%PDF-1.4 %ту╧╙ 1 0 obj << /OPM 1 /SM 0.001 /Type/ExtGState >> endobj 2 0 obj << /OP true /Type/ExtGState >> endobj 3 0 obj << /OP false /Type/ExtGState >> endobj 4 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[255] /FunctionType 0 /Range[0 1 0 1 0 1 0 1] /Length 699 >> stream XЕ ─░ ╤{^l█╢m█6l█╢m'k█╢mЫ╡{╗ъ4╩S│─6┴▒└╧_B"Й=H$ї!@6╔bфРЬFо#╖фI0ЄJ╛#гА╠ЖQH g╟(Тги╦ЙQ\Jф┬,Щ│ФФ╬ГYF╩ц┼,Ч│╝T╚ПYQ*└м\│КT-ДYMк╞мQлж╘*КU[ъ├к[лЮ╘/Б╒@Ц─jT л▒4)Н╒TЪХ┴j^лЕ┤,З▌JZЧ╟nS╗н┤лИ▌^:T┬юX╗УtоВ▌E║V┼юV ╗╗ЇиО▌Sz╒└щ]зПЇнЕ╙п6NPgа кЛ3╕╬ZgШ oА3в!╬H╒w┤МiМ;╢ ю8▀wВLlЖ;й9юdЩ╥wкd╡─Э╓ w║╠hН;Sf╡┴Ы▌oО╠mЗ7Oц╖╟[╨oб,ъИ╖XЦt┬[┌oЩ,яВ╖BVv┼[╒ ╡мщО┐V╓ї└_▀ГlьЕ┐I6ў╞▀╥лlыЛ┐]vЇ├▀┘Чь@░GЎ$╪7И`┐LpP !8<ФрИFpLО'81ВрдЬIpZ╬М"<;ЪЁЬЬCxa,сE╣4ОЁ▓\Oxuс5╣>СЁЖ▄ЬDxk2сmr√в;ф╬йDwe▌ЭEt╧4в{х╛щDў╧ z@ЬIЇР<<ЛшС┘DП╩csИЧ'ц?9П°)yz>ё3Єьтч?//,"~Q^ZL№ЄтWф╒е─п╔ы╦И▀XNЄж╝╡Вфmyg%╔╗лH▐УўWУ| о!∙h-╔╟Є╔:ТOх│ї$Яo ∙B╛▄H·Х|╜ЙЇЫ═д▀╩w[H┐Ч╢Т■╕НЇ'∙y;щ/Єы╥▀vТ■.ь"¤S■┌Mця=d■СўТ∙oЩ /9╤X endstream endobj 5 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[2] /FunctionType 0 /Range[0 1 0 0.6 0 0 0 0.06] /Length 20 >> stream XЕ ┴@  OгШ ■¤ endstream endobj 6 0 obj << /SA true /Type/ExtGState >> endobj 7 0 obj << /Width 821 /ColorSpace/DeviceGray /Height 1203 /Subtype/Image /Type/XObject /Length 987663 /BitsPerComponent 8 >> stream                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ■¤¤№¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ■∙ёх╫╙╓▄▌▐рррр▀▀рюяЁячс█┘╓═┼╛╝║╗╜╫я¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             √ф╥┐╞╩╦╧╙╘┘┘┘▄┌▌█┌▄▄▄▄█▀▀с▀▄╪╘─▒дЫЧЦХХЪгн█°                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       √▄║┐┼╠╦╬╬╧╨╤╧╘╒╪╓╓╫╒╒╘╘╘╘╫╫┘█▄┌╓╥╠─╡гЩФРСТССУШжу■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  Ї╧─╩═╥╘╙╥╬╬╠╠╟─╚╚╩╔╔╩╔╔╟╚╔╔═╧╤╫╫╓╒╤╬╔└╖йШУПМИИЙКОТШ╣є                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              √╩┴═╙╫┘┘╫╒╬╔├╜┤окйлнпннлммн░╢╝└╚═╧╬╬╠╩╚┬└╗огЧНИДГВДЗКМТЮр■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ┌┴╠╙╪▌▄█╪╓╤╔╛┤иЫЧУТХЧЦФФТТСТФЩЯи│╗└└╛╛┐┴┐╜╝╣┤йЩЛyy{|АБДКРЮ─ї                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ю├═╓┌▐р▐▄╪╙╩╔└▒вЧСОППУФОКИДГВГВГЙПЦЬвдйлп▓╡╕╕╣╖╢░жЧЖyuutvzАЕКСЮз┘∙                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 °╬╩╓▀тфутр▄╒╨╧╠╚╜▓дЪХТТСМЗЗ{vvwuvx}ДМПТТУЩЭадл░│╣╕╗╕мЮМ~{vtvzАБЕЙПУЧЫ│▄є№                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ■┘╚╙▄учщшчу▀▌╘╘╒╙╧┼╝▓дЮЭЬЫШУКЕА{xvt|~ВЗКЛИИИКУЧЫбзо▓╖╖╡пзЧЙ~xvruwzАДЛОФХТРУЧе╬хЎ■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   т╡╔╫рхщьъъшхт▌╪█▄┘╥╟╝обЫЪЫЫЫЬЪЩУНИДДЖИММЛКИЗВАБДЛФЬвйо▓╡╢╢пдЪПВwrppt{БДЖКМКЗЙКРЦЬае╞тў                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             щп▓┼╪сшыьььъхт▀┌╙╘╓╙╠┐нЭХППСЦЫЬавждбЮЩФСПМЛКИД|yyz}ГОЧбжл░╢╖┤│пгМunghlqxzАДКЛЕДВАЗКОЦЯжн▓═я¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ¤ы╔ФЮ▒┴╥▀цыьэьъчфр▄╫╥╒сс╧╕ЭОВz|ЕМХЬвко▒плбЫЧСМКД~xvtsv{ВЛЦаем▒┤▒│▒еШГnijkmpty~БВВБАБВДЙТЧЯвдн╖├Ё                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                Ї╨ШСТЧЭд│─╤▄схшшшчфс▌█┌╪ш°ъ╤пРsmmqu}ЕПЪдл▒░мквЪУНДwwqrqnruwВЛУЫЯкмнпойЮПnlkknqtyzДИЖУУРКДДЗНУУТЧз┤┬ё                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           №█┤одаЫШЫЮдо╝╚╤╫█▌р▀▀▐▄█┌┘▄чьц╦вИvnhlou|ВКТЩЮвджйзеЬОГ{vqqnmpquwГКСШЮбджежеЯЧ~snnlmpruuzГЙФЭбжЦКЙЙМСРОСЦа░╓                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        Ў┘╤╧╚╛┤еЧСФШЬбз░╕╜┬╟╦╨╤╤╥╤╥╙╓██═│УБsmjosxЕМНСФЧШЧЬЯЯЭХИБ}qropsxy|БЖЛРЧЬЯбаавбЭРВqkijkmqru{ГМЫ╢└╛▒ЦНЗКМННОПФЭ┤Є                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ю╓█рт▐╓╔╕еЪТРООСУФЦШЪЬдм┤╕╖╣┐┬╚╬╧╔╣жФЕ|x{ВДИЙКЙКЙЖЙНФЩЬЭЦМЕzttwz|~АГЕЖЗМУЦЩЬЯбждЭЩК~wqnlkmqv}ЕХ╗╧▐ш╚дЛЖЗЛММЛЗМТХШг╟┌ь∙                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ю╘▌хъыъф┌╟▒ЪОИЗЙМСОИГДЕЙОСУХЦЧЬгл╡╗║╡окЮТОРХЩХРММКВ}yyАЗСШЪЪФЛЕ~}~БЕЗГДЖЖЖЕЙОФЩЭбжибЯЬУЙВznkjnsyАКЪ▓┬╟╗ФМ~}АЕЙКИДДНТХЦСУЦЯ▌                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        я╙▄фъюяюъх┌╟╖иЩЧЬзбЩН~smko{БАxrs~ЛХЯежио▒п▒╢┤кЫХПМЕytprtyАИФЩЬЫХРМЙИЗЗЕДДЕГВГЙЛСЩЭдивбЯЬУЖ~togintw~ЗНРРПИ~xwz}ВЖЖГ|БДЖИКЗГЕОЩш                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    э╩╒сщяёЄЄЁьчр╒╟╜▓┐╦═╝ЯО}oebdsВxmb[`evЕПЧаи╢└╚╠╔└нЯФНГspmmlqv}ЖРШЯЭЩЧФПЛИИЗЖДГЕЕЕЗЛТЩЮбваЮЯЪПГ{wokklnt|ГЖЗЙ{ggimqv{~ГГБГБАЖКГ}~ДМ║■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                я╝├╥▐щяєїєєёЁэщх▐╘┘▌т▀╤│УБncaitqha\Z_ekszАЕСа│├╨╓╓╦╣еПБzrofijquxКУЪЯЯЭЩФРОЙЖЕЕЕЗЗЖДИКТШЭавЮЫЪЧМД}wqkiimqw|АВ{ka`bflpu}ДД~ДЗДВГЗЛЦю                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             №╟╣┴═╪уьёЇїїїЄЄёЁяэьььэщ▐╦жДullmona\[]cfmonovЕПе╗╬┘█╘└иРАvpkdgjrtzБЗСШЮаббЬЩУНЙЗИИЙИЙЗЖГЕПЦЭаЯЪШШШСИБ|qlijloswzyqd]ZX`glt}ДЖВ|~ВЕВЖЕВЖЙ╖                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           с┴┼╞╩╨┘уыЁЇїїЄёёїїїїєЄєЄЁщ█├ЧКВzsofXW[aikqhdkvГЗПп╞╒╓╧┬нРЖxmkjlqx|БКЙНУЪавевЭФРНКЙЗКЗЗВ}ДПШЭЯЮШЧЧЦПДwrjjmoprvy{tgZWY^emu~ЕЕyx{ВЗМНИГДВПЇ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ё┴╞╦╠╦╩╠╓▀щяёЄЁюьэЄЇїЎїЇєєЄюх┌╩╡ЩЛ~kabddfiig`gpv~ИМж║╚═┼╢иЬПАtrquzДЖИЗМНУЫбзлеЩХТНЛИЙГ{vtyzДЙРЧЬЭЪЧЦШФМИД{tqopomovy{ug_[Zcjpw}ДГВzvzДЗЙКГ}|y~─                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    №╟╣─╚═╔├┬┼═╪уыЁЁючтчэёєєЁЁюьььщц▄╦оФВlfhijjhdehoxАЕДЙЦ▒└╜░едвШНВ~|АВКЙЙЙЙММОХЫдмиЮШТОЛДВ|yyy|ГКЙМСЧЩЩЩУФФСМЗВ}xrnmjjntx{xnhbdjkpt}ЖЖ|tuzБДЗГ|yvxzР·                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ▌▓╕╗╝╜╝╖╢╢└╧▐шяЄёъс╥╪хэяюшфс▀сцччс╓┬еРЖ|qomje_ekyБДДДЕПн╕мШЩЫЮбЪФПНЛКЙЗЗИЖКИЛОЦЫдевбШПИ~xx{}АЕИЙЖИЛПЧЩЩЦУТУФПКБ~tmmiifnv{}{usomlmow~Е}trv~|yworuxy█                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ∙╞└└╜╖пкзй╖┬╤сшяєЇєэ╪└╔┌ртс╪╔├─╔╓▀тс┌═╗гСДysojcclzДЖЖДЖГКблаМГСЪЮввЯЬШРНМНЛИЙИМЛСШЭабЯШРДwyВДИЛКМИЗИКРЦШЦХРПУФПБ~uookihiqyАВ{urnmty}|xx~|w|}zxomqtttЦ■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           х╦╬╦─╗лгЯЯо╞┌хьЄїўўЇы┘╦╟╩╠╦┬░ЭФЦд╝╠╒╓╘╠─╕зЦЛ~vnhm}ДЕЖИЕЖАВЧЭХЕxГУЭглозЭУРНЛЖЖЙЙККМРЦЩЭЮЪУКВВЕЕИЙИИЙЗИИЙКТЪЩЩФРСХТАwtutplhiktЕЗДГА}wty{{z}Г}ruz{ywqrtssxВш                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        ¤╫╘╓╓╤╩┬╕мжл╜╪шЁїЎ°°Ўёц╓┴│квФИ~y{ГПа│└┬┬┴└┬╗пдСАzzБЖЖЗИЙЖД~xАЕrryДЧбн▓ндЪФСМЗИКЙКЙКЛОУЧШЧСМИЙЙКЙЛЛЛЛКККЙЙНХЪЪУПСТОГ}z{ywrlkinwГЙЗДВБА|ywzxxxxxqpty|~zxuttu}╖                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ю╘▐▀▌╓╙╙╧╚╜╝─╙чЄў°°°ЎЄъ▄├бПГxonhhnzКФЫгжжй▒╗└┐║нЧНММЛЙИЕВ~zuronikqxГТЬк░▓иЬЦСКЕЕИИКИИЗГЖНФФТОЛМЛКИИККЙИЙИИКЛПЦЩЦФСТПКИДАytmjfgnyЗЙЙЗЗЕДДzxwxwsqgjltz~ГГ|zyxz|КЎ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ■┌╪сцт▐▌▀р▌┘╙╤┘фяЎ°ЎїєЁф╓┴вЙБ{qkgbhq|КОСУУУЧЮо╝┼╚┬╕зЩЦФОЙЕВxqqsqmjiq{ДЛХЯимкЮШТМЙКККЙЗДА}xМУТПОНМЛЙККЛЛИИЙКЗИЛПХШЧСПОМНННЗДАsnigkqzЖЙИЖДДГАzvwzwob`fov|АГВ{zyt{Г╥                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                є╘▀хшъщчшццчуррхэєЎўЎЇюс╬╜гФТОВxjdajwБЗКЙИКДВКЪ░┴╩═╠┬╢кЪСЙ~xqpstpkllq}ЕМПУЬввЮШТОЛЙЙИЗГ{uyБЙТЧУОООКИИИЙИИИКИДАВИРЦЩЧТРСППНКЖБzqgfijsИЛЙЗЕДЕwtyxpcbcfmu~ВВБГГБzy}ВЫ¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ┘╫ущэээЁэээыщщчшьёїїЎєюс╬╜┤░лаЩОАgbhozБЕЕВБvsЛЭ▓─╨╒╨╚╗йШКwqsuqkhjoyВЗИКПФЫЫЬЩУСОКЙКЕ}ywzДЙНУХТОНЛЙККККИЙКИyu{ЙСФЧХРРТТРНЙЗАvlihhnvБЙЛДЕЖДГ|wvvtlgcfjqy}~АВДЕГ~ywz~Йт                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          √╔╘тъюЁёЄЁюьщцхттцъэёЄєёьц▌╘═╔┬╢ЮНzihnxГЕДВzwrtw{ГЭ╣╠╘╒╨╟┤ЫМ|uqtqokkpyГЗКККНОСФЩШЦТОМКЖvvzБЗККЛСФРНКИЙЙЙИЗЗДВzz{~ЖОУХЪУНРУУНМЙД{rmggjnxВКЛНЛЗВ~zvuvvmccfltw|АГДКЗВ{zz~Дп                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        э└╨▌цыюЁЁяьъф▀╪╥╬╤╫▐тцъыыьщцу▌▌╫╔иН|pnyАДЗЗВ~pmiifhwМк└═╤╧╩╕вМ{sv|mkjqyВЖЙЙИИККМРХЩЩЧТОЖАytxАДЕЗЙЙЙКССРМЛЙКМИИДБ|{}БДИЛРУХХРПТЦТСЛЗАxqhffjs}ГЖИДАzwvtrsyznefkoty}}}{xurw|~ЙЁ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ▄└╔╥▄ущщыъчт▌╘╩╝омк┤└╔╨╪▀учыьыыът╘╡УБv|БГЕЕЕwihggfiuИЭ▒╛─╚┼╗зМ|}}xiimwАЕЙКЛКЙКЙЛМТЧЪЧТО~{xx|ДКЗИИЙКЙНРРНЛЛКИЖЗВ{}ГЛРПННПФУУСПРППЙЖГ}vkhegnw~ГГА|urrrvwvzxmdgjotx}|qpxytmmrx|ВЗ└                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ■╚┐─╔╦╤╒█▀т▀▄╪═┐оЬЙДКРЬил╢╞╒сшэяюэч█┬бМЖИЙЛЛЖxqfeeaaf~ИУЭл▓╖╝╖иЬПВ|tils}ЕИИКЛИЙЙЙКЛНТЩЧСМzz~ГЖЙЗИКККИМОПННММОЛЗЖДЙРЩЭЫЦТМДНСТСРНОТНКЖВ|meadjovБ|{wtux|wxy{{qhhmqtwwrjpxuokrsx~ВЖФ∙                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               ў╗┐┬├┴╛╝╜╩╤╙╙╠┬│ЯН~v|БКСУПФи└╙▀шьыыц▌╦╢вХФУПЛЖ|plhe^]ctГЙОФЩЮбкнеЫТЗ{rkq{ГИИКЛМЛКККМКОРТУТМЕВВДЖКЛЙКЛЛЛЙЛНООЛМНРОУЪвй▒░╡┤еЦЛ{~ЗРРОНЛНММИБ|pe]`einwБББ~АБАxwwz}zrjnqrvvsuw{}}wusuy~~|А╘                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             х░║╛╜╣мЫЫе╢╜╛╣йЭРГzz~ГЛМЗВ}ЙШм└╤▄тур▌┘╙╩├║▓зЩРДuhhda[an}ЗЗКМЛЛПЦЬвЮЧК~tryБЖЗИИЙККЙЙКМКМЛНПООМЙЙИЙИИИЙКММЛМОРРОПСЩЬл░┤║╖о▒лгЦЕrvzЗПРЛККМРИБ{oh[YaejozЕЕДЕЖДЗxwz~~~vsqsvwwux|~~|zxx{}|{БЫ¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ╬▓╡┤│╡наЭЦЬйлеШК|spzzЗНЗ|x{ДОЪп╛╚╧╧═╠═╤╤╥╧├╢дХДpcda`aivЕЙИЗЗЕ{ЙТЧЪЩСЕyxАДЙЛКККЛЛЙКККИЗЕЖЙМММНККККККММПРРСТУРООРЪзмонмдЯЫЧУО{a`jyИРНЙКЙИДyml`Z\cijqВИИЖЖЖЕВ|vv~БАysstvzxz{~~~yw{|yxИх                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ■╟└╢пллпо╕╣▓мвЦИ}tot}ААДЗКАusxАИТШз░╢пел║╟╤╓╫╥├░ШГoe_]]csБЕЕДДА~vr|ЛУЧШХНИГЕЕЙИЙИЗЙЙИИЙЙЙЖ~{БИЛННКЙЙЛЛКООУХЦЩЪХОЛНОЦвйлкгШРИ~tk`WX^m{ЙСНЛККЕА{vsjc_`eip}ГЖЗИЙКЗДwx~ВА~xtstx}}{{}ВВБ~{yz~xy~Г▓                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     №╩╔┴┤ои▒└═╥═┼▓ЧЖ{rnt~ДЕЕЖЙЖxnr}ДЕЛУЭдЭТЛНЬ╢╚╥╫╙╚╢ШДme^Z`o{БДЕДБ{xqr|ЕМСФХФСОМИКЙКККЙЙКЙКЙГ~wuwБОСОЛЙКМОТУЦШЩЩЬЫУЖДЙНТШЯбЩМАvohb[Z^`ckuБМНЙЖЗЕВА}~xpf`aflu{ГККЙЖДВ~yuvАГАzwuw{ЗЙЗДАВГГ}zwtz{yyzОё                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ∙╬╥╧╟╗▒┤├╒▐▐╪═нРКБ~zДМОПМПЗxr{АЕЕЙУЬЫНАvyЙЮ╕─╠╠┼╕ЬЖqb]_kwАДЖДА|vqos}ГЕМТХЦФТНМКЗИИЙЗЗККЛЕБzqrzДЛООЛЛНПСУФХЦСРРПКБ~ДЙНПОЗ|rlhhjigedijms|ДЙЛЙЖЖЙЕГДБxi`^^flvАИЙЙЙЗЖБytszВДГАzwtsЖЧЧНЕАБДБА~ww{}|y|АИ╔                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                Є╥╫█╒╥╛├╦┌хъыт╥┐┤кЫТЦджжЬФСГ{uxЕКИНЦЫУ}rjpБРг▒╣╝║│аКylbit~ДДКЕАwommyБyzИУЦФТСОМИЙИЙИИЙККБ{trxДИЛЛЛННРСССТУПЛЕztquyАЖЛИyqmoprsrrtuxxvuyЕЙКЖВЕЗЖЖДth`^bfq{ДЙЙИЖЕБ~snwЕЖГ{vr{ТЮЩНЖГГГБxvv}}zxzИЩ√                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ъ╥┌▐▀▐┘╪█тшэЁёъц▐╪╧╚┼┼╦╩┼╕иЫЕxzАИКННЦЭЫИrjan|КХЫЯвеегШДzru}ДГВДyqnqu~~wq{ОХФТСОМЗЗИИЖЖИИЛ}urvАЖЙКЛКЛНРСПТРИ}wnhfdftВЗИДБ{yxzz{|А}{xtv{ЕКМИДГДЕГГВ}sa\[bis~ИЛЙЗЗЖВwot{ДДztswГЦаЩЙГЕЗИЕ~ysu|~xt{БЖИ╫                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           с╥┘▄сффусхъяЄєїєЄюьъччцчу▌╥┐бЗВДЗМСХЧЯЮХАhdcq~ЖКМООЧЮбЯШКЕГЕЗЗГБzwppw}zyplwЗТФУТСМИЙЙЙИЖЕЖЕ{vvyАГЗЙЙЙКНРООЖxmgbafhiotБЗИЖЕДВДДЕДВДГГ~ytpsyГКМИДДГДГЕЕД~j_\_emsДКЗЗЗЕxrrv|АА|yvvz~ЗХЯОАГЕЕБwtrx}}ww|ВИе¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        ▐╬┘▀тфхчццщэЁєїЎїїЄёёЄєЇЄёьф╙╕ЪХФЧЩЫдзеЭР{eehwЕЗЕГАВНЫваЬФСМЙЗГupmqyАБxsnmxЖОСЦФСЛЕИИИЖЕЕДВ|zzВАВГМОЛЛННЛГpcc_aelrw{}БДЗИИИДЖЖЖВВГВБvssqu~ДЙЛЛИЗГДДЕЗЗВth]^bgnzЕЕИЖДwqrtyАywtuwyДНЗ|yy{|}{usuw~~{wyx|Зш                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ╫╠╪▐тфхфтс▀тцыяЄєЇєєєїЎў°°Ўєэт╤│▓░лн▒╡╖оЫЗqaep|БДБАzmuБСЬгизЭФНЗД}pnov~rnho{ЖЛРФФТМИЗЗЙЙЖЖЕЕ|АБВДБГЙПОК{rojfhlt{АГДДЖИЙИЕЙЗЗЕГБ~yqmqw~ГЕИКЛЙЖВДДЗИЗДxqc]]cku}БВ{xuopssw}ВВ||~}zz{z|xrmpstllprv|БД}wvwxy▒                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ╙╦╒█руус▐╫╤╦═╘▄сшыьщъэёїЎ°°°ЎЄыт┘╥╧╚╞├┬└мХj_kwГГА|schqАУеопжЩРИВxnquzАА}mlmuАЖЛОСТТМЙЙЖЕЖЖЖДД~ББ}~skpvДРОЛБwqolnu}АДЗЖИЗЖЗИИЖЙИЗДАztpmovАГЕЗЙОЛКЗВДГЖЗЖЕАwc]\]hozАА|ywuxwvvyВВАБА{xvzzvplkqwsopsvy~ЖГxrtvvxАЪ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ╦╞╧╪▌▐▌█╘╦├▓ди┤┼╨╪▄▐▄╫█хэёЇїїїЄёюъчт▌┘╓╧┼зОvjdo|ВДВzui[\asИЮо▓маХЛАwnszА~ujlr{ДЗИКРТТПНМЛКЗДВГВ~АБ}wriaagsАМТНИВysnq|БДДЖДЖЕЕЗИЙЗЙЙЖА{wpmox~ГЕЖИИЛККИЕЕДЗЙКЙГ}jc]\ahq~~||{}}yuw}АДГГГ{wxyyuttrvtrrsuuxВzrrv|zyУ■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               ─┴╠╤╘╓╫╒╧╞╡жТКОЬ░╣└┼┼╗┤╝╨┌сцыыэюёЄЄЄЁьчс╫┼аЖochvАЕДВwme^_`lДШзпнвЬК}skw~Б{wnflwБЕЙЙЙНРУПЛЛКЙЕГДДББ}wske`ckmvГЛПНЛЖ~soxГДЖЖЖЗЙЗИЙЙИЗИЗВytpmrx~ВЖИИКИЛКММЙИЕЖИЙЗypf\Y^djwАГГГЕВ~wvyГЕЕДБ}wwxxxБОЗ~z}{yysv~~xqqqw|zz}Т                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ┐╝─╠╠╚─╚╞└▓ЬРЕВИФЬджибШЦа▓┐╟╬╘╪▌фьЁїїЇЄяш▄├Ъ~jep|БДВ}pe]ZZ_lГУЬвзвЭП}ru}БАyslhr}ГДЗИЗИЛРСНММЛКЙЖГ}skeccfkorx~ЖЛТСНЙБ|zБЖЗЗЗЖЕЖЕЗИЙКЙИЗВvpqsv~ВЗИИЗЙИЙИКККЙЖЖЙКИ|rl_Z]ahqyВЕЖДЖГАzxy~ЕЖЕЖЖГ{yyzz~ВЖБ|~~~}xux|zxuqswyy{|Щ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ╟╡└├┬╣╖╡╖│лЯК|АЕЛСХЦЪЧОДГПЧгкп│╡└╤уэєЎЎїЄь▐┼Ш}nlwВВxe^ZWZboВПХЪЭаЬТЕz{ВГГvplpxАЕЖИЗИИЙИМПОННЛЖА{mcbefiot|АВЗЛОТПЛЖБВЖЙИИЙЗЕЕЗЗИЙКЙЙЗtpsu|БЖЗЙКЙККЛЙИЙММИИИКД{wpme^\_dkr~ЖИЙКЗД|vvxАЕЖЕЕДА{yz}}АЗЖ~~zyvx|zvrrqv~~}zг                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ╞▓╝╝╖оаЯжвЭЦЕu~ГЖЛНТУЩИ}|БЛПФХЩЦХЮ┤╘хюєЎЎєэт╚ЩЕwsВГАyp^\YY_hxГЙНТХШЪХТМЕЕЕrmjs~ДДЕЗЗЗЙИЙМПРРМЖ}tj_^flsvz|БДГДЖЙЙПФСМИИКИЗЖИИЗЕЕИЗЙККЙИvrt~ДЕЙККИИЙЗИЕЖИИЛЙИИЙЕ|wuqjc^\_cmyВВЕИЗЖБyuuyВЖИЖЕБАxzz}ГМИz|ББА|yxzzzwvqt{zxzо                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        ┼▒╕╢йаЪФФЫЪН|u{ИКММОРРР{y{ЕЙНСОДДЛж┼╫хэёЄЄэт╦дКВ~ВЖГ|qi_]YZcq~ЕЙЙЛНТУТТМИЖД|nlqzБЕИЙЛЙЙЙКМОСРНИБyjeekqxАДДДДЕЕЖЖЖЖЛПОКЙЙИЗЗКЙИЖЖЗИЙКОЛЙА{|БДЖИККЙМКЙЗЗЗЗЙЙЙИЕЕЖБ{xwuna\]_fu~ГЕЙЙЗГ~vrxАДЗИДББ{xxw{ИЛ}z|АГБАyxy|}|xvssz}}yw╟                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ╩п╢░иЩСМРЩФЙyqyДЛЛОСУУТМuvДККМИГzwДЦп─╫тщэыч▌╠┤ЪНКМЙЕylbUVR\iuАГЖЗЕДЙПУЧСНКВxhkv}БДЙККИМНПССХУОИГ{rpqw|БГЕЕЖЕДДДГГБДЙНПНМКИИЕЗЖЗЕЕЗИЕВКНЛЕВАВДЕЗЗИЙЙЙИИЖДДЕИЙЛЙЖЖЕЕДГВwg\[]doyБЗЗЖЗДА{uv}ВЗКЖГВyvvwzГВ{y}ГДЕА|z}~~~zvtu|Б|xwц                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ╙жомжЭУМПРТГyuwБСЩЧЪЫЩЩХЖt{ГЗИККЕ|uxГПЭо┬╤▄ут▌╓╦╗лЬФТМГtd^YVZdq|ДЕИЕАyzЗУФОМЗБvhl|ЕЙЙКЛЛНССПМЙЛРСКГ~z|~ВЕЙЖЕИЙИЖГА|txВЙНЛЛКЙЕЕИИЙЖЗЖЕВ~АИЛИВВДЕЗИЗИКИЙЙИЗЕДВИКМЙГГДЕДДДБ{oaZ[blsЕИЗЗЕБ{xwwАЗЙЖЕДА|wstqt}}yzАЕЖД|ww}АА~zyvv~Б}xuє                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ┘ЮгдедЭПЙПТЛБ{zЗЧмпп┤╡пжЩКАЕЗККЛКwpwЖЛУЪм╝╟═╧╦┼┬┬╝▓дЧПДqa\WYYjwВГЕГ~sq{НФСМИАxmuБЗЙКМЛНТУОЗ~snГСПИЖАГДДЕЕЖДЖЗЙЖДГ|xpr~МТПНКЙИЖИИЗЕЕДБ~x}ДМЛИЗЕЗИЙИИЙЖИЖЕЖДАzАЗЛЛЖГВИИЕЕДАuh]X]gnzГЖЗЗЕДА|uwЖЙЗЗЕВ}tuwvrsxyzЕЗЕАzxyГДД~{uuВ{u{№                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                уШЬЯЫРИЛМРЧЩСЛМУж╜╩╠╨╨╤╦┐лСМУУППЛЖwss~ИМНФЫеп▓пно╖┬┬╛┤бУЖr_ZWZfr|ДЕДГ~{nnxЕТУПЙДzr|ЕЛЛМОУЧХРГsfboИНОЛЗИЕДЖЙЛИИЙКЗДxskuБЙНПНККИЖИЙКЕЖБ|wqvБКИЗЗЖЖИЙЙКЙИКЙЙЕГ~wyЗЗЗЕБВЖЖЖЕБ{qa[Y_htЕЙИЖЖВrqyАЕЖЖГГ~zvvywuwxz|ДИИВ}zw|ВЖЗГzvzА~zvЕ■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              їШЮЬЦОИКОЦЮЮЪШв░╛╦╪▐тфцхт╓─поиаЩФПДrtxДЙИИМХЫаЫНКФв╖─┼┐│ЪИrc\XanzГЖЗГ{vnnzЕМТУНЙВ{ГЙКМРФШФКmbchnwДМРНЛЛИИИЗЗЕИЖИЕВ|trt}ЕИЛРТКЗЕДЗЕЖГБ|wpiqАННЙЕЕЕЗККЙЙЖИЖД|zvsw|ЖЛЛИБВЙЙИЕБzbYWZcmyДИИЗЙЕВuns}ГББ~~ywvsuuvvyy{ГЙЙИГ}zw~ДЗЖГ}{y|~~xvХ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             √абЮЦНЛЗПЯлпн▒╝╩╒▌фщьЁЁЁЁяц▀╫═─╖лЫФouАЙЛМНМУЧФЙ|v|Уп╛├├╕дОwiaahvБЖЙИДtpkr|ЖКНССМЗЕИЛПЧЪЧСЛvibbhkko~НТПМНЛККЙКИЙЗИДwprxВЗКМСРЙЙЕЖЗЗЕБwqnmxГКНМКЕЖЖИЗИЙИЕГАywuqt}ЖЛЛЖВБЕДЖЖДk`Z\bhrАЗИЗЗЕБuquw{|{vwuuutvusty~z~ДЕДГ}wxyАЖЙИГ~|zy~|xvг                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            мевЭЦТСЫк┤╝└┬╩╙█учэяЄЇЇїїЇёьшу▐╤─░ЦЕx~ЙЛИККНУФМxnhrИб╡╛┬╗кЧБnejs|ВЕЗГВ{nmowАЗЛОУФСЛИМУЪЯЫРВufdglppnnzМХХННЛЛЙЖЖЕЗЖГ|rmtАЕИЛМТТЛИЗИЙЕГАysons~ЕКЛНМИЖЖЕЗИЙЕЖА|rnonyВЙММКЖДВЕЗЗЗЖВrh[W\bmzВГДГ}uuuwz{yvwvvvtvwupr{{wy|}}{wzy~ГЖЖДВ|{{{|xvu├                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ┴▒╢обЬЮн╡┬╔═╬╧╒┘▀ущэЁёєЇїїїїЇЄЁыу╫╞нОЕЙНРМММУФРka]kВХж▓║║▓ЮПx|АБЖИЗЕВwijqzВЖЗЙПУФПОУЬбЫУГnfgkqrrqlm{ЙТХУНММКЙИИИЖГ|wom{ЕИИКЛНТПЛИЙКЗГ}womq{ГЗКККЙЗЖЗЖИКИДВ{xpoqwГЖКНОЛЗД}ВГЕЖДВxpaVY_fu~{urqrqsy{{~~ААzyvzsoosrllmnopttzБЖЙЙЗБ{yxzxxtu╓                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        ╫▓╜╛║по┤└╩╨╒╘╥╧╬╤╒▄рфщыюЁёЄєЇЎЎЎЇяш┘└аШЧЦУММЛПСЙw`[^lВПЩжо╡│йЯЧЛДБЕЗИДДАpiku~ДЙКЙОЦЫХСЦЩЦОibelv{{unkrБЖМСФСНКЙИИЗИДАysquАИЙЙКККПТРЙЖИЕxrknwЕЗИЙККЖГЖИЙИГ~xrpkp{БЖЗЙЛООЙЕВГВЖЕДВ}te[WZanx}{xspvvusw}ВДДГВГАyrwwqjjohhknmrsszАЗКЛЙВzw|~|wvwЁ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      э░┐┼┬├┴┬╞╧╘╫╫╙╦┴║╕┐╚╬╒┌▐▀суцыюєЎўЎїяч┌─╝▒дЩУСПХПВo\[_rАЛТУЭлнкзаУКЖЗИЗЖБ~rqu{БЖЛКНТЩбеаТУЛ{nijrw{rooyАДКПСПНМЛМКЙЗД}trq{ДИЙЙЙЙКНТРЙИЖЕ~uqquДЖЗЗЕЗЙИГГЗЗЕАzuoptyБЕЙЗЙЙМЛИДББАВДГДАym`YV[env{{x||zxwuyДЖИЕЖЖГ~wwvvnjijovwtsusy}ВИЙМИДxyxxtz°                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    √о╝─╟╔╦╠╨╙╒╙╘╥╠╝иХФгм┤┐┬╟╩╦╔╠╪уьєїЎЎЇящр╘╔╗нЪЩФЧМxgW[gyЖЛПМПЪейидЩТЛЙЗЕВА}yy|БЖКУТФвп╡│кУМАpmms{АА|plp|ЕЕЙНСПНММНЙЗГБxoowАЕИКЙЙЙКНПНКИЗДzssv{АЕИЙЙЙКЛКИЕЕЕВ{voloxЖИЙЖЙЙЛКЙЕДВАВДДДАzshZTY^hu}ГЕДВД}wvyВЖЙЗИЖГywwtpkmw~БГДА|yz|ГЗИЙД}wyБ{zxД■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   ╖║┼╠╦╬╥╘╓╘╬╩╞┴╕еЦЙМФЪажинмлвз╡═съяЄєЇЄяыф█╨┴░бЭЧЗpaXanЕИЖДКОЩгзеаЩТПМЗГ{rrv|ГЙМТТв╗├├╜кХМАxtw~БДА}wnnt|ВЕЗЙПРПНММЙЖГxqvДЕЕЖЗИИЙЙМПНКЗДzst{ГЕЖЙЙЙЗЗЙКИЕЕДАyspns}ЖККЙЖЗИИИЙЗГА~АВГБ}yslbWX[dp{ГЗЕДГАytu~ДЙККИИЕ}|xxrjn{}ВДДЕБА}{}~}{БГББ}uzА{xvС                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ╔╢─╧╧╧╘╫╫╘╠├╖пойЩЗАЕЛНСФУЧШЦЛКХ║═█цыэЁёёЁэш▀╘┴╡йЪ~h^YfwВЖИЖЕННТЬгегЮШЦСЛГvqpuЛПХЪ▓┐╠╙╨┴зШНГ{|ДГГzrkoyБЕЗИИМОТПМКИЕ{srzГЗЗИИЙКИКЗЙНОМЖДxt{ГДЕЗКЙИЙКЙКЙЗЖДАupms|ДЗИИЙИИКИИКИЕВ~АА}xsojd^YYakuАЗЗИИДvrxВЕЖЗЕЕЕБyvwvqnw}БГИЖДБ{y}~{z|||zvxz~{ywп                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                щ▒└╠╤╘╒╪╓╥╟║гФЩЮЭОvzГККЛМНСНЙМа╢╞╤┌схъяёяэш▀╥┴пШ{gY[nАЕЕВ}vБЗКПЪвддЮЪХРЗ{{wДЛСЦЮ░╜╒▌╫╗вЮЪСЙДЕГЕДГvlgsБДЕЖЗИЛНТРМИЗЕ|tqtЕИЗЗИИИЕЙЗЙЛМЛЖД~{ДЖДЖККИЗИИЙКЙЕДrqu|БЕЗЙЛЙИЙКИЗЙИЖГАА~{wuqqmd]Y^eo~ДЕЕЖЕ~wrt~ДЗИЗИИДАxwvvrrwzДЗЕЕЕБ|y~}{zxwvwy~~yxy╨                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              №м╜╦╨╘╫╪╫╨╞╕жФОСХУ~p{ЕЖЕЕЕЖМКuxИФбо╢└╞╤▀шэяяьф╪╦╡Чzd^cvГЗЕБ|xuopyЕФбеЪШСМЖГГВРЧв░╣─▀щ╫╖СВОШЦКДЕЖЗГАyrloxВЗЗЖИЙЛМППНЙЖБztu{ГИКЗИИИИЗЗЗКККЙЕГВДЖЖЕЖЙИЙККЙКИИЕГВyzВГДИЙЛЗЗИЗЗЗЙЙЗДВА~}zyvtssl^W[bhxАЕЖИЖБzww|ГЖЗИЙЖДБ{wvwuuwx|БЗЖЖЕВzz{wvtutw{~}zzы                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ╡░┬╬╥╫╪╒╧╞╢еФКЙПРИtoЗЙЗЙЙЙЙГzrvЕНУШЩЬе╡═▀шэяьчр╥╖УxgbjЕЖБzna_Y\exКЬеЭЩПАtpt}ИХж╛╫ыї┌░И~~ИУХМИИИИЕВxpqt}ДЕЕЕЖЗКМПСПЛИЕxrxБЗЙИЗИИЙИЗИЖИЖЖИЗДГИКИИЕЖЙИИИЙИЗЖЖЕДГБАГЖЗЙЛЛЛЙЗЗИЗЕИЙИЖВА{|{~ВГ{wdWV\fr|ГЖЖЕГАzx{БЕИЙМЙЖГА}wwtssvyДЖИЖЕБ{y{В~yxxusw}|zzА∙                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ╥а╖┼╬╥╙╥╨╞║лХЗДЗНК~twГЙЙЗЙЙИИtr|ГКМТСМЛХ║╥рщыыщу╘╝ФwhhtГЖЗ~se[VQU`sЗЦаЮШН~lahsЖЬ┐ф∙ў╓оЛzwyНРТПЛЛЙЖГxsrzБЕЕЕЕИЗЙИМППКЕГwy|ЕЙЙЙИЙЙКЛЙМЙЖАВДГАГЗЙЗЕЕЗЙКЙКЙДВЖЖЕДГЕЕДЕЙЙЛЖЖИИИЖЕЕЙИДВ~|АБББ|j]UXblwАЖИИЗГАxx}ДЖЕИЖДЕВwvzusux{ВЕИИЖГ|{}~ВБ~zyzuuzБА{{{М■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         їФк║┼╦╩╔╔╚╛нЪЙВДЗИВwr}ЖИКИЙЛНЖvouАЗКМНД}Рз└╙▀цшчу┘└Ш~loЙЕАxm_UON[kyЖХЫЮЫРДtdkzЩ╟Ё№√хмР}ts|ИМСРЛКЛЙБ|vux|ГДЕДДЖЕЗЖЙМРНЖВ}ВЕИЙЙЙИЗИИИКЗГ~||ВВДЖЕЖЖЙЗИЗЗЙДyГЖДВЗЖИЕЖИЙКЖЗИЙЗДБ~ВЖЗГААВВДЕГqeZW]fo}ДЖЗЕЕБywx~ИЙИЖИЕДuw}yvtwwВЕЙЙЕА|{~ГДЕА||zxx~ДВА}{zа                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         ХШм╗╛╜╡╡╕╡оЭСДВЖНИ|psДМЛЛИЛМН~rtzГИКМЛ|qwЙЬо┬╙▌тфс┘╔жИ|zДЙД~si[WSWfxАЙСШЬЩФМ|xР╦є¤№Ў╦САvonnt}ЕКЛКИД~xtu{АЕЕЖЖЕЗИИЖЗЙККЖВВДЖИИЙКЛКЙЗЗЗДАwtw|ВГДЕЖЖЖЙЙЙИЙЖБ}uwЖДВЗЖЗЕЖЙИИЖИИЗЗА}zДИЗВАБГЕДБxk^X\diwАЕЙЙДБzwuyЖЗЕЖЕД~xwwxyxxw~АГЗИЖБ|yzЕЗДБ~|{yz~ДДГА|~║                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ╔ТЯн▒░кбЧЬжЭХЙАДМРЖyx}ИМОПНСПОyqwБЕЗККЖxlwЛФа▓─╤█▌▀╪╠┤ЪЙЖКЗДzmbXVT\oАЖИОТШЬЪЦОКР╜я■¤∙█Шytni_beluБМОКЖА|wy}БДЖДДДЕИИЖЖЗКИГДЕЖЕИЖЗЙИЙЙИЕЕЕВ~sntВЖДДДЗЗЗЙИЙИЕБ}wpt{ДЖЖИЗИЙЙКЙЙЗИЕГА{xszВЖЗД~АГЕЗИЗ{qbY\agr{ВЕЖВГАwtt{ГКЕИИЗБyxuwwvts}АЕЖЙЙГА|}ЖКИЗВБ|zz{ИЗГА|~┌                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ўМШвдаЫХНПСХУКГЕРУХЙ}АНУХЧХХЦТОvs|ДЙККЙБvs{ЙТЦд┤├╧╒╓╥╦╗зЧТРЛВtd[UQVexДЙЙЛПСЧЫШРОи╫ў¤°╥Х~xwsoc]_afm}КМЖБА~ВЕЖЗЗЕИИИЖЕЕЕЗИЖДДЖЖЗИЙККЙЗИЗЗЖГ{sr{ГЗЗДВДДЕИЗЗЕДАyvmr}ДЕДДЕЖЕЕИЗИЗИЕГxuqvАЗЗДА{}БДЕЕЕАxg]Z[blwАИКДЖБ|rnwА}~|zxvwvyyyxy}ИЙЙЖГБ|zzАЗЙЙЖЕВА|{}ЕКЙЕБzАЁ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ХПЪааЧОЛМСЦШПЙЙОЪЭЫОЗРайнокйдЫФ}|ДКМЛИЗ|nrАЙМСШд│└╟╔╟┼└╡кЪФЙБn]WQT\pБЖЛЙНОПФЪЬХФпхўЄ┌СД}{АzsjgfgmvЕНЙДА|}ИЛЗЗЕДЖЗИДГДГАГДЕЕЕЕЗЗКЙКЙЗЗЖЕЕwpu~ИЙИЖЕГДЕИЖЕДzslhuБЗИЕГГЖЗЙКИЙЗЖГwsqqzБЗКЖА{}БДЕДЖДБna\Y^fs}ЕЖГВ~xqls{~{wuqsttxz||}~~ЗЛЛЙЕД|zЕЙКИЗЕВ}y|ВЗИИГ}zИ√                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ╨КХЭЫСКЗМСЩеЭСКУбп┤▒ом│┴╞╞╔┼─┐╡ЮИЛТФТМКvpwЕИЛМФЩж▓╢╢▒╕╜╗┤жЫОiZTQRcyГЙККМКММТЮЬан╨╪╚вГ}АДДГ~~ytoqzВЙИЗАyvyДЕЛЛИЕЕДВДГА|vЗЗЕДЗИККЙИЗИЖЗВyrqyДЙЗЗЕГДГЖЗИЖБ~vonr|ЕКИИДБДЕЗИЗИЖЕБzqpryАДЙЛЛЕ}~АГВГЖЕАvi^\^dq{ВГ}ywrporty}{vuuvvvwx}~}ДЗЗЖЕВ~wzВЗЙКЙЗГА{y~ВЕЕБ|}Р                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 №ЗФааЛЕМХЩЪелаХФл╗─╩╠╞╟╥██▐▀▌┌╒╠╗нйлжЫУЛ{wt~ИИЙЙРЦЮбЭХЬж│║╣обП~gUPNXmАИКНОРОООХдзкмЩУНДw|ВЖИЖГИЗДГАВЛКИwnhlqyЕЗЖЖДАБ~{xАЗКЗЖЗЙКЙЙИЕЕДАzuqu~ЖКИИИЗЕДЖЖЖБ|wqpryДЗЙЙЙЗВВДЗЗЙЕГАzvooy~ГДЙМПИБ~АБДЕИДВ|p`W[alvzyxursqrtrv~АА~~}}|zxxz{}yxz|АГЕГyu}ЕЙИЙИЖГА|z~ВГГБ|zй                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ЮМШЮТ~ЖХЪЭз╡╕▒ин└╦╘╫┌▄▀ушъыыыщхр╘╔╦┼╜пЬТ{ryГКККИНТЩЧОГ~Тд╖╕┤еТ~eVRT_yИЛНННПОППг┴╗иЮХЖ{v{БДЗКЛЙЖИЖЕЕДВВЙЛИxmebbhnwАЕК~xwvutЙЛЗДЗЗЙЙИИЙЙГАvqryГИЙЖЖЖГДГДЕДxqnitЗЙЙИЗДВАВДДЖГ~{xuqu|ГЗЕЗЛПЙДББГЖЕГvfXU\eovuuttwuustu|АЕЕДЖЕБ~zyz~}smnoklv~yxyДЗЙЙЙЗГА{}~БВzv|Ж╬                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              шМУШХЗОЬй▓║┼╟├├╟╨╫▄ртфчщьЁЁёЁяэъцс▐┌╤┬мЦАzАИИЗЙЙМТЧТ~wtБЧм╖▓жТАeVPSmБИМНПУХСЦж╟сш┘дЧЗ|}~ДЗЙКККЗКЙЙЗДДГЗГ}uea^^]amw}trpms~ИЛЗГДЕЗДЖЕЕГАzpnvАЕЙКЗИИЖЕГГБysngo|ДЗЙЙЙКЗГББЕЖЖzvrqr{ВДЕДЖЙННИДВГГГДДГxg^UYahrwy{}}АГ|vuzЖКИЖЕЕАyx{{wplmonmpxzzyy}АДЕИЙЖДzy{{xvx~Ея                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ФУЪХЖ~ЗЪм╕┬╬╒╒╒╓╘╓┘█▌рухщыюЁЄёяяюэьыцр╘└аЙЖИММКККОТФЖridyНЯлнгФВk[VbxЗНОТХШЪЧк╔ъїЎ╫иЩОЕВДЙЙККЙКЗКЙЗЕВА}|~ГГАzrid`]]^djrtrrrsВЖЙЗДДГЕЕИЖИЕБ~rr|ГЗЙЙЗЗИИДВАwqmmyВИЙЙКИИДВАДЕВwtont|ДЖКЙЖЖЙММКДАББВВВА~vmb[Y^fnuГЖДГГВ{su~ЖКЙЙЗЙГ|xy}|yz{zzwtsvxxxz~ГЕКЛККЕ}yy}АzwuuwН¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ╘ХЭЧЖ}ГЦл╜╚╤┘▌▀▀▌╫╘╨╨╬╙╓┘▐ушъыьььэяяяющр╨╡ЧУРПМЛКЙРХР}h_csЙШажаЦИrealВКРТЦЩгн╡╩Ё·∙ъ┴дЬРЗЖЕЗЖЙЙИЗЕЙЙИЕА{uu|ВГА|xslea^_acimqxДЗКИЕДВДЕЗДГА~yowАЕККЙЙИЙИЗВБА|upquАГЗИКЛЙЙЗЕГВВБ{rnkrzВЕЖИЕЕЕЗММЛЖА~ЖГА}yuoh[Y]eltЕКЙЖЖДzwzАДДЙИЗВ~ywy~~ВЕЗЗЕГ}yyxxy|ГИКМЗЗЕГ{w||wuuvyГШ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ¤УЫЩП|АФи╜╩╒█▀тт▀┌╥╔╛╢п╡╛╞═╤╫█▄▀▐рхыюЁЁэц▌╦╗░зЬЧТРОСФМtaZ\sГСЦЪЬШР~niuЗНТЦЩвл▒╛ы¤¤Є╤мЫШРМЙИЙЙКЛКИЖЙИЕВ~uqv|ЕЗДААВ}|wpkdb_belwЕГЕЙИЕВВГЕИЗЕxur}ГЗККЛКЙЙИЖГБ~tos}ЙЕЙКККИИЗЕВАА|wpor{БЕИЙКЙЙЙЙМНМЕАВ}xtqmkc]]`gq~ГКЗЖЖЕБzyyzАДИЙЖД~zwuy}ГДДДЖГБ~{zwyzАИЛЛМЛЙЕБ|}xsswy}Г╗                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         └ЪЫХЗzЙд╝═╫▌рус▀╪╧┬│гТОЧдл▓╖┐┬╟┼╟╩╘тшэюьъу┌╧╞║░бЧССУСЕm_Y`uЕОТУЧШУИАyБМОХШвк┤┐╪є■√▌йНУУПМЗЖИЙИЙЙЗЗЙИЕ~|vqvБЙКЙГАББА~yslb^_`em{ГИНЛИЕВВДДДzwtxАЖКМЛМКИИЙЗГВ}ts{ДЕЖИИЙЙИИЗЗГБ~{xoqyБДЕЗИЙЙЙИИЛЛМЗА|~vppnkc_\^clyГИИИИЗДАzzz{ГЕЗЗДА{wvv|ВЕЖЖЙЗИГБА}~z{ГЙКЛЛИЗВ~{{~vrtwyИ▀                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ЎЬвЪЛАБЧ╡╩╒▌сс▌╪╥╚╜нЫСВАИТШЩЯджизжв╛╨▀цъщшчу▐╫╧─╢зЩЦЦС~f[\izЕКЙЛПУУНКККОТШЪжо╗═ыў·фнЕГОРМККЛИИЙЙИЙИЕxtoq|ДИЛЛИГВГГВА}zqeb`bgmxАЕЙЙИДДДДГВypr{ДИКККЙЗЗИЙИГАА}yzБЕЙИИЙЙЙИИИЗВ{zvlvБИКЙЙККИЙИЙЛККЗГ|z~|usv|~o`[\citАЖИИЙЙЗДАyuyДЖЙЖБ|www{ЕИЗЙИЗЕДГАБyzАВДЗКЗЗД{z|~ztrsszЗМў                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ▒ггСВАЛй┴╥█▀▀▌╒╠╛пбЧПДsxВКМОУУФХСОТз╜╬╪▀стуфус┌╥├╖дЪЧЛw_X]n~ЖИА~ЕНТСНЗЛОТЧвн╕┴чЎєр║Й}y|ИПОИЙИЗИЙИЙЙИЖ~trsyБЕКЛКИДДДВГДГ{pfccgkqw~ДЙЙДГВБА~smvБЕЗЗИККЙККЙЗВА}}~ГЕИЗКККИККККГА||xxЖКИИЙИЙИИЙККЙКЗЕВ~~ААz{БВuiZY`ep{ДЙЙЛКЛИД}uvzБДЖДАzvvvw~ГЗЙКИИЗИЗДБ{|ГА|ГЖЗЖБ|zz{|xusrvВЙТ■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ыбвЫИ{ГЦ╖╩╓▄▐▄╙╦▓бЧСМДupwВИЙЗКЛМЛГАЧй╕╟═╧╥▄ухфт▌╘─│вШИsZ[cvБВzssВРФУОППФЩж╢┐╙Єўт║ХwqxВОТПМКЙЛКЛЙКЖГypos}ЕЙЗКЛКЕГДЕЕЕЕxkfghjklquzВЖДГВГ~ws{ДИЗЗИИЗЖЙЙЕГАВДЗИЗИКМЙИЗЖГ}||}~ДИКЙЙЙЛМКЙИЛКЖДВВ|ДЕЕzpaZ\bkwЖИЙИЙЗЕБ{uuАЕИЖА}zxuvzДИЙИЙИЗИЕД}}|АБААВВГДzxy{{xxux{ЕКк                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    лебУ|xЙй┴╠╒┌╪╘╩╣ЯРМЙДynjwАГЕЕЗЗЙБwtАСШдп╡╢║╦▄тхфт┌╬┐нЬЗqX\i}ЕДАsmdkВТУПСОФЧж╕╩▀яы╔ЬЖxpmwГОСОМЙЙККЛЙИГАvmmxДЙЙЗЙКЛЛДВВВГГВvkiowxomnnu~ДЗГАА}zsw~ДЗЗЗЗЙИИКЙИz}{АГЕЗИИИККЙИДБ~~}|~АЕЙИИЗЙККИЙЗЙИДББВБ~~~БЕЙЕАvc[Z^grДККЛЛИЗДАysyГЕЕВ}yxvuw~ВЕЙЙЙИЛЛЗЕБ|{В|БВ}xx~yxx|АЖЛу                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  цееХЕ{Ф▒┐╟═╙╤╩╝дПИЖБ{plpzБГГДЗЖГyru~ЙПФЪЬЩЭ│╨▌тут▀╫╔╕ЭЗp\bqАГГ|kf_`rЙФУТТФЩз╝╫уц╠Я~yqpo|ЖНУТНЙКЛЛЙИЗАzpnt~ДЗИЗЙККОКЖДГДГЕsiov{{tmimxЖДА{zwwГЖИЗЖЗИЖЗЗЗГzwuz~ВЕЖЙЙЙИЙИЗБzvw|ВИЙКЙЗЙММЛИИЙЕ|{ВВ~~~БЕЙЙД{l^Y[doxВЙИКИЖИЖВ{uv~ЕЗИГ{wrqsyДЖЗИИЙЙЗЕДБ||{~А~{{~~~wzГГ~xyz~ВЗМ¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ииЮЗ|xЗЮ▓┤╖┐╟╟╜мЦИГБvlns|БВВГЗЗВsltАНКПРОКЙж┼╘┌ср▀█╨┴дИscfwВДvd^Y\kБСХУСХЧл╔▐с├ШДytlmrДЙМПУТЙЙЛКЙЖЕ{tpr|ВЖЖЗЙЙЙЙКИЗДВГБВkfp{ВВЖД~wrszГВ{yuДЖЖЗИИЛЙЗЙЖАwqqv|АВГЗККИЗИДvrt}ААГЖЙЙЗЗИЙКИИЖЕwwyАГГВББАГЖЗЕДseYXbntЕИККЙЙИЕ}wwwДЕДwqoovzВИЙЙЙКЛКИЕД|{z}БА|zy|~~wwЗВ{xyz~ГИл                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                рджЩ}wТвгЬУЫк╕нЭКБАГqemv|БГДЕЗЗ~nlxГЗИКЙД}ГШ║╟╥█▌▀▄╘╔пРxho~ГВ~p^XQXkБПЦШФЦЦм╦┌╔ЧЖwplimzЖКММРФОМЛМЛИАuplsАЕЗДЖИЙЙЙЛЙЗЕЖЗА|ggtАБВГБ}xtvАВДГААГЖЙЗИЙЙЙЗЗЕВzrmoyААГДЕЙЙИДДzpmuАВБВГЗЙЙЗИКККИДАxuttzАБАВАБЕЗЕДБym\W]js|БЕИЕДЖЗГАzstyБДВyrooqv~ЖИЗЗЙКИИИЖБ}z~ГГБ|{zywvx|БДБ}|yzЗЙф                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               вдЯЙxНФЧФРМСж╡жУД|ВВ~mdqz|~АГДИЗ{lm{ЖККИВzw~Фи╕╞╤┘██╪╧╝ЬЕxzЕЖВ|kZWNXmГРФХУУЧз└╔жАupkkioЙКЛНРТОНЛЛЙЕ~rprzЕЙЛЗЖИЙИЗЙЙИДВА|ublzВДДГЕЗЕА|y}ГАЕЙЗЕЗЙЙКККЗЗДБzoir}БВ}АГДЗЙЖДГ|tpqyБДВБВДЙИЙЙЙИЗДА{sttw{БЕДВВДЖГВБ~s_X\foxАЕКЗЕЖДВ~zrrw~БВ}wqmmtw|ВЗЙЙИИЖЖИЗГ}zzБЕБ~|{xvssv}ВДД~{xzГЗЛ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ╙ЬЫРГЖТЧКЖЖНЩкобСГ}ГЕ{kht{ААВДЕВymsАИИЕД}wsАРЫл╖┼╧╓┘╪╙╞оФЕЕЙЕАvdVSO^tДПФШХЧШамвДkieeeixДККМРСУПНМЛЙВzlqwАЗЙКИЗЙКИЙММЛЖВyrkuАЕЖЕЖЖЗЕДВА}ВГВДЙОЙЗЗЙКИКЖЖВ~wjlzБГВБААГЗИЗВuqlqЗЖБББДИЙКККЗЕД}{qpryАДЗЖВ~ВЖИДДГАycZ\bmu~ГЕБА{zzxvrsvzААzvqonrvz~ВЖЙЙЙЗЗЙИЖГ~z}ЖЖББА|xtsuxДДБ|zzБЕЗ╛                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ■ЧШРЕzБТЩРzwЕЦ▓┐║гТЖИЙЕ{nqzАГГВБГtrzГЙЛЙГwmqАНЦЬи╢├═╘╓╤╩╜йЧОМИo_UPPf{ЕКПЧЦЦЦЪТpjffegoЙЛКМНООПМЙЙЗАvhm|ЖЙЛЛЙЛККЙИЛМЙЖВ}wpo{ГЖЖЖЙЙКЙЗЕБ~БГГГЗННИЖЖКЙНЙИБztmrБЖЕДВБААГЕЗГ}yqnqzДИЙДВБЕЕЖИЖЗДА}wwpqyАЕИНКГАГЖЕВГГД}i`\_itzАДБ}yyxusrsrsz}soknu}}|ВЕИЛККИЗЖЕБ}{|ДИЕГА{xtsu|ЖЗДА{{БГДў                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ╟ЪЩИwАСЧСАtxМл├═─пХМММЙБyЖЗЙЛМЙЗЖАxwВЙМЛКАsnuАЛСЦЭи╢┴╩═╬╦├╡жЫУК{l\SNWoБКЛПУЧЧУРЖwnhebgjuДКММНННЛЛОМЙЖrlvГЙЙКЙИЙКЙИЙЙЙКЗГ}vttАЕЕЕЕИИИИЖЕБ{|БГДДЙППРМЙЙИИДБ}xoizЖКИЕДГБАДЕДwtoq{БЕЗИДБАБЕЕЙЗИВ}xsrozБЕЖЗКЙГААДДЕДЕДГ}oc^_grx~}vwwwxusvttux|}upmmvВzx|ГИЙКЙИИЗДВ}}БЕИЕБ|xutuyАЖЕЕА}{ВБХ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ■ЦЩТ}РЩТГwsЕЯ╝╨╓╧║еЩЩЫЦОЛПСУТТТОРИААЖОСУТОqnxДЙНСУЩз▓╕╛╞╞┼├╕кЩМzhYTO^uДЗКОТФФРЛАtmieehq}ИЛМКМЛЛЙКМКЙЖtt|ЖКЛЛЙЗЙИИИЙЙИИИЕА{yzДЗЗЗИКИЙИЗДАxqwАДДИЫожШСООМЗЕ}vqpИЙЖЕЕДБ~ГДБ{rqqvЖККЙГББВЕВБ{usptyАЕЙЙЙЛКЗГАВДДВДГА|rh]^epzА}z{}~А}{utx~{srompnwxz~ГЙЙМИЙИЗЗЕБ|}БДЗЕЕ{wuwx}ГИИЕБ{{БД▌                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         ╨ШХНГЙХЩЙvrwР▓╠┌▀╪╚╝╣╖╣│оп▒пп░пмждЦСТЧвгбЧТ~qq|ЗЙМНСХЬегж▒╜├╟─┤ЯПyiYTTf{ЖКМРУЧХСЛАyqjgfkwВЙНЛКНМНЛМНМКДБ{{ДЗЙИИЖЖИЙЙИЙЛЙЙЙИГ}АЖЙКЖДЖЖЗЖЕБ~uin~КККЩ╣╞╛лЧТНЗВzutxГИЙЗИЙЖДБББxplr|ДЙИЗИДВБББДЕБ}xssszДЗИИИЙЙЗВВДДДВВБ~ytm_]bmw}АБГДДЖКДЖ~wwy}xxqmikvyz~АБАГВЖЗЙКИЕА|ГЖИЖБА|ywtyГИЗЕДzz~АК■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ■ТЧСЕАХЪПyotАд─╪тцс╓╨╧╨╤╥╙╥╨╠╠╦╩╔─└╛╗╝└┴╛╣йШДuyВКЙЙЛНУШЭЦТХж╗┼╞╝зСzgXQ[nАИККСЧЧХРМДuokin{ИЙМЛЙЛЛЛЙЛННКДББЕИЙККЛИИЙЙЛИИЙЗЙИЗВББГЖЙЛЙЕЕИЙИЕ}qfrЕЖЙТл╥▄╧╖аТЛДzuw~ИИЗИЗЗЗВБА|uppyВИЛКИЗЕГБББББАytrpuАДИЙЙКЙМКЙЕВГДЕБ{wuplc__ky}БЖЗИИЙЛЗДА{vs{~ztnlpxz{{{||z}~АЕЗИЖДyЕЙЙЖДБ~{wvЕЗЖДА|z~ВД┤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ╨СРЙЗПЬПАvu}О╕╥тшышс▐▌▐рсс▀▄┘╪╫╫╓╥╧╧╥╘╓╒╘╠┐иНАДЛПНММЛПФЧЗГЗРл└┼┐пХ{hWRaxГЙМНУЦЦФСМИЖyskktВЙЙЛЛККЙКЙЛКННЕВВЕЗИЙИЙЕЕЙЙЛККЙКЗЗИДВГЕЖЙИИЕИЙЙЗДymjuБКЙИНЧ╝▌щ▄╜ЧИД}z|ГИИИЗККИЕА|}|tqvДЕЖЗЖЗЕДВВБАА}ysqsКЗЙИИИИЙЙИЕГГЕИЕА|ywqmfa_fwГАГЖЗЗЙКМКЖДА}xx{|xrqtz}~|z~А|{{|АГГДА{yyАИЙЗЗЕВ}{z|ГКЙЕВ}y}БГДЇ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ТТМЙОЧЦВ{y}Йд╚▌шэюьчфтттттс▄┌╪╪╫╓╥╥╙╫▐ттр┌╠╖ЬТПТУОСМНСФС{uxЕШ╡─╛▒ЩБmXXk}ЗМПРТУП}ЖКЙ}xrr|ГЙЙЛКККЙЛИИИЙКЕЕДЗЙЙМКЙЗИЙЙЙЗЙЙЗДБГЕГАГЗЙЙИЙЙИИИДzshjxВИЙЙИРа┬щїт┼ЬНГАДИЙЙЗЗЗИЗДБ~||rr{ВИИИИЙКЙЗЕДБ~zsnt}ЖКИЙЙКИИЙИЗДДГЖЗЗБzwvstqd\aqГЖККЛКЙКЙЗДБ|xyz}zwrw{В~z|ВВББ}z}Б{wx~ЕЗИКЗЖГ~{{ИЛЗЕАxzВДЕШ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ╨ТУЙИСШР~||С╕╒уьяЁэъцс▀▌▄┘╓╥╧╠═╦╩╞╞╦╘▄тфф▐╓╟▓гЯЫЪЦХТРУУМqjiyРк┤╣пЪЗqZbuБКНСТФОuq{КМА|suБЕЗИККМКЙМКЙЖЖЗЕИЕИИИККЛИЗЙКЙИЙЙКГ{zГАВДЙЙЗЙЙЙЗЖБwojr|ДЙКМЙЛСЯ╞ЁЎр┐ЧИИКЛККЙЙКЙКИЕГ~zuyБЕЖЖИЙКЗЗЙЗДА{wtt{БЗЙИКЙКККЙИЙЕГГИЛЙЕБ}|zl]]k|АГИИКЗИКЙЗЖЕБ{xy}zxvwx{{y{ДГЖБ||БА}zy~ГДИЗЖЕЖВ|x{ГЙЛМЗzyЖЖВт                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ТФУОУЩУГxw{Йд╔▐щяёЁьч▀╓╨╦╔─╛╗╢╡│╡│ол┤╞╙▌рт▀╪╨╞╛╣┤мжЬЦФХЦЕfabrКЫеижЫМ|kl{ИННРПМГseivЖПЕ~ГЗКЛЙКЛКЛКЛИЕГГЗДЗИЛМЛПЛЛККЛКЙЗГ}wyzААВДЙЛКМККИД~qjkwБЕКККЕЖКОЯ╥Ў∙ю╫▓ХРОККИИИИЙЗЕА~||АДЕЗЗИКМЙИЙИЕА{zwyАЕИИЙИИЛЙКЙКЙЖЗГДКНИГББГЕАrc^eyЕЖЖЙЙИИЙКИЗЕГАxv||xwxz~Г}y{АЕИЖДА~А~{yy{ГЖЖИЗЗЖБyzЖЙМЕ||{ГГК                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   ▀ЦЩЪЫЮЦГАЕЖБО╡╘хыЁёящ▀╧╛▓идебЬЫЫЫЪШСНЦн╛╩╙╓╫╒╘╥═╠╚└╖маЪЧУАa[`rИУЪЬЮЪРДyzВКОРТСЛug^esГЛЖДГЕИЗМЙМЛЛМЛМИГ{u|ВЙЕЕЗИККМИЛККЛЙЙИДxkn{ЕДГЕЗЗИЙЗЖЕymkrДЙЛКЛЗИИМХк▄√√Ё╧йПРЛКЙКЛЙКЗЖД~ГЗИЖЕИИКЙИИИЗВ~~{|АИЙКИЗЙЗЗДЖГГВВЕЕЖИОМИЕДИЗЕxhbaoДЙЖЗЙЗЙЙКККИЖЕ~yy|{xxx{ААxzАЕЗКЙЕГВВ{y{~БЖЙКИЗЕГ~{|БЗИЕБ}zВАГ╠                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ЮЯЯгибОЕМЕЕЪ┼▐шяЁЁэф╘║ЮНЗКООНЛНМЛЖ~ЙХв│╝└┼╩╨╘╪┘╒╨╟╗мЮЫСz_]buИОНТЧЦТКГВЕКОРСОЕg_]erАЛКЗЕЙККММММКККЙДАtpwБКЙЗИЙЛМОЛЛЛККЙКЗБrjo{ЙКЕДЕЖЗКИЖДuglyГЕИЙИКЙЙЗИПШкс∙√Ё╦ЪПММИИИИЖАБАААДЗЙЙЗЙКЛЙЙИЕВАВЖЙККЙИИЙЙЖЗВ~~ГЕЗЙПРМЙЕИЖЕ|od_iЛЛЙЗЗКИЙИИЗЗД~zyz||{z}ГГБ{y~БДЗИЖЖЕЕА|{z{ЕККЙИЙЖБ{y~ВГДГ}x}ВВАД¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                юЭейпоаИ{ГЗИПл╬тыяяюш█┬аЛА~ГИЙЗДЖИЖ{ot~ЙСЧадео├╤╪▌▌┌╘╦┐▓аНs\_gxЗЙА~ЙСТНКЕЖЛМРСЛ{^Y]gszАЙКЗЖИИЛКНММНКИД}pkwЕККЙИИЛЛЛКККККЙЙД~ldoБЙЙИЖДЕЕИЖДАznbm~ДИКЛЙЛЛКЖЕЙНШ┐у∙∙с▓ЪНМКЙКИЖААБГГЕЖИИЗИЙЙЖИДА~ВВЗЗИЙИЗЗИИЗЗГБzwvyВЖИЗФХТНЗЙЙЙАti`c~КИЕЖЖЙКЙИЗЙЙЙБzx{~}z{АДДА}{~ДЗЙЗЙИКЖБ~{{БИЛЛИЙИД{yzАА|zДГБм                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ║░╢╖╖мШВАНКВП┤╘фыяяэх╨▓Т}x{АГГ}АВБnen|ВИНУЦЧЦо╔╓▄▐▐█╙╟║вПo[_l}ЕД{puДСУМЙЗЙЛНПЗoZZ^hotyЕМЛИИКЛЛНЙЙЛЛЕwiiyЙМНКЗИЛЛЛЙЙЙЙЙЙЗБwifvДИЗИЕДЕИЙЗГ}tjfrГЗЗИИИЙКЙДДЕЗИЮ─ъ∙Ї╫оУОКЙЙЙДx{|ВГЕЖЗЙКЛЙИЖЕБ}z{АЕЗЗЗЙЗЗЗИЙЙЖА~srtu}ЖИЗТЧЧРЙКИИАynbauЗМЙЖИЙККЗИИЗЗЕАyx~zАГЕЖВz}БЖЗЖЙЗИЕВБА|ЕККККЙЕzz~zz~~|z~ДГГї                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ∙╢┐╛╜╡ЯСЕКМЕГФ╣╥сщюяыс╟вГrv{ББААВВ{gepy|~ДККАЕЩ║╬┘▐▀▐┘╥─йСr^crГЖДuflvЕСТЙЕИКНЛdUW`hlpxАЕЙИЖЖЙКМЛЛММЖzvmo}КМПКДДЙЛКЙИЙКЛКЕ~tkn{ИККИЖГДДЖДАzqjjyЕЙЙИЙИЛЛЛДВББ~г╫ю∙Ї═ЬТМКЙЗАttzГГДДЖИИЙИЗЕБ|yvyБЗККЙЛКЛИИЗЕАxvnopvАЗЙЙУЩЪЧОНЛЙД}pb`nАООЙИКЙКИЙИИЗДВzw{~{}БЕЕДАy{~БЖИКККЗЖЖГБ{|ВЙККЛЙЖБ|zz~yz|}yzАГГЦ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ╥╞╩╚─мЧКДЙКЗКЩ│╩┘хьюы▌╛Чtw}АБА{}ВАt_esx||~ВВtzОк┬╨┘▄▐█╓╚нУtckxГЗГoddkyНФЛДВГЙИx\SX_glmqzДЛКИЙКММККЛЙАwpktВКМНЛЗВЖЙЛКЛИЛЛКГ{nepАЙЙЗИИЕДГЕГ~vmjpАЕИЗЗЗИКИКЗВА~|ВПн╥цЎъ╡ШНИЗЗВttzГДДЕИЙЙКЙИДАwsswГЖИИИЙИЛЙЖГА{rsprv}ДККИСЬаЪППМЛЖte^i~НПНММИЙИЖЗЗЕДАzwx}ВААГЕЗЖЕ{x|БЕЗЙЙКЗЖЖГА{{ВЕЗККИД|y~}|{yxsxВГАГх                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ¤╞═╨═└дОЖЙТКЖНЫж║╚┘шэы▐╗Уyx{БГВВААБ{qeitz{|}~krЗЪп┐╧╓┌┌╒╦╖Ф}os~ГГh`Z\oЛТНЗГЕЛЗq\Z_bgkjesЕПНЖЖЙЙКККККrln{ДКМНМИЖДЕЖИЙЙККИВtmnvГКИЗЙЗЕАВДГ}qkkwДЖИЙЗЗИЙЙЙИДА~}АМУп╤▄▀╦░ФЛЗЗАqt{БДГГДЖЗЙИЕЕА{vqt{ЕИЙККЙКЛЙДАztmnmxАЕИКМЛПЩдвХСОНЙБwibbvОЦПЙМЙЛЙЙЙИИЕД~}z~ВАГЗКККЗБ|}АЖИЙЙЙИИЕДБ|z}ААЖНЙЕБ|z}xsrwАГБН                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ц╬╒╥╦╕ШЗЙПТКРЦЩШШ▒╘цэъ▄║С}АДЕГДБА}vjcpv{{||wlrДУЭп└╠╘╫╒╧╛аБx}ГЕyc]YYkИФРКЖЕЕБgWZ_cfeiiuЕСТЛЙЙЙЙККИГxqmsБИКНОНКЕДЖЗЖЙИККЖ{qko|ЕКЙИЙЙЗДДДБylio}ЖЗЙКЗЗИЙИЙИГБББЗОРХм├╠╤╜бРИД}rwАЖЖДДДЕЗКЙЗГ|wsryАЕИЛЛКЙЙЙЗДzsoknwАЖЙЙКККСЧавЭЦПОИВxi``mИШХМККИЖЖДГВА|{}ГДЖКПСНКЖВАГЙЙЙЙИИЗЕГ{y~~~|ДИЕГА{|БВ|vssuxАБАА╠                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ═╒╓╨─йРЙРЪаЯЭЦПЛТ┤╫щюь▄║САГДЕЗЗЗДГ|pfhvy{{{|yqdrВЛФЫ░┐╠╙╥╧─пЦЕЖЙЖ|u`YRWkЗХФРОЛДs]X]bfffhl|ИННККЗИККЙИЖvlmxЖЙМММНЛЖВГЕЖЗИКИЕwkjtБЙЙКЙККЙГБА~uigvВЖИКЙКЙЛКЙИЖДББГЖЙЛНМе┼═─кЦЗБ|tzБДЕЕЖЖЗЗЗИЕАxuru|ДЗКЛННЛЙИГsojmyБДИЙКЙММОЦаебЩУПЖАxkd]lВУХУРПРРПОМЛММЛИГБЖКЛОРРНЛЖГБДЖЙККЙИЗЗЕБ{yy|}{|ВЗЖВ|ДАvsrqu}АББГ■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         Є╥╫╫═╕ЫМПЫй▓огУЙКХ╣▐яЄь▐╜ЦККЛЙКМКЕ~vmjmy{|{||uijtАИМТЮо┐╔╦╦╞╣бШУТК{p[WU^qИФФФТНВd^]_cfeeiqАЙПСНКИИЙЙЙИГpnu}ЕКММНМКЙЕДДЖЙЙЙЗГrjpyГЙКИКЛНЛЖБypgk{ЕИЗИИЙЖИИЖГБГГБВЖЙНОНН░┴┐▒ЫЖ}prЕЖЖЖИИЙИЗЕЕtst{БЕЕИЛНОЛИДwpmoxАЕЙЙЙЛММННТЮклЯФОДАvlg`h|УЪЧЧЮм░лЯЫШХХФТНИЗЛОТЬввЯШРЗДЖКЙЛЙЙЙИИЗГ}{{}~|zzАДББ}~БВ}uporzБВ╛                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         ╒╒┘╓╞жПЛХл╖╝╖жСДЗЫ┴уёєюр├дСПСРТФТРЖvjmv}||zwpfhvДЕКФв▓╝└┐└╗оиаШМxmVSR_vИСУФУПГk^\_bfgflxДЙЛПОМИЗЗИИДhjwГККНННЛКЙЕГВЕЙКЙЖГkhq}ЖЙККЛЛМЙДБ|yldrВЙЙЙЙЙЙЙЙЗЕА{ВГБДИКЙЙЛРл┤оЬИwqyГЗЗЗЗИКККЗГ~wrsxДЗИЙМПТОКВztqqv}ЕИЙЙККЛММПФЬи▓еЦМГ}yqfcfrНЮде╖╠╒┘█┘╫╙╧╔╕ЬСМОСФЫзлниЪПКДЖЛНЛКМЛКЙГАzz}}}{yx}ГВ}ВВВypops}ГГВЖ√                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       √╧╪╪╤╗ХЗЙЪ┤└┴╕ЯЙАНб─цЄїяу╩│меввждЫЧЙvnu~А~|wkdjyАГЕДНХвлоо▓╢╣╢░ЮПykXRVg|КРУЧТМВqiaafgffm}ЗЛМППРЙЙЗЗЕБ|ck|ЗККНМНННМИДВЕЙЛЙД~fivБЗКЙИЙММЛЗБ{xtrzИЙЙККИКИИДБzxy}ГГЖЙККЙМНРЯквОЕ||ВЖИЖИЙМНЛИВ|rns{ГЕИЕИИЛСУОАvrpu~ЖЙЙККЙЙЙЙКНПШз┤лЫОГВЖs^dmВЫзн┴╓фыэюЁЁЁы╫╖ШМОШЫЭбио░гЧОЗЙНПОКМННЙЕГАyyА}xxЕ~|АГВ{toos}ЖЙВБо                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       с╙┘╓╠жЙБЛЭ╢└║жФИЖРе─шєїёч┘╬╟┴┬├├┐┤гРБzАЕЖЖЕГБxlkpyАГЙСЩЩШЫг▓╕┐║йУ}lZW^nАКОТЧЦПЕyrgcdeegrВИЛМННОМЙЕЕГxksАКММОНОМНЛЛЗДДЗИЗБxck|ЖЙККЙККММИД|ysuАЙКЙКККЛКЗЖВxnrzАБДЙКЙЗККЛСЬдШРКДГЗЗЖЕЙЛМКЙynnwБЖЙЙЙЛЛНУХТВtqu}ДЗЖИЗИЙИКИКНРЦг╖▓вТДtc_ag|Ъеп┼рё°·№¤■■№Ё╞аНЛЧе╝╠╠╔┐▓ЮСЖЛУТПОНПМИЖЕГ{ДДБ}z{АБ}~БЖВzxrux~ЖИБА°                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ╦╘╓╨╜ХААНЫ▒╢зЧОЕЖРи╚ъїЎЇяцс▌▄█▄┌╓╦╖ЪИИМСППППМАsov|~~БЗЛТСЛГОд╕└└│ШЕm^YcxЕКРСХХФЙБxihfeejvДКМНОРСМЙЕГАzrdvЕЛКМОНРННМКЗЕЕЕЖВ{qbqБИЙКЙИККЛМКИ{zЗКЛИИЙЙИИИДАvkmzГДЗЙЛМЙКИЙКМХЮЪМЙЖЖЕЕЗЙЛМНМГyrt}ГЖЗИИЙИКУЪШЗ~y}ДЖЛИЙЙКЛЙИЕИЛПФЭ│╣лЦИ~n`Z^chvТе│╞╫эЇЎ°√№№№Ў╨ЫКЛХе└┘▀▄╒┼лЦЖИХШФФУССНИЖЕГАГЖЕБ}zx{~~ВЖЖВ}xtv}ДЖДБе                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ш╠╘╨┼кЗyАОЪвдХИДВЗСл╦ьЎЎЎєёюэььэых█╠╗лймп│░мжЩК}{~~БДКРКu{У┤└┬╣ЯЙr`bm}ЖЛТТССТНЖБtnjgdj|ЕЗЙКЙКРНЙЕГypo|ЗМНМОМОНМПНЙВДДГxmlxВКММНИИКММИЕ~~ГЗИЛЙЙЙКЛИИГ~niq{ДЕЗИЙКЙЙЙЕДИПШЯСМКЙЙЖИКЛОПМЕ|t{ДЖИИЗЖИЙЙСЫЯОИДЕЗИЙЗИИЙКЗЖГЗЙПФЫо╣│ЭМoaV\`eqЗа░╝║╣╝─╓шЇўё▄░ДnuПж╚уху▀╨╡ЧЕЖСШЫЩЪХСОЛЙЖГ}ДЗДГАyvuxyЗЗЕБ~ywyДИББЕє                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ┬═╥╦╢ЦxГТЭЭФ{ББЙХ│╙эў∙°ўЎїїїЇЄЄьс╙╞╜┐─╩╠╠╔└│гРМНКЗГААЕКЙАsgmЗе║┴╝жСwbcqВЙОУТНЕДЙКГ|umhgpБИКЛНМНППЛЗБ~vmoБКМЛННОНМНППНДВВД~tjk}ЕЙЙКЛКЙЛМКИЙГБАВЖЙЛЙЙЗИЗЖГ|wiesГЖЖИЙККЙКЖБz}ЙТЧФСЛЙЙЗИИМОФЦН~~БЗЙИИЕДЕЗКСШЮЦРМЛЛЙКЗИИИЙЖЗАГКТШл╛╗дТЕugcdejqАЬиоЪИГГОв░╣пШ}eboЗв┴┌Єяц╩иТwyСЬаекмаФПНЛЙВГЕЗЖБ|{vsv{ДЙЗЕВ~yzАИЖВВЩ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   Ї└╠╧┐аИw{ЙЦШПА|ББЛЫ┐▄Є°√·∙∙°°°ўїЄы▀╧┴╛╞╧╪┘█┘╙╔╗пзЫУОЙВДЗПМyiafАЩп║║йЩ~flxДЙОУСЗ~yЖОКГ{phiwЕЙКККИКНПЛЖВ{tovДЛММНННММЛММКЕВБyqktАИКМЛЙЛККЙДВВВБВЖЙКИКЙЙЙЗДyrikzИИЕИККККИЕ~xxМЦЦЦПМЙЖЖИКМУЪЩПЖЙИЙЙЕДЗИЕЖНЩаЬЩУПЛЗИЖЗЖЗЗДГxw~КФЩз╛┴оЩПВzqnlkqyХзгЦЗ|wvwxxuk_^YfБЭ╕╞═╦┼лФГfoИЬгм╢╢▓дЫФОЙГВВЕИИЖВАyuty~ЖЙИЕА}zГДДБДы                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ╩╜╟─пП}u~ОШТ{uu|}ДТй═хї∙√√√·∙∙°ЎЇюф╥╛░┤┐╬╫▌▀▀█╫╬╚┴╡дШПИЗНПЕsaVezТЯо▒кЬЕvu}ИЛТСО{hnГНЙЗtmn~ИККЛМЛЛНРЛЖА{zx}ЕКЛКНМНММНННЛИЕВ~vlnzЕЙКЛЛЙЙККЙД}ВАДЙЙИИЙКИГukgpЙМИИЛЛЛКЗВyopzЕСЦЦСПЛЗЖИМПФЫЯЩТПОЛИДДДВАГЛЧбеаЩСОКЙККЖГБ}wou{ДПШж╝┐╖гЧПЛЖБwqpuЛззЫКД|ytpmifd``h}Чл╢ЦНВ{tdUdБЩгинм▒нкбШСМЕДЗИЙИЖГ|xuv|ЖИКИГ}}ВИЗЕГУ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ■м╝┴╕ЭАxyЕЦЦЗloyАГЛЩ╣╪эЎ√№√√√∙ўїЄэх╫║бЬж╖╞╨╫┌█┘╫╥╨╩├╖иЩСППСВl]WdzЛЦЭевЭЛГАГИМРОЙudeuМНИБyqtДИИИИКИЙМННКД||ВИКНМПООНКМММЛКЖБ}vntБЙККЛМММММИАzwy~БДИЙЙЙЛМКД{nffsДКЙЙКЛМКИДtijvВИСЦФФНЙЙИЙОЦажаШУСМЙЕГЕВАИТЮкзЬХПЙКИЖДА{wtnp{ЗТЦг╢┬╛░ЬТОКГ~vmoГазаФПКИЕГ|vqmjglzОгйЦАsfZUU\{ЧббЮЮЬЬЮваЫЧКВЖЙМЛИЗА{yzДКНИЕА}{|ЗКДВЕф                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ф▓╗╖дНuvАРЧОwdo}БЖТй╞тё°·√√√°їёэшс╘╜ФНПЧд╡┐╟╦═╦╩╩╨╨╬╞╜нЬЦХУi[QdzЕМУЪЮЬРМИЙМНУНЕn`ckВНЛВ~z{ЖЙККЙКЙЛЛНЛЛЙВДИКМЛНММЛКККЛМЛИВ~ww}ДЗЙКЛЛЛЛМЛЗ~tt}АААДЙКЙЙЙЙЖБwlgk{ДКККММООМЕzqflyБДЛРХХТНЙЙЙМХЮззЭЧУОИЖЕВ|x|ВОЭнмгШТОЛЙЖБzusqlqyЗРХЮп┬╚║дЧТОИБxqn~ЪжеЫСЛКДДГ}zwtrxЙЮкаЖ{maZVavОббХЙЖГЗОХЪХЛАГИЛНКИВА}{z~ЛРМИДГ{{ДИЖВВР                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                п│▓иЦАnxКСПАnhsБЕНа╝╘щє°···°Їяч▐╓╩╣ЭАКУЩвн▒╡┤││╣┼╬╨╤╔┐┤йбЧАi]Xd|ЖДЖМЦЪУРККННСЛБj\\exИНЙЖЕГЙЙКЙЙККМКККИИГААЕКМНММЛМКЛЛКЛЙКЗДyzВИККЛМОЛЛЛИАyqhsГГГИЙИЙЙИГqfgqАИКИИКМОСПГxnip}ЕЕЖМУЦУОЛЛЛМХЬжкдЬХСНИГ~{wyБРЮмоиЬХОЙДБ|uooootАЙРХЪк┐╩─оШФМИД{qnzТкнгЦСНИЖВ~~}zuruДЫлеТЗ}skdewЗЫвУ{mjo{ЗРРwu{ЙОНЛИГГБА}КТРКЖГА~ВЕИЖВД▄                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ўи╡оЬЙyn{СТГsfh{ДНХн╚▌ьЇў∙∙°їют╒╟╣кЪЖq{ЖНОТЧЧШЦССЯ┤─╧╘╤╬╚┐▒ЭВi\Yj{~|z{ЖЦЦУОММПСЙ}eX[`rДКЙЗЙКМККЛМНКМММЙИЗГГДИКМКЛЙММММЛНЛЛЙДВ}АЕККККЛНЛЛКЙ~tlkvАГЕЕЗИЙЙИЖВ|kdkwГЙЛЛЛМНПСПГvljuВЕВГИСХШТЛМЙКНЩипмзЪУНЗА|wuzГРШз▒одЧСКД~wrnmpu~ЖКНФШе╗╩╔╣вЧРНИslsЙг▒оЫТОЙЕА}}vtxВФклЭФКГ|xyyИШЯУzaVV]gokhipДПРОИДГГААЙХХСЛИВДИЖДГЛ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ╦й░дР~lnДЧПwhdoАКХд╗╨уьЄїўўїёч╘┬мЭФЙuqyЗЛНННОЛЕ~~Йе╢╟╤╒╓╙╦╛дЗm`_n|~wppwЕХХМЙЛЛЛИ|eXZ`k~ОНЛМННКНЛЛКИККЙЕГИЗГАЕКЛКЛЛЙКККККЛЙКЙИГАДЖЛМКЛМОЛКЗД~nim{ДЕЕВЗИЛКЙЗАwgdp|ЕЙКММКЛОУФЕyqs|ЕКИДЕЛУШШЛДАКХг▒▓лЮЦПЙА}xtxЖТШбп░йЪТЙВypmlrwАЗККЛФШб╕╔═┴нЫТНИwomБЯо▒гЦСЙД}А|{yxyВРв░мЭФПМИЕВЖУЭЧГkXTMIKOQUczЛУРЗАААВЖЧЪФРНЖААДЛЛДАЖ╥                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ЦдиЫЖwmvИТЖndewКСЫп┼╓счьЄЇЎЄы▌╚░ЫУЙ{kh|ЖЙЗЖИЙЗzouДФж║╠╒╪╫╙╟▒Оvffuz{thek|ПХНКИКЙЗ}dY[`luГНОМЛНКННМККЛКЗА{АДГ}БЗЙЙИЛИКМККЙЛЙЙИИЖВГЖККЙККМККЙГyjcrАЗЙИДДЗИЙЗВzrbguВЙЛМКММНОПЩМ}uxВИЙЙЖГГИОСИАyyДФЮп╢▒гЩСЗ{xss~КПХЮн▓мЫФЖ{unmo|ВДИККЙСЦЯ┤╟╤╦╖ЯХРИГwrnzШ░╖йЩПИБ~z||zzz}ЕНЮн▓еЩУОЛИЕЖНЪаУ~maYSOKHLYqЗТРЕ}|~~~АИФЫЪФПКЖВЕЛНИВДС                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            цФббТ{qp~СР|hfoТЩн╜╩╥┌▐хьЄєЄщ╪╛дХО~rkq}ЗЛКИЗД~misАЛЧн└═╘╫╓╬╝ЪГopzzvncZUnЛРНКГГНП~dY]blp{ИОНММЙММЛКЙЙЙД|v{АЕББЕКМКМКМКККЙКИЗЕЕЗДБЕКЛЙЛНПМЛЙБtekxВЕЙИЕЖЕЗИЗВwlhm|ЗЛНЛЙКЙКМОЦТЙАВЖКМЙЗДГДЖЖГzptЗФЯо╖▓зЫРЖyww{ЖЛРТШл┤░ЭТВuons|ДЕКЛКННРЧЯн┬╧╨┬жХНГwrmtОи╖▓ЯРЙБ|z{}}~~ЕЛЪм│нвШТОЛЗИЛЧЯЭНАuk`YRLLUgСТЕ{wx|~АЗТЪЫШУЛЖБЕЙМКЕГИ╒                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ЫФЫЧДspwМУЖrfivЛШй╣┬╩╠═╬╫хёєЁш╓╣ЮТИxjmzДИЙИИИЗzfbpАКСЯ░┬╬╘╒╥┼лУАz~|vh^TQdЗФУЛЗЕКМ{bZ^fkluБЛЛЛЙИКММЛЙЙЙДwsu~ВБВЕЙЙКММНМММКЛЙЗГАГГДДИЙККЛНКМИo`i|ЙЛЛМИЖДЕЗЕ~qjftВИКММЛМММНПХЧТОНОММЙЖГАААДАwu{КФЫй╕╖лЫПВutzАЗЛНРХв░наСГzut{ГИЗЙЙККМСШЬк╜═╘╚мЦЛАzurmpЖЮп╣зСЖ|wx|~~ДЕЗНПУж╢│лаФРНКИКЧдзШПЙВxk\TRWcwТЩЗysrw~ВЙСЪЮЬШТЛЕГИННЕБЕО                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          №ЖЦЪО{puВЛК{minzТв╡└╟╞╛╕╕═шєЇёщ╓╣ЬТЖoenБЛННМЙЙГs`bqДКРЯ▓┐╠╨╨╚╕ЯУЙДtcXRQfБСХСИЕГq\Y`gnkq}ЛПНЙЗЙКЛККККВumrАЛДВГИЛММКЛММЛККЖБ{}ВВДИЙМННОЙКД|mapВИИКЛЙЖДЖДГxkek{ЕЙЛКЛЙККЛЛМЧЭЪХУСПОКЗЕВ}ААВЛТЩз╖╝▓ЬМuu|ЖММПРУЫдебФГ|y{БДЛЙКЛЛММСЧЮз╕╠┌╤│ЩК|wosmq|Чп║лХЛВ{{}~}ДДЕЙПТбо╢│жЧСНМККФдмбШСЛГ}sd`_duПЪН{qqw}ДЗКЦвгЬФНИДДМСЙВГК█                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         ╘ЙХТГyu|ЛШДukjr~Хй║─├╣ибн═юЎ°Єы┘╜ЯСВnj~КПССОНМДn_dvДЗКТЮп╝╟╔─╝нЦПЕ~p`UMQgВОХЧСПКygYYaillmvЙТРКИЛННМНМЗ~qkrАКЗГГЕЙКМНММННММЗtp{ВГБДЙККЛМКЗБwjgwЗЙЛММЛИЕЗД~rhkrБЕЙЛМКЙККЛЛНЦбвЫЧХРНКИВА|zБЕДЖМУЩв▓╣╡аЛ~u{ЕИЙКННРХалзЩИА~БИЙКИЙКЙЙЗОФЪЯ│╚┘╘╝еПГ|yyqqyМж╝│ЬПЕ~}yuБЙКЛСЦЮм╢┤кЫФНКЛКТЯкйЯХРЛДБwnlpyНЩС~ojtЗДБРЯжбЪТНЗЕЛСНДВЗС                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         ПОФИ}txЖХХypmkuЕЩо╗║▓еЩЭн═я°°Їы╪┐ЯТДsyОЧЮЯЬЩЦСЗrfm{АГИНУЪи┤╗┐╛╡жЩМБq^SLTnВНТУТТУВfY\fpokktГРСКЖЙЛЛИЙИДyliuЕКЙЖЖЗИЙМННМОМКЙЕ|njxЖДАВЕККЛЛМЖ{rfi}ЙЙММММКИЙЖqfjyДЙКМЛЛЙКЙЗДИФаждЯЩХПМКДБ~|ВБГКСЧЬ▒╝╕дРВ~ДЗКККНМОСЪй░вНИЗИЙЙКИЛКЙИЗНРШЭо╞╫┘╟оШМЖГАzrtДЭ╕╗иХНДАzplkqzВКТз╖╗оаЩСНККПЭм▒зЫХОИДБ}yx{ДЦЪГoiju~{yЗЪггЭЦОЕВЙСПКЖДЙ▌                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       °ЖТЧxyВКРЛzwnlvЙЪо▓иЮЦТУе╦ё∙°Їы▄├жЦНЕПи╡╖╣┤пжЫОznvБЗГЖИЙНФЬЫвн╢╡░еТЕs_TN[uГКПЦЦФЧМq]`imjiktЕСФМЗЙКМККЙГwjjzЙНМИГДЕЙЛНННОННЙГwjk{ДБАБВЗКЛМКЕxnhqБЙМННМНЛИЗЕ}odnЖЙККЛМЛМЙДАДСайлиаЦРМКЗБyxz~ЕЖГЗПХЫо╝╛нФКЕИИЙКККЙКОШи╖пШФПМКНМЙИЗЖГАГЗТЩк└╘▄╧╗жШТКЕvs~Щ╢╜пЯСИГА|ronrx~ГЛб╕╜│дШУПЛКНЦк╡оеШТКИЕГ}|СЬРwd^^_aiwПгибЪУЛГДПУМЙЖИС                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ─КХУwzВЙТУБyzml|ПЮвдЧОНМОа╦ё∙°Їюр╩░ЯЧЩ╡╔╨╙╘╤╔┬╕ЫЖГКЛЕЕЕЕЙОХЛЛРЮп▒мЪКtcVP`zДЖЛФШЩЫУxefnrlgkwЙУЧНИИИККЙЗБsim~КЛОЙДГГЗКННЛЛКИДqipБИЕВБДКЛНКИБsifsДЙМЛНКЛМЙЙЗodrДККЛЛНЛЙЙЖАyАОЭк▓оеЬФПКЗГzswyБКИЗЛУЩк╕╜╢аТППМЛЛЛКЕЕКХк╝╣иЭУПМММИЕЕГВАЖПЩж╜╬┌╪┼▒ЭФОЙБyszСм╛╡жЦМЕВ~qrpuЕДЛЭ╢┐╖зЩУСОКНФж╕╡лЬФНЙЗДГА}}НЪЧГm^WRQYhАЬмзЯЦНЗДЙУУМЕЗНт                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ЙОЦМu}ЗОРЗy{}qrДХбЯУДВЕЕКХ╦Є∙°Ўёц╥┴│п└╘▀уфур▄╓╬╝аЦЧЦЦПМИИЙКН||ГОанмЬРxfYVizЕИМСШЫЫШБolpnein|ЛСЦПЛЗИЛККЕ~qlsВККМКЖГВЕИМЛКНММБzqnxДЗЖЕВБЖКЛКИ~rik|ЖМННПМЛКЙКЛГpk{ЕЙККЛММЙЙГzrrЗЫи╡╢йЬФРКДАuqsyАЕЙМПУЧд╡┐╝┤еШТНЛКЙЖВБИФз╝┐┤жШТПНЙЕГАyqpr~НШв╖╔┘▄╬╗йЫЦРЗtwКг╗┐оЫПИГ}wuv~ДИКНЩ│┴╗лЪУПОЛЛТЮ╖║│дЧПЙЙЗДДБ~ЗааП{hUOKP[vХккаЪСЙЕЗТФПЗДЛЦ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ЇЖНТЕwВМОЖАВ|syМЭЯОЕВДДВЖЪ╙Є·∙ўЇы▌╨╔╧┌фыээьъчу▄╤├╕╡нвХСМИККЕokrАУдйЯЦБl[Xn|ВЖЙОЦЩЧЦЛ}urqhksМРУРМЗЖИКЗГzmjvЕЛЛККЙЕВГЗЛКЙЛЛИ~vmmzЖЙЙЖДДЖКМКДxmkrБИЛМММЛЛКЛЛМИxwВЛМЛЛЙМЛЙЕwjmЕШи╖╕▓жЩТКГzpmqxЗКИНРФа░╛┼╜пгЩТНЛЙГДУв║─╛оЮЦПМЗГytoko|ЙХа▓┼╫▀╘─▓еШТКВvvВЪ│╛╢еФЛГ|vtw{ДЙКНЧл╜└╡гХОМЛКОЫ│╛╢лЬРМЙЗЗЕЖЕЖШгЭМzfYNNVnРлмаЧСКЕДТШУЛЙКРт                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ╛ЙПЛА}ЗРСГw{xr}ТЭФАББВВЛл█Ї·∙°ЎЁц▌╪▌хыяЁёЁюьщу▌╓╨╠╞╝лЮЦПМИ}ebboЙЬЭЯШЙweau|ВДЖНЦЩХТОИrncjwГКОУТРКЗЗЙКwlm|ЙМКЛММЕВЖКЛКККК{rlqАЙККИДВГИЙГshjuДЙЛЛЛММКЛЛНПМВГКЛЛЛЛКМКЙБ{rgjЕШз╢╝╡мЬТКАsghpu{ИЦЪУСЦЫл║╞╞╣лЬУОИЕy{ГТЯ╖─┬╢жЩСМЕwplhlvБМЦао└╙▀┌╧╝кЫУМДzv{Р░─╜нЪНД}wsw|ЕЛЛНХж║┬╛кЦПЙЙИНШк╜╜│дЦПКЙИЕЗИМТЯдЪК{hYU[lИвпеЧСНЗГНЬШОЖЛСЪ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ЙНСЖz~МУОzsАВwuЖХЦИx|ВЕГБТ└хї·√·°Їыу▐▀хщыюююьъшфт▌▄┌╒╨┐│вЧСКx_\\j~ФЪЬЪПБyoz~БВЕМТЧХТПКГvrglxЕМНРТРКЖЗЗГ|rkqАЙЛКЛММЙАЖИЙЙКЙЙwqowДКМЙКИГГЖКВ{ogn|ЕКМЛЛМММККЛПТРМММЛММКЛКЖ~xncpКЩе│╝║▓бЦЙ|qfhrxzГФЭШСУЫг╖┼╩┐│дШРИВzwwПЬ│┼╩╝иЪТМwpnprt|ЕНЦЮм╝╤▐▌╙─░ЮФОЕ{vwИе┴┬╡аТЙxts|ЖКЛМУа╣╚─│бУОЙЙМХж╗┴╣кЩТЛЗЖЕЗКЛРЮвЭУЙ|kbcjВЫлиЪНЙЖДМЩЫУККРЧу                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ЁЗЛКВ{ЕПРИ|{ЕБzОЧП|xБГЗБЙе╥ю°√№·∙їюс┘╪█▐тфффутрр▀ртс▀█╥╞╖жЩНy\VWgyИУШЧУМД~}ББДЗНРФФФСОЕwpen{ЕМНППУНКЗЕГwpluЖММЙЙЛКЗВВЖИККККИrlp|ДКМЙЛЙЖЖЖЖБymgsБЙМННПРОНКЙКОУУУПООННЛЛИЖ|rjkwМШд▒╗╛╡дХИyognuz{АРЫЫУЦЬб░─╩┼║зЩОЗwwzБПЭп┼╦├░ЬСЗyrmmsx}ВИМФЭн╗╠▄р┘═║йЪСИАxtЯ╣┴╜нЧКБzvv}ДИЙНУЫ┤╔╩╜кШОККЛТб╣┴╜▒вЦПЛИЕИЙИНЯпмЭПЙ}pfk{ХжиЭСЗВЕМЦЫШСЛНХЭ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ╜МТДz~КФОВu~ДВГЙСНА{АЕЗЖВР╗▀є∙·√·∙єъ╪╔├─╔═╤╙╥╥╨╬═╙▄сфф▀█╙╟╖жТ{_XXhzАЖМСУТИВГААВЖМНЛЙОСПЗ{oir~ИМНПОППЛЕ}tonzКЛНККНМЙГБЕЙККЛКВkmvЖЛМММКИИЖЖ~tklxЕЙКЛЛМОММКИИНЦЪЬЧФТПНМЛЗГwnjkАОЧан║╛╕еЦЖtljy}}x}ЛЬЧКЙНЦк╝╩╚└оЬСЕ|wsxБРЫ░┼╬╚╖аОБuoqu|ДЖМПФЬй╗╩┌р▐╥┐оЮФЛА|vzХ▓┼┼╢бУГ{tsБИКЙМСЩ░├═─╡дФНКМТЫ┤╞┼╖зЩТНЙЗИЙКНЪл│жСИЖ~tu|МдпдЦЙБЙФбЮЦНЛРЦф                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 МСС}tБСТЗ|xЕЙБЖСОВ~~ВЕИИЕЩ═шї∙√√·ўя▀┼нзин▒╡╖╕╖┤йп┐╨▄тхфт▄╘╚┤Ш}cX[jw{vzКСТМЙИДГДЗММИГИООИАtjuВЙЙЛМНУТНИГ~rnrАКЛКИЛЛММЗВГИЙКЛК}fkyЕКЛКММКИЗЕГ{rhm|ЙММНММООМЗГДЛЧбаЩЧТРПОЛЕАrijrЖПФЫк╗┴╜йЦГspr~Б|xx~ЛТБ}БПг╣╩╩├│ЪПБ{sv|ЖСЫо└╬╠└иРБsswzАГЖЗЛНФЫи╖╞╓▐▐╓─│аФНД~txМз┼╠┐нШЙyxАЗЛЙНСЧк┴╬╔╛нЪТНМОЧ░─╔┐░ЭЦРКЙЙИЛОШж│нЪМЙЖВ}АИЫмйЩИ{wРадЭПЗРЧЯ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                юНТЛuvЛТЛБА~ЗЖИТЦР{zВЕЗЙЙПн┘юў···∙Їч═жССУЧЪЫЮЮЫЩПОв┬╙▌уфур▄╥└гВh_`lvwpkuИТСНЗГВВЖЙК~yАМРЛИxoxГЙЙКЛМУФТЗАyrqvБККЛКЛНСОКЖВГЖЙИЕwem|ЖКЛКЛНМЙИЗГzsmrБЙМЛМКННМЛГ}КШгкдЫЦТРОМВ{mioyИПУЩж╢╛└мЧВrryГГ~tu|ЗЛuw}На┤─═╞╢ЫОА}u|ВИСЧм╝╠╨┼оСЖ||~ГЗЖИЙЛМРЧд┤┴╙су█╦╣дЦМИАuwЖЮ┬═╞╡ЭК~wwАЕЙКНТЧз╣╬╤╟╢дШРНМФл┬╩─╖еЩТМЙИККНХж╡╖бУКГДДГЖШджЫЗsmtЖШаЮТКПЧЪх                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               ╗СТЗrzСЧЙ}yЗХФШЩЦИxАЕИЙЙЗМ╗▐Ёў∙··ўя█╕УЕЗККНПРСПО}~Р▒╟╒▐ттт▐╓╔░Мoehqxxjbj|НУУНИДДИКЙxkwЖОКИ|u~ЗКЙЛМНРТТЙД~spyЕМЛЛКЛЛОНЛДВГЕИИБrbnАЙКЛЛЛЛЛКЗДГ|soyДКННОННПНЙАzxГХдмоеЪТСОМБwjfo}ЙПУШг│╗╝▓ШЕxxДИЖВzvyБИzu|ОЬ▓┬╨╦║ЮОzxАЖКПХд╡╟╬╚╖ЧЛДДЕИЕДЖЗЙКОХао╛╤рфр╤└йШНИАwwАШ╜╧╦╜зОБ{{АЗЙКМПЦв▓╦╙╠┐мЬТППХг║╔╩╝кЫФНЙЗИИНТЮ│╝пШОЗЕДЖЗОглЯЗpdhtМЯбЦРОХЭе                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               НОРЖuГФУАzДОЩЪЭЬРГ~ДИЛИЖИЩ└▐эЇ°∙°Їщ╨аЕ~ГЖДКМНМЛЙquИд║╦╒█▌▀▐╪═╣ХАoouzwh_apЕСФПМЕБЖКИtko~НПЛЗГДИЙКМЛЛМООЛЕ|yy}ЖЛНМКЙЛНМНИДДЖИИАmctДЙЙКЛНННОЛЙЖ}ts~ИЙККЛКМММЖzuuВУи┤│нвШУПИrggvДКОСЦЯо║├╣ЮКБККЙДztv{ГДВГПЪм└╬╬╜еПАz{ДКЛНФЬн┬╤╨└зЦСПМККЖЙКЛКМХЭм╣╬рху╫╞йШНДВvvАФ╖╬╥╞оФЖ|{АЖИИЙНУЭн╚╙╨─│вХСПЦЮ╡╟╠└▒ЮХНЙЗЙЙНФЬо╜╕еУКЕЕИЙИШйиРrc\dyФгаФТЧЭбё                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ЄНТМАvЙФО|xИУаижЫНГБЕИЙЖЕЛШ╗╫чЁЇўЎЄт─УА}АГГДЕИЙДАhmДЦм┐╩╤╒┌┌╓═└вПГ}~xwd]Ze}РЦТПИДИИЗujluЕМЛИИЗИККМКЛМПУПЗААГИЛНЙЙЛММЛМКЗДЕЗД}pnyИКЙКМММЛЛКЙЗГ}{ГИКМНННННЛВskoАУе╡╣┤йЯФСЗyofiyЙМПТХЫй╕┴┴мСИКММЛГ}xuzДДЖЙРЩк┐╦═├нТГВВИККМРШг╜╧╒╦╖йЩТНКЗДИИИИКРЪж╕╬▌цч▐╦пЩМБ|wuzПп╔╙═╖ЬОГАЕИКЙЛОУЩи┴╒╘╦║кШФРФЬ░─╦╞╡дХОЙИЙЙМТШл╜╛пЪЛГГЕИЙТдкЪ{cY`qМбеЪПФЯд╕                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ╚ПТИ{xРЧЖwwКЪк▓зХЗВЕЕЙОИЕЛа╕╚╫рэЇЇЁ▌╜ПАА}ГГВЕИКГ}`mГУЫл╣└╚╧╧╧╚┐пЬСЛГu_ZY_tОФСМДАВДГxmel~КНЛННКККЛКККЛПОМББГЕЙЛНЛМНОПМНЙИГААxgl|ИККЛМННМММЛИЖГДИЙКМОЛЛЛКК~oioВХд╢╝║░гЧПГujbk}ИНПРТШж┤└┴╕ЯХУПОКЕ~wruКСМЙРШж╝╩╨╟╢ЪПЛЙКЙКЙЙПЩ╕╧╒╤╚╢аХПОКЗКЙЙЖКПХЯ╡╩▌хшу╤╖ЫЙАywxzЙг╟╘╘┬йЦИГЗЙЛЙЛНСЦд╜╙╫╨┬пЭЧСУЫп─╤╩╗кШРМЙКЙМСЧе╕├╣дРГВЕЕГНгмЯГh[]lЕЬеЮЦХакй°                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ПНЛГyАУОw{ЛЬонвОДЕИИЙЙИНЪдим╗╥чёєэ┌╣РГА~АБДЕЖЖАt]mГОЦЭин╖┐├┬┬╛│зШРЙБs\UU]qЗФФОЖААК{kceyЛОКККЙЙККЙЛКМНПСИДЖЙЙИЙИКММНМММЗВzqltБКМККМНМЛММЛЙИИЙККЛМНННОКЗxliqИХд╢┐╜╡йЬРАsjhrАЙЛППРХЬо┐╚└▒гЪУОМЙАyuxКЧРНРХа┤├╨╨─лЦТОНЛЙДДЙЧ▒╩╓╪╨┴оЭТОИЕИЗЖДЖЗТЮ▒╔┌фщх┘┐бНБzvwvДЫ┴╪┌╦╖вФКЛНРММППУЯ╕╨╪╘╚╕вШТУЩл┴╧╤─░ЪРЛККЙНОУЯ▓├└оЦИАГЕМЬлзОqaZe~Ънзгави░╦                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ўОСИ|zЖУЗzt~ОЮмеЩЙГГДЙЛОФЪЫЫХФк╚цєЇы╪╣СДА~ВЖЖЖГ|lcsЖРУУЩЫвкнкк│╢░дЪТЗt`YU_sГОЦТД|{y|wg_drВПНКИЙЙККИЙККЛНЛЖЕЕЖЙКККММММЛМММД}|wpixДКЛКЛМНКМЛОПМПНМКЙЛММЛЛМКЖsjlxЛХЯ│╜└╖пЮТАnfhyЕККООПТЪй║╚╚╛│гЩТМЗxqsКЧТЛНУЭн┐═╤╬└нЬУНКЕ}|БОи╞╓▌┘╠║зШСКЙЗЖД}}ЗЦк─╓фыьс═╡ШНДА{yАХ╗╪р╓├кЧНЛКМПНПРУЩ▒╩┘┘╧└мЫУТХй╝╠╥═╕ЭРМЙКЛООТЪн└└╡вСД|АЗМЧжнЯ~g]cvТк┤кзжн╢╢¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ╒ПЙВ{ИЛutАПЯдШИАВГИОФЩЪФОЛОа├чїЄы┌┬ЯЛЖВА~ВЕГАykf~КТФХХХЦЪЪШЦап▓пиЬО|e[WcvГМТУИ}|ytna\`mzИНМКЙЙЙКЙЙКККИКЗЖДЖИКЛЛМММЛЙММЛЗА{upp}ЖККЛНМЛЙКЛКЛЙМППМКМЛННЛКЖБnel|МФЮп╗└╗▒бФzljqБИЛЛННОСЦг┤┼╩╟╜наЦРЙxrrЗЩХЛМПЩж║═╫╫╦║жЩСКДzx~Лд├╓▀▀╙─▒ЭТИЕДzuuzГРз┴╒фьяш┘╟мЩТЙА|ВС╢┘у▀╬┤ШЛЕУЩЦХРПРЧк┴╒█╫╚╡дЦТЦв┤╩╪╤└жУМИЖЙЙМТЦе┐╔╜оЦЙ|БЗУглдТrdanНг▒┤лк▒╗╕▄                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ШФО}wБНЖwrtАСЬЦЙ~{}БДЛУЪЪШЛЕЕРв┼шЎЎы▐╩нЦЛЖДВЕДДБyt{ИРЦЩЩЦТУФПДЙан▓▒жЧГk\[hxАИОПЙЕ|vb^[`itБКМКИЙКМЙИЗЗЕВЖЗДБДИЛММПОНОКМЛЛЗАztuuБЙЛЛЛНННЛЛЙЗИИКППНЙЙЙКККИГ~hboБМФЭп║┴╛│дСxloxДЕЙККММНСШк┴╠╦┼╖иЧПЕ|tnrЕУСННОЦЮ╡╩╫█╙╞▒ЬУИ~vv{Лв└╓рт▄═║дФЛЙytpqu}МЯ╜╥тэЁэу╒╛кЩСЖАВР▓╓цф╪╜ФИБГКРТООРЦа╕╤┌┘╧╛лШУФЯо╞╫╪╔▒ЩПИЕЗИКРХг╗╠╚╖гПГ~ГОЯ▒│вЗqfoДб│╢▓п▓╝╜╣¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        №ТХМzwЕТВpqvДФЮР}vy~БДОШЮЫП~АМЧн╚чЎїэу╓┐зЦРКЖЗЖЕБАИФЬжжзЮШЦТК}sВОв▓╖оаМtjbozАДКПРНМИ|e]Y]el|ММЖЖЙЙКИИЙЙД{~ГЖГВЗКМЛМККЙИЛЙЛИВ|xy{ДКЛКЛМЛМКЗЖБДЙЛССПЛЛКММКЖБxfdsГМТЬй╕┬┬╕зРukn}ЙИКЛМКЙЗКУа╕╬╤╠╜░ЬСГxrnsБХЦНКМТЩ▒╚╫▐█╧║еТДysu~Тд└╓тч▀╙┬йУЖГvppmou|Ма║╨тьЄЁъ▐╠╡бТЙГБМм╨хч▐╟дОЕГГВЕИКТЩп═▄▌╘╟│ЮХХЫк┴╘┌╨┐зЦЛЖГГЙМФЭ╢╦╦┴░ЧКА}БМШн╝оЦАll|Хм║╖п│╗┴╛▌                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        ▀ТХЗxwЙПvmt{ЙЩЪАsuzАВЗУЮЫОГГОЦи└╙ы°ўЁыс╥└нЯТНМЛЛКЖЙХз╡╝╝╖мЯШЦО{qyИЪм╢┤йЧ}nku~АВДМУФРСГmd[^afuЛРКЗИИИИЙИДx{~ГЕДЖЙМКММЛМКМЙЛЙД}x{АЖКККЙКМММЙД{|ВЙТЦТКЛККМКЕschxЖНТЩж╡┴┼╝зОslwБИЙЙЙЛЛИЕДЛШ┤╦╙╨╞╢вТАpljr{ТЩСЙЗОЩл─╓рр╓┴йРДzq{ЗТе┐╒учф┘╞кХЗ~tnqosyГПЮ╖╧сьєЇях╓─нШНИДМз═тщф╥╡ЫПЗГА}~АЖМЦи─┘▀┘═║дЦУЦв╗╒▌┘╩╢аСЕАБЙМУЩ▒╔╧╦╣вТБ{~ИХи╕╕вНynvНж╖╢по╖└┴┐                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        нФСАr{ЛЙnpxВМФРxrx|АДОЩЬРБВЙЦе╝╥▐ю°°єЁьт╓╩╗мЬХРОНПТй╝╚╠╨╦└▓дЬЦПКИТЪгп░иЫЙ{rw~АБВКСЩЫЮХ}mc_^brЖМНКИЗИЗЙЗЕ|ut{ЖЗЕДЗЛЛММЛЙКМКЛЙД{ВИЙКЛКЛКЙЙЕwvzЖРХУНММКЛИГxmen|ЖМСШб╡┴─╝иНvr|ИЛЙЛЙЛЙЕАzГР▓╚╒╘╦╜еС|mhhoxОЦУЛКТУе┐╒сф█╔нСД}wАЙЦе╝╤счх▄╟иОuomnsvzВНТЭ│╠▀ьЄЇЄь▀╬╡ЬРИГИЭ─рьш▄╞кЦОЗЕГАББЗПа└╓▐▐╙┐мЪХЦб╖╥▀▐╘┴кХЗАВКМТЪй┬╥╤├пЧК~ДРв╡╗▓ЩЕwtВб╡╡нл░╗└╛ю                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ПСКАyАЖ~nt}ЗТЧИqpv|ГЗФЧУГzВПЬ╢╧▀ъЇ∙°їїЄэч▐╙┼╖лжвбдн╜╦╫┌┌╫╧┐▓гЮЬЧШЫЬЭгееЭФЛВААВВИПЩвгЮТ}mhbaoЕППМЗЙИЕЖЖБwooyЙКЕВЕЙКНННМКМКМЙЖА|~БЖЙКЛЙЛКЙЙЖ}qowЖСЦТПЛЙКЙЕ~sgbrБЙНУЩЯо╝├╛лР|zВИЙКЙЙЛЗБyrzРп╟╘╪╨┐зСyigfnuЙЪХКЛТКЪ╗╥схр╬╡ФД{xДЛФЮ╖╧▐шч▐╔зМzpquyДЙМРЪ▓╠▌ъЄїїЁх╒╛гУМЖЙЦ╝▐ььу╥╣ЭТЙЗЖЕВГИНЬ╢╨▀с┘╞▓аХХЬ┤╥▐с█╦┤ЬМББЙОЧд╜╨╒╠╣гТЖБКШп┴╗еСБzШн╖пжж░╝└┬                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ЁСТИz{ДЕxpyВМУП{ory~ЕНЪШКyrДУй─▄ъЄў·∙°ўЎєющ▀╤└▒йеем╝╔╘▌сс▀╪╠┐овЭЦТУРНЛПХЬЧУНЖВВАГЖПЩзниаРxjbcrВОРНЖЖЗЖИЙДuil{ИКЗДДЖЙЛМНЙКККЛЙИЕВАДИКННЛКККЙАwmlvЕОХЦСОНМКДynfduДКЙОУЪй╡┐┬┤ФВВЙЛМКЛЙКЖ~un|Рм┼╘┌╒┬йРujiopsДОМБyvВЫ╣╤▀цт╘╜ЫКБВЙМТЪп╞┘фчр╩иМyz|~АЕИЙМРЧл╞┌щёЎўЄъ█┬кХОИИУ╡█ьющ█└иЦНИЗЗДЕЗКЦм╔▀ф▐╠╣жЦЦЬ▒╩▐у▐╤╗гРЖААДЛУЭ╕╬╫╥─░ШМГАДСж┬┬░ЫЛААОд╕╢бШг╕└╛Ї                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ╔ХРГ{КВuq{ИПОДskt{БЛШЫЙzt|КЧ│╨чёЎ∙√√∙°їєящ▀╧╝иваЯе╖╦╓▀ттс▄╤┐жСД|vtqrq}КУЧЦРМЕГ~ВДНЬн░озЫЕqcdtБКРРИЕЖЕЗЕБqlo|ЙЛЙДГИЛМННММММКЗГВА|~ЕЛМЛЛКККЕАrhiyЙНТЦЧТООКДznfm}ЗКЛНТЧд▒╜─╝ЯМЛННМККИЗГzngwТм─╥┘╫╩мРwnssopБМЗvjoИЪ┤═▐цч▄╔кТКЛЛКОЦе╝╙тчт╥┤УИВГЕЖЗЗКННХи┬╪чЄЎ°Їюр╔▓ЩСКИТм╘ыяьу╧╡ЭСКЙИЗЕЙНХй╟▄фр╘└кЫЦЩо─█цф╓─лХКДББЗРЫ│╦╪╫╠╕ЭОЕБАЙЮ┐─║иФЛЕКЯ░╢еТЩ▓╜┐╠                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ЧТМВ}АД|uwАОЦСzlkt}ЗУЪУyrs|МЫ╣╒ъЇ°·√√∙ўЇЁът╓┴нЭФРРЩе┐╤▌уфт▌╥└ЯВpdb][`gf{МФХУРЙЖВДЖПЬи▒озЫМxbhvБКМНЛИДДЗД~nfoЙНЛДГЗЙМНМКМНЛЗГАВАВЕЙЛКЙЙЙЗД}njn}ИНУЩЩЦТОЛВsgcqБИЛКМПФЭм╗╞├░аХТПНМЛЙЗrieyУм┬╙┌┌╬▓Р|wy{sqzЖГofvЙЧн╞┌учт╙║бУРРМНУЮ▒╦▐шч┘─иТКЙИЖИЙЛННУг╝╘цёЎ°їЁф═╢ЬПКЗПд═чЁящ┌┬лЦМЙЗЗЕЙНЦж┬▄хф┌╟┤ЯЩЧи└╫фц▌╦╡ШОИДАБМШй┼╒┌╙╛зЧЛВГКШ╕─└▒ЬПКЖЧ▒╣мШЦм╣└┴·                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   №ТУИВИГuqzЗУХЖnllwВОЧЦИpluЕЧл╞█эї°···∙їёш▐╧╛жХЗ~yvМд┐╙▄рр▐╓╟вЖoebbfgdfl{ПЦЦФМИГЖЖНЦЮзожЬР}hmyБЗМПНЛГДГБzijrАКНЛЗГДЖЙММММММГ{{|~ВЕЙККККЛИБykfpИНФЬаЩУРЛБpghwГКЛНЛОФЪи╕╞╩╝мвШУОЛМЗГyoci}Ук┐╧┘▌╥╖УВ~ВАqmwВАrp{ЛШз┴╒фщч▐╦╢бФПЛМНЦг┐┘хшт╥╣ЯФОЙЕЙЙЙКЙРЫ╡═сЁї°ўєч╓╛вФМИНЪ╞фяёюс╦┤ЩРКИЖЕЛОЦд╛╓цшр╨║вЩШе╛╘фчт╥╝бТМЖГАДСв╝╨┌╫╟░ЪОЗДЙЦо├╞║дЧРЛФл╛╖дШл╣├├╓                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   тТМВГИЛ~lp~ЛУО|ghozИУШР{js~Сж╝╥тяЎ°∙·∙ўЄщ┌┼оФЖxlda`kvПж├╙┌▌▄╫═┐аБunvwqg^diАФЧФРЛЕЖИМСЦЪЭЭШСБpt{БВИПТНДВГufdtВКННЗГВЖИКМКЛКЗvswБАГЖКЛКЛЛКДБveftАИНФЩвЮЪФЛjdm|ЖЙЛКМОСШд┤┼╠╟╝▒вШСРНИwlakВУж╝╦╫▄╓┴бОИЖГtlvВЖ{{ГЛТЮ╖═▀ъых┘╟оЩСНЙКМШ┤╙уъш▐╩▒ЪСМЙИЙККМПШм╞▐ьЇўўїь┘┬дУЛЗЙХ║▄эёЁч╓┐гХОКДЕЙНУа╣╙фъх╪└зЩЧв╗╤тщц┘╞йФНЕВАБКЪ│═▄▄╩╕вСЙЕИХи┬╩─пЫТЛФз╕╜▓бз╣├╞─■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  │ЧР{}КЙviuГПФЙpdlsВПШТqsОг╛╨▌щЁЇў°°ўЇю▌╜ЧЕzkeee\[kyКЧ▒─╬╘╫╒╨╞│ЧЛГЗВ}k][buНЪЧСНЕГГЗЛОРРУСНГyz|АБЕМТСББ}rfgwБИМНЛЕБЖЙМОЛМКЕyppt}БГЖИЛКМЛЙД}tdiwБЙМУЪедЭЦЛ~gdqЙКЛМПНСХЭп┬╠╬╟╣кЭУРМЙ~sjfsДСЯ╖╚╓▄┌═▓ШРНИxmwГЕВВЙНСЪм╞█щюыф╥║бУКДДЖОй╦тыьх┘┴иЧТЛККЙЙКЛФд┐╪шЄ°∙Ўя▐╚лЦМИЖСп╥ъЄЄы▄╚оЧПЙЕЕЗМРЫ│╧фьщ▐╔оЬЧЯ┤╦ршщс═▒ЩПИДГДЕСи╞┌▀╥┴нХЛЗИУг╜╦╚╖дЩПФд╣┴╝пй┤├╔╞ъ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  УЧЙzВНЙpgwИТСi_jwЗХЩЙvqsЕЧ╕╨▐чыЁєЇЎЎїЄщ╥вЗytjjkdYXh|ДСЮп╛╟═╨═╚┐░ЯШРИxiYWYoИХЦФПКЗДЗЛЙЙКНПМЖАБ~ААГЛСОГА~zpbk|ЖЙКНМЙБГЗККИМКЖvkmxДДЖЖЗЙКККЗАxnakzГЙНУЪкндШКygduБЙЛКЙМЛНСШй╛═╙╬─╢жШСНИ{nggyЗПЩп└╧▄р╫╞нЪТКwqyЖНЗЖЙЛНТа╕╒шЁящ█─кЧНВ~БИЭ├▐ыяьр╬╢ЭТЛКЙЙЙЙМПШ▒═тяЎ∙°ёу╠мЦМЖГМв╩фёєяф╤╡ЫТКИЖЗИМЦо╩рэьх╙╣аХЪн├┘чъх╒╝вТЙДББГНЯ└╪с┌╦╡ЮТНЙСЫ╖╦╬└оЬТУЭ│┼├╢░╡┐╔╦╟                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ЄХЦД{ГКДmi|НУКwdam~РЩЦАoq{Ли╔▀шьююэяЁЄєяф╩еЛА{|xvo^WezБИФЭк╖┐┼─├┴║огЩМzgXSXpЗФЦХТНЙДЕИЙБ{ЕМНИЖЕВВВДЙРРДА~yncn~ЖЙКНМКВВГЙЙКНКГqjq{ДЖЖЕЕИЙКЙЖ~slgp}ДКОХЫзпйЩЙwfizДЖЙККККЛОУб╢╔╘╥╦┐оЫХОЖvkhmАЙОЦж╗═▄сс╘└йЧОyv{ЙСРМННМРШ░╬хюёэт╦оЦЛ~vxБШ╛▄ьёЁш╪┬иЦНЙЙКИЕЗЛУв┬█ьї°°єш╨░ЧЛЕБЙЩ╜▀яєёш╫╛гФНЗЕЗКНФк┼▌ыэщ┘┴жШЪж╣╥хьщ▄╞мЦНЕЕБДНЪ║╓тр╙┴иХМЛПЦ▒╞╬╔╕еШЦЫн├╔╝┤│╛╚═╩Ё                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ╧ФХА|ИЛhmДТР~nfiuЖХШО{tvБФ╣╒цьюьщутцыяэ▀╞жУЙГ}}yp]Yiw}ГКСШдо│╡╣╣║╖лЭО}gVTYoДРХЦУОКЕЕЗЗ~qxЖОЛЗЕВБАГЗМРИВ}xmeqВЙЙЛМОЛГВЕИЙКМКБnhqБКИИЕЕЗКМЙГzrhdvБЕЙНХЪж▒нЭНymtБЕИКЙКККЗИМЩо╞╥╒╨╞╖дЩПГpditДЙНФа│╚┘фц▌╬╕аРyv}ПЩШУРМКИСб╟тэЄяф╨┤ХЗzsuВЩ╜┌ьЄЄь▀╩░ЧОКИЙЕГДЗНЧ╣╒щє°°Їщ╥│ХЗБАДФ│╫ыєЄю▌╚оЧОЗДЗЙМСв╛┘ыяьр╠пЩЦЪо╔ръьс╧╡ЪПИДВЕМЧ╢╤сф┌╦│ЯТНОФк┬═╬┴лЪХШк╛╔┴▓▓╖─╠╠╙                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ЧУРГДКЗyksЙФЙvhajzНЧТЗ~ГЙСе├█шьыч▌╙╨┌фэщ┌┴жУЛЖАzo``my|ВЖПЦЪЫЩЭжм┤▓гТАk[W^sЕЛРЦУНЖБВЖКБrsЛПНКДДБВДИЛКЕ|wmhxДЙЙЛМННЖДЕКЛККЕ}lhuГИККЖЖИМНКЗyojmyГЖКНУЩз│▒гР}o}ЕЙЙККЛМКЙБВРе┬╒╪╘╦╜йЩМl`gzЖИНСШк┴╫фшф╫┴зР{yАТвгШФРКЖКШ╜▐ьёЁц╤│ТВtqwЗЫ╜┘щЄєях╥╡ЫОЙЕА}yzzГРо╤цЄЎ°їы╪╣ЧИБ}ГНж═чёЇяф╥║ЯТЙЖЖИКРЯ╣╙щЁюц╘╣ЭЧШв└▄ыэц╫┐гСЙГГЖЛХо╩▀фр╙╛дУООТЯ╖╩╥╞╡дЪЩд╣╔┼╖оп┐═╤╩√                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              №СФМ{ВЙВrkzПУВnignДЦЦЙ~}КНЦй╞┌хщх▌═┬├┌юяч╫╝еХНЖВА{lZapz{{~ВИРТНЖЖПЪелгХЖn`[eyЕЛНФЦСИВВДПДomvЖНМИГГБВГЗКЛИyrq{ЖККККЛКИДВДЖЙЙЕxiiyИМНОЛЙКМЛКЖwmfm~ДЗМНУШд▓╖иФГ{ГИКККИЙЙИЕ}}ЙЬ┐╥█┘╤─пЩМ|i`mАИЗЛОУЭ╖╙уъц▌╦кРzwГЦиндЩРИГЗР╖┘щёёщ╘┤РАvt}На╜╫шЄєёц╙╖ЪЛЕzwttw}Мй╦уЁїЎЎЁ█┴аМБ|АЗЩ┴ряїЁщ┌─йФКИЗИКСЩ▓╨хЁЁщ┌└дХЦа╜╫ъюъ▐╔пХНЖГЕЛФз┬▌чх█╚оЦРНРЩм├╙╬╝нЮЪв│╟╦┐оо╗╦╬╬▄                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              фРОЖВЙЙ{ok~РС{iimyРШОГВИМНХг┐╤▐т┘╦┐╗╚фьюш╓╜иЦРЙЗГzl`gs{{||~ЖННВwqoДШбаЪНzh_m~ЗКМСФХМБАГwicl~ЛМКЗДГВГЖЙМИБzrtЕИИИЙЛМКЗВДЖЕЖАvgj{ИККЛЙЙКЛЛЙВrhhtДЖИКМРЧб▓╢нЪЙ~ЙЛКККЛЛКИВwwАЧ║╥┘█╫╟▓ЪЛyectЕКИКМОЦк╠▀щщу╬пРzyЕЪ░╢лЩСКГЗС┤╘шёЁъ╫╖РАuvГПЭ╖╥цЁєёц╘╣ШЖ|ywppqr{Зж╚▀юїЎЎЄу═▒ЦИАВЕФ│╫ьєЄыр═│ЪРЙЖИЙРШо╔тяёэ▀╟лЦХЬ╡╙чюэф╥╣ЫПИЕЙЛУг║╓шщс╨╖ЩТПРФв╜╨╧├┤дЫЯн┬═┼┤о╕╔╨╨╦                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ┤ТПВГunnЕУЛxjosГЦХМДИЛИЕКЦ│╟╙╤┼╝╕╝╦уўЄч╓┐оЫФЛЗД}namz~{{}ДИЙzjderМЩЭЬЧИ{lvГЗЙЙОТХПКЗЕ}n`\dsЖОЙЗЖВВГЖЙКГ|y{ВЗЗИЙИЙЛОИБВДЕГ~qgm~ККНОМЛЛККЗ~nhnyДЗИЙМОХЭл╖┤еЦОЛММКЛМКЙЗ~rr~Ц╖╬▄р╪╠╖ЭЙvfiyЖИЖИИКМЪ┬▌щьх╘▓Т}zЕЪ░╣лЩРЙО▓╧фяёь█╝ХГ|ЙПЩ▒╠рэёёц╙│С}vttorx}ГНе├▄ыєЎЎЇш╓╛аОВГГПй╬чЄєюх╙║аСМИЖИЛФж├▄ьЁют╩░ЩФЩо╠тюяш┌┴дРИЕЖИПЫ╡╥цъф╪└дХППСЬ║╤╘╦╜нвЭз╜╧╚║п│┼╧╙╧ы                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             УТКДК}qmvНУКvps{ЛЩСА|~~}ГУп╜╗╢░░╡╛╧чїЇщ┘╟║йЮУПЛupyБГА~БГЗВq`[YlЗУШЫЪРЗГЕЗЙКИМРФТПМИГgXX_l~НМКЗЕГБДЖИЖА|АДИИЗЙКЛЛНЛГВГЕБzpirДЛИЙМООМНМЗzlel{ДЗЗЙКМТЩи╡╗▒ЮХТПОЛМММЛД{om~Ц┤╩╪с▌╨║ЭКrgo~ЗЙЙЙЕГДУ╗┘шьщ╪╖Сy{ДФл┤еЦМzУп╦уюЁюс╞аОЖЗКОЦж┬┌щяяц╨░Мzqrrqw|АДМа╗╘чЁїЎЇэ▌╟кУЕВГНЬ┼тяєяч╘╗ЯРЛЙЙЛКТЯ╝╒щяях╨╖ЫУХз┴█ыёыр╩▒ХЙЕЕЗМХ░╬фыш▐╦пЩРНРЫ╡╧┘╥╞╡иад╢══╛▓┤╛╬╥╥╠                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ·СНЗГИКulp{ТНВwz{БСПЗzutsqsДШгдЭЬЭеп├╥ъЎЇър╙╩╜│еаФЙАzЗКЙЕВГГЖИ~n[USjГЛСЦХХСЛННПНКЛОФШШХСЙi[X_jzИКЙЕГБ|~ЕИЗВГЖКЙИИКЛКМКЖВ~АwnnxЕМЛЛНОООПНЗwiiqЕЙИЙЛМСЦг┤╛╝▓иЭХПМЛКЙЗГwkmАШ░╔╫рс╓┐ЯИtiuГЙККЕВ}{Й▓╒хьы▌╛ХБ|}ЙЭеЧЗАxzДУз─▌ыЁЁц╤┤ШПНОПФЭ╖╬сыэц╥▒Н}vtx~ГДЗКПЪ┤╠▀ьєїЇяу╬┤ХЖВГКЧ╕█эЄяч╒║ЬПКЗЗКЛРЪ╡╧фюяш╒╜аХФЮ╕╘шЁэх╤╢ЦНЕЕЖЛЦк╟рыыт╥╣ЯСООШ│╠╪┘╨╛одд▒╚╬┼╖▓╗╠╙╙╠Ў                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           хТНГГЛЗrhsДФИ~z|БЙЦН}pmminzМХШФЛОУЫй╜╨ъўїьх▀┘╤╦├╕нЩТСЭЫЧУПМКЛЛiZUUkАДДЛТФЧФФФУСООНТЩЮЮЫХre``iuКНЛЗДГ~А}ВЗЙГ~ГЕЗЗЗИЙМКЛЛЙЕБ}ulo}ЖКИКМООППКГsgisАЖИККККРУЯ▓┐┬║пгШТНМКЛЗrjmГШо┼╫ут┘─аИvr|ЕЙКЙД}xwЕо╥хэюу╩дЗ|yБРШКytszЕФа╛╓шяЁы█├кЩРННСЧй┬╪цьш╫╝ЧЗВАБГДДЕЗНЦи┬╫шёЇЇЁч╒╜ЮЛДВДОл╨чэяч╫╗ЫЛЖГДИМРШо╚▀юёъ▄─зЦТЧ░═фэюч╫║ЭСКЖЕЙСд└╪щьч┘└зУСОЧм╞▄▀╓╚╕йгн├═╔╝▓╡╚╙╓╙╒                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ║ПЗВЙНБlhvЗМББИОЧШГsjiiksДУШПЕАЖНФа║╧ыЎїяычу▀█╪╧╟┐╢п│╡пидШФТОАjWRZoБАy{ЗХШШЩЩЦФОООСШаегЯВndbjtЙПСИВВА~АВЖЖАВДЖЖИЙКЙЗКЛКЕ}|yqjqБЗЛЙМОООРТМБpejyВДИЙКЛЛПУЭп┐╞┬╗кЫУПЛКИВ}mdqДЧл╞╒тц▌╦еИxwИККЖАyroЕн╨уьюц╘╡ЧЖ|zИПАmflzИСЪ│═тьЁэу╙║дФНОНТЭ╡═▀щш▐╔мУНИИЕЖЗЙЛКТЮ╖╬сэёєёщ┌┴дНЖВБИЭ─сэющ┘├дНЕВБДЙПЦз─█ыЁьс╩пЩТЧи┼▐ьяш┌┴бТЛЗЗЙПЭ╖╙чэъ▌╚пЦСПХй┬┘у▐╤┴пек╗╦╠┐▒│─╨╓╓╬■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ЦУЕ~ЕЗykl}НЛ}АИУЩЯХznjkptАФЩМ~{|ВИРЬ╕╨ыїЇёяюэшчу▐┘╒╥╨╨═╚┴╗│мЯЦЖk]X^sГ~qn{КЬадеаЪУРНТЦЭиибТ{jdiuДЛФМЕБА{}АДДАВГЕЕЕЙИЙИЛЛМИБ{wnjtГИКЗКМННМТОВoem~ИЗККККЛНПШй║╟╔└▓ЯЧСНКЗАxlhrЗЧи┴╒▀хт╧лМА~ДИЛКЕ}sopДй╠рыэы▐╚жМ{zБЕ{pmuБКТЧе└┌ъЁЁщ┌╞йЦНММНФе┴┌цщу╘╛еЦНЙЖЖЖЗЗЙОЧк╞┌щЁЄёъ▄╞йТКЕГУ╢╪щющ▄╩мУКВББЖЛХг╗╘чюэх╥╖ЭУФб╝╪щюъ▌┼зУМИЖЙПЧо╦уюьт╨╢ЩТОТв╛╫фт█╔╖из░┼╬╟╖▒┐╥╓╓╘щ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         №УСЕГЛИwkrГУЙyАПШввТwmmsxАПЩСАz|}ВДРЮ║╙ыїЎЄєёяюычу▀▌██┘╫╒╤═╚┬╖гМrbZcuykfo~ЦзопмвШУПТУЬгебЩЙqhlvВЗМЛЗВБ~{y{БДА~ВЕЕДЖИЙЙКМЛЖА{wpq{ЗЙЛЙМНОООУПГpgrБЖЗЙЙКЙКОНХЯ╖╞╩┼╖йЪТНЙД}tgguЙЦе╜╤▐цф╒│ОЕЕЗКЙЗДypjmЖд┬┘шэях╘╕ХА{}Г{x{}ГЙМПЫ╡╤фюёьс╨╖ЮСМЗДЗФ│╧уыш▐╠╡вФМИЗИИЗИНХг║╥уэёёы▐╦░ХКГАОй═фыщ▀╬╡ЩЛЕ|БЖРЩ▓╠рьюш┘┬зЦХЫ│╨фыъ▐╔мХМЙИИМФе─▌ьэу╙╜бТПСЭ╖╒фц▀╤╝лен┴╔╚┐╡╜╬╪┌╓╬                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         хУПЖИКБuq{ИСxЖТЭеаЗsns|ДЛХХИxv|~ГКТе╛┌эїЎЇЇєЁющхр┘╪╫╪┌┌╪╫╫╒╬╞┤ЦlbjzvcZasПн╣╗╕оЮЦСММУЯгбЩОypqyБЗППЙЖГ|wswДА~ДГЕЖИИЗКМНЛБzuquАЙККККМНОПУУЗrlvГЙИЙИЙИЖИЕОЩп┼╬╔╝пЮХНЗЕzpggyКЦв╖╬▌цч█║ЭПЛММКЕАukioЗЬ╕╬тьЁы▌╞аИ~|КЕ}АЗЙККТж╞▐ьёэх╘╗гФЛ}АОз╞▌ъъф╘┬лЩРЛЙЙЙЗИЙСЬ▓╩▄щЁЁьс╧╡ШЛБ{}ИЪ┴▀щъс╤╖ЭСКЕА}ДОХз└┘щюъ▀╦▒ЪУЩн─▐щыс═▓ЩНЙИИКСЭ╗┘ъэц┘─иУРТЬ│╨ущф╫┬пжи╗╠═─╣╗╚╫▄┌╤ў                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        ┬ТНВЕЖzrtАЛН|{ЗУЬаХГ{y|ДНЦЩП|qszБВЛЦн╟ряЇїїЇЄюыф▄╥╩╚╔╦╨╥╓╫┘┌╪╨┴кР{ouАt_X]jМл╝┬┐│дШТЛЙОШЯЯЪРvw|АДМТПЗВАzvpq{ЕЖВГДЗИЙИЗЙМНЛЕ|xvzГЛММКЙЛММПУФКxr{ДЗЕИЗЗЗЗДГЖТй├╨╧├╡зЩСЗАukbi|МХЭ▒╩▄хшс╩░ЫТРМКГ~piluЙЧм─▄ъЁЁф╨оН~}ОНИЖЕЖЖДВЛШ╝╪шЁяш┘┬жТКywyЗЫ┐█ъьц█╩│ЭТОКИИЗККПШй┴╓хэяьу╤╣ЫЛБ|АЕХ╢╓хчу╥╗вТЙЕАБВЙСЬ┤╨хэьф╥║аХХв╗╓чыф╥╕ЬСКИЗЙПЩ▒╤чэъ▌╚нЦРРЦо╩▀шч▌╩╡иж╡╞╧╔╝╖├╘▄█╒┌                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        ЦСНЖМДwovВКЕx|ИТШЪЛ{y~ГМЧЯФБvty{ГЙТг╜╥цЁЇїїєЁъу╪╠╣мдл╡╛┴╚═╥╫╪╙╩╣бО}АВq_Y^iИк╝┬┴┤гЧОИБИРУШЧРД|zВГИНПЙБ~{rjlzГВААВГЕЖИЗКЛННЗА{|ЕЛМЛЙККМНПТУРБ{ГИЙИЙИИИЖБ}ВНд┴╤╙╔┐оЬУКАshcnМТЧп┼┌хъч╫┼оЬУНЛВ{mdmyКСЬ╖╘шяёч╓╖УГБУХОИЙЙЖГАЕУ│╥хьэщ█┬жОАrquДШ╝╪цыщ▀╨╣бТНИЗЗЕИЗМХЯ╣╧сыюьх╒╗аОДГПл╧счу╓┐жХНЗЖЕЕДМЧи╞▀эьц╪└жХФЪ░╧уъц╪┐аХМЗИЙНЦн╦тььт╬│ЩРРФи├▄шщр═╝лдп┴╠╦┴╢╜╤█▐▄╥■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      №ППКЕЙ|uryИКАt{ЕНФОxАГЗСЪЬЗ|wuw|ДНЫ╖╬▌щЁЇЇєяыт╫╚╖ШЗЗСЪбк░║─╦╥╨═┬┤бЧСЙАo]WXiИв╢└╜паШРЖВЗМОРУСЛЕА}~АЗЛМИГ{rhivЕЖБ~АВГЕЕДИЙЛНКВ}АВЗЙНМЛМНПНПТХХКЕЗЙЗЕЗЗЗИДБ||ИЯ┐╥╫╧╞╖вЦЛqhfsВМРХж╜╒фъьт╒┬нШОЗwgco}ДКСи╦фюёы▌┐ШИИЧЬФОКЗДАzВПл╠съэщ┌├дЛ{qqwЗЩ║╘хъщт╘╝жФОКЙЗЕКИМТЬ│╔▄щьыф╒╗бОЕГНв╞▄цу┘┬лЧОИДГГГЖРЯ╜╪ъьц█╟мЩФЪк╩тыъ▌╚жФМКИЗМУж─▄ъюх╙║бТПУг║╓чьф╘┬░ел╜╬╙╞║╜╠┌▀▌╪ь                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      шПМКМСxqtАОЙzruВМОД~{ГМХЫХ|tuwy}КУй┬╓уъэяЁюыс╒╟╡ЫЕvxЗУФХШбп╗┴╞─└║маЦРЕp]WYjИЪн╢╡кЮШРЕ~БЕИЛПