪═┼╝▓бЩ╡╩╫х▌╖ОRNjЗУОБz}СЦЮдШРУШЮЮЛw\ZЫ─жДuЕПезн╖╗═цфъ╫╬╟┬▒▓┤│▓│нзабПaXT^Дй╢КMILEJЛ╬їё╝{zzcWYcxЭйybeQ@A0Gv}Чи╣Ч>7GЙ╦с╨░йебв▒├хъ∙▌╟╖┐┴└╜┐┴╞├╔╞├─├┴└╣о░бж┴╔┘╫т▐█трттхуххтхххсфх▐ццшчхшхъчщшцхцчххххтфэц№ьоnxабХд╗╧╤█▐▐тхшёч▌рщтрр▐█р▀▐▀▌█┌█╪┘▌╒╨╔╔╬╪▀∙юЄэччхцї▀╒╨╠╟╞╕▓ЧГВЖЧЙЦЪФдkW[xШдМ^,'dМr*'Д╛иНВy_.aИБ{~МПКБzho~Эмw87nСi![┤╕Дh[cwОЧАimzТпЖ:JЯдДngxБ{h^gЗЬОyП┐ёша~КН}NI_mvvpИЯСЕБГД|jfsy|ФНh27Ypл╩У;5JOZN 7hm`YpпбQ 2M]l>Aг╛ 7nДЩЗnnГГveoyvsw~}zrАЗЕЗИНЭв^`Я├▓ДfuА|ББypnhE:Z|ЛАO1GlЪ┴ЗN@QC$8^k\PZbtlT8HlГh\F2?fM:TААkO-7el]]bnpVSf}Аwf[N49^RHWeux\A! )Q|БXBСмФБsv}ГКЖ{tnPTФз▒╚╥╬╔┴┐╢▓░░еЦ|`]pЛе╡├┘▐┌╨╚╝▓мба▓┴╨┘╥аhJR}ЩмпШБ|ЕУабЫЩЩХЦЭМgY]ЖждК{Пвм░│┴╩╥щь▐╙╔╝▒▓╢╢╡▓▓▓пиОmQKlЕЫ└─Щ_EgИ┴╠╒┌мВ{ykaZYnЬ║НtO59@PvНРЯ╝┼и1*Н┌╨йиеЯе╛╬цЁш╨├╖┬┬╛╛╜╝╜╛╛╝╝┴║╝│Э░╖┤├╥┌тршцчфцухчхцшчшъч▌цшхщьышуфчшщьыыъщхшцфутучтюц╖АЗЩЪХв╖╩╒█▐уцхтьч▐хчтс▀р▐▐▀▐▐█╨┘█┘┌┌╤╤╩╚╝╩╪ыьЁыэьыщэ▐┌╫╒╥╨╔╠╝збЪЧЖxЕКЫеЕВЛЪкЭyK0FvХ[CТ┬дГvuS0rЭЙwyzЗШЗЙ~ltЖвйb1*BvЪR "}╝аx_[k|СФ{zy~Ьлp-bеЧ}z{~ЖdF]ОвЗ~ихЄ┐НДКК`&8fpytyФйФЗИГГxluz|ИПzT$@hН║нx**NiХw(Of^PZН╡БF L}9c╧ВQuРСpkxzvuvuprvyytu|Д~ДНХЭА'Iy┤╛Уpf{А}Г}ols\)>mИБd'(WЙ▓Н=/?K/#KbbXP`ilXC;Xpv`Q@Jhe5BiВnV7(Jd`^afvjGWsvg_S[VN_dJK_ppdC*5cys`;>Б╢иМ}nhzГИ~zЕxGKКзн┼╦╚┴╝╡пмеЫЪЗkbi|Ъ░╝╩┌х╓╦├║кекм▓▓╜╛пГTMcОм╩╩╖Ш|zБСЩЪЩЪЦЧбИ[^yЕОЩНГРго╕╣╩р┌▀▀╙═╟│й░╡╢▓ой▒╝ЪlZTaЗЦг╝├нМnРн┴═╝╛╛йОАzniWRjЧ╝Ъ[)3P_uЕОШа╕╘╚L [╚╥млзби─╤чш╘╦┴╢╗║┴┤оиг│╕╡╢▓ао╢м┐╟╩╤╪▀ффшшчцшхшфшцчшЄычтхшхшщщшххццшшъщъэчцххутсс▀хр╞ЩФЛЖНЮ▓╩╙▄▀ттт▐учххур▀▐▐▀▀▐▌█╪╤┘┌┘╫╒╨╤╧╔╗┴╬█чюьээъът▐▄▄▄╫╫╒р═╛║░еЪГyЪРОФЫимФoEC`НВBXи├ЦrtmC BЕСАuwzКЕКУzfoКлПW%*XЧВ9@Ч╣НiW`sВЛЖАБ|ГзЬ^(zЫШе{Xe`Zmz~ЦН~К├Ё╧ЯКАЙx8MoysnwЬмОГКДВyx|x~РСh.1Xtе╞Ч@=jЮбR/XYNRnеоs;<ДX$Н╤$EbБНАnnyzyxvsslmorspv|~|АСЮЙS$]}╖╜QeГБ}БwhikB"M{ОoB>kбПF!?H-0Vp_VReuiA'Hind\OOloH)Mp{aA" A\i^`bhrXG`ug[RM]cceWHQdsiQ-%FksnbN\Ь┴ЭЗ}jkyДН}ru~NTКзп╝├╛╗╡плеЯФУy[dsИе╢╛╦┌▐╨╚┬╡око▒▒о▒зФfCXzЮ├┌╪╤┤С|o~ТЯЩЧЧЫаЗ[\{ЖЗЗНТЬи╡╝├╨х┘┘╒╬╚┬╣йн╡▓│нейл}SN`АЩбжп╝╕╡м╜╙╙╩╢▒░бСБyrj[XmТ▓~1LmЖЧНЧЮЯ░╒хrT║╚пздЮм╞╪х█╨╚└╢▓поЩЩХЪ░▓жнЯЩо├╞╬╠╒┌▀ффтчшчцхххчхххъячхцшфхффухххххухххтъшчххтсср▐р▌╩пЩtrНЫ░╩╤┌▐▌▄р▀▐ут╫▐▐▀рррр▐▄█┘┌╫╘╘╨╘╫╤╤═╣╜╦┌тъыыщьшхт▌╫┌▄╪╪у╩╟├├╣мЬЛЖn|ЖМХСв╣нФcOYtСr,p╗║Бktp2VНЯДwklwВЫНlguНЮЙC%GvФpXд┤|]XgwzДЕЖЗПеКM @Зм╖~<8dБywrАМКГе▄▄╖Цyvd"%_~wkhВдвЖЕЖЕАxxzzГЧВC$KcГ┐╗` WУ╣Н ;ZRT`~╡м[ IСp-?╛╣\|СЕzyxxvutusojsnlostx~ЕДПЫs71Y{░░oHjЙА~yomd[13\ЗО_2/YДК?$A=*@is^ZdpБ^dbb^e[00Vrw_5%Nko_agi_JTcf]SS[bgmbNHXpx_;#8VrvneRkн┼ФБВrx}ЗТИa)?>_Сп╢╖╖╖╡░мзЯЪХКbOsВЦм└╦╥╒╨╠╟╜▓▓о▓╢мЯеаВM@kО╢╘┌▐у╬╢ЧwoЕдЪХЦЪСЖk[kББУЮ▒╖├╟╦╨╫╒╒╤╦╟├╝╢▓╡│▓пкЬuaY[yОЪзп▓╣┐╚╧▄ь╒╠╗╡нбТД|ldcosАНL!FfsЪ╢ЬЩвик╨°е.g╖╢йнев░═▌ч╓╧├╗иЧЦОЕСФд▓евлбн┐╩╤╒╘┌тхххрхцшчцхчххуъчххцчцшъхуфцх▐хъуутхрхцхцххтфц▀▌▌╧▒Уc^ГЫн╟╙▐█т█ус▐уу╒▌▐▐фщхфсс▐┌┘╪╘╒╬┌╫╧╨═╜├═┘▌тщъъщычхр╙█▄┘┌╪╬╤═╩╞╕огЦ~pyБИНУ╣║┤ШoapНФ]$3М╦йsoВa&%nнжЕ`W`xЛЫЙjn}ОЮwAEbЙЧP!k╣еmQ^or~ЕЖННЖПдГJgигz=:uТ{wovДЛНа╝х▀кБo~<;zldnДжбЕБЕГ}zyz|ЗШr-7]lЪ╨Ф; 9yм┐\ PbY\fО╚Н; VгЧHuьa NwХЭЕxzyrrooljo{vhfttftБОИФЫ\FeНйИbc{|xsph`L)>gРВN"?yА; =I%%Y{f\_oz2/dickkiuwG[tlmmК┤еай╕╛╚ё№╨КОи╕нн▓пн╢╙Ї√т│▓ВZ^`ГШЪдеЫ▓┴╟╙╒╒╫▌туу▐хчшхх▐хфхтчшхшх╒сцшщх┘шъьыыэшщщчщыщшшуухщщфхх▌╒╫┴кv0.C{ж╠х╫╪▐▄▐▀█▐▀▐▀▄▌▐▐▀█ррт▌▌▄█▄┌┘╪╒╒╙╤┼╝┼├┘ухшъьыщх█████╪╥╪╪╒╨╚╗▓мШvsБА|tzЛж╗─СГА|ККIБ╕├ЗcpЗFi▒╫|''ZlpВОЕЖЙЖа}fsНО{4a┤╙uENltx~ДУнЫОТФk5u╓dNБ}xyyzxc]ЧЫкфЁе|ВНuR^ВzssАХнТ~ЖЛГ}z{yxОЩ= VgИ─цY$cж╛а(:o]]fyж┬`"^Ш╡RZ┌жZБВЖВstxvoniN?fНrMRlnQZyМПЯ▓T\Фне|dc}Гzsnl`41mШТL1Бj#Q; Nf^\\_hW "RfilppЬ▓Z%dsX@!Fgwlg^R<"K|ЖzZWtvС`,jДnH&#?ZnПж┤бЪЪгЮШУХгдМi}гШCGЗ┐╓├▒пкЬк╢дЪСxccsФн║═ъч╘╦╩└о╖╗┤│ом▒╡НROrЩ┤╚┌╥╨╓╙╘╩╞╛йИКНШГMTxznzСЮл╗├╩─╬╨═┬├├├╣╜│╢ииЫ│╝СTVptvЗПЧШЬйм╟╛┐╠╓╬┴╢│▒жЯХСЗ~xW:K[gХtGO]Е╣оЯл┴╟╦сю╨╗╖│▓окмн│╛ъ∙√йmdKaБЕТЩШи▒▓╚╚╦╒▄╪╪▐▐▐хтычххууххххххшцф▄фцхшьртчяыьыщшчшцшчшЁу▐сшт▄▀ы╒╙╟╣кДZGcМл▐р╩═╧╥╨╨╙╙╒╪╓╫╫╫╪╘╤┘┌┌▐▌▄▌█╪╒╒╓╒╤╨╦╜├┐╒█тчщьъшт╒╨┌▌┘┘╪т┘╫╙╨┐пйеНnrys_Y\{ПЬТЗЖЖГМx.9Н╝░xiyo-#Д╩░S*alsАЗЧЕxНН|o{ИВ`$К╞еgAQlty~ЖЭоУКНБbL[Пw28czxzzyzwgdrЕТе╧у╞ЩmДХf 8lНАwzЕХЮКБЗД|ooyvxЕ^%)^vа╚Р)AЕ╗пN KcbalЙ▓З8 2lЯК1%Ыч'Cit|ysvwpmwzZ8Nyz^M`iaTc{ЦЮжxl▓╣ЧiQnИИЕzplsKMЗ▓s'HГP 2F( ([r[XZeV= 0cxznnН═|#?naB(,SovsV;*0X~ИrctУgVEBtД\/-LdЮ╝╗лЭУЧЧЩЪЮеШxeГХУ}eyДк▌╝лнкгйобЦНnbkБв│┴▄ьх╤╔└╖к║╗╢▒мп┤Ш^I\Ле║╠╘╨╨╤╘╙╘╨╦╦йЪТН}8EjouЙЮм│╗╟╦╦╥╤╩┐├├├┐╗┤▓кеЬЭЧlLQzЛjr_i[~Кл▓╝╓┌╒├└╝╕╡жЭФПМfI7AgЛаxVP?eЪ╕з▓╟╓╨┌┘╦╞┴╖▒мвлл┤╚┘тоkTBX~ПЩЮей▓╝├╠═╨╒╪╫┌██▌▀▌уцф╫тххххххччцх▄хртсщ██╒чщщъш▀стхтр▌ф┌┘┘┌╒╥╙╘╦╚┬╕╡бТДХб╝╬┌┐╝┐┼┴┐╞╙╚═╩╧╩═╬═╠╨╘┘█┘┌┌╫═╓╫╓╘╨═╩║╛╗╬╪▐хщъышт┌╬╙╪═╒┌▀╒╙╬╧├мПЮкВjkraI9K_~НОСеХТП\ Zн┤УsixcF▓╚П/ 8dkmz~НЛБЕНЖ|swЛ|SHй├вY3VorrzЙгбРНК|ГЮm&8]rtxyxxzxomnm~Я┬▐╙║ДsКН<N~МА{ЕФбМВЖБspyyomgW ?iЖл░oWЫ┼Е3&WsffuвЫr$MНЭo[фп!^kjsrtpmbnГp?>j~iPXfeYWnХ░ЯH/И┐├КWVБНЖБtmvc&2gелTaА5>5=lt\XYR4IxС|oеУ. &^y]5:mwkX, E_mxjyбw'.^ГxG">XrРй╗╖еУ~ГЫан┤вЛncАПЮЪНЙЖб╦╕лййжжлЬОooВФн┐╙хы▐╬└╖║╖╗╣╖▓ижЯkN\zШ░╚╠╨╨╙╤╩╒┌╒╤╫├еШОW@JdtТи▓╕─╨╫┘╫с═├──├╛╜╜╕│онХw^bgКЭЪГГomaoЛг▒╩╦╦├┴──╨╢нзЩlgДДТЬеп▓╛╤╟╚╩╨╥▌╪╥╬╒█рртфттр▐ххчшшчччцфххящщшщчшщшххррч█┘╪ц╤╧┼┬╜╝╝░лм╢илееаЩМyЙМЗНТСРСПМЛХМЕ~ПУвайвй▓├╝╔╩╔╨═╒ч▄╥╤╨╨╒╬╟┐─═рчщыэёч┌▐▄╓╓╒╒╒╒┘╤╓тЭLIод{pxi%RЛЗПгенвwI*!YУ╢ЦxktoE'Ч╪Н@#Vmnt|ВЖПбвЙАtvЕИZ$У╔П`CQgnddoВЪ╢п▓ЯQFm{}vy|txzyy|{og|Ю╗═╨╕Сo}НbGxФЛ|xЗПХСНЛИА{wkWSYK%3\А╛╟] KЯ╬Я3SvpeuХ▒{@)PУеh" B┬╟ *hysdclu`YkЕiG?ZПАG>kuI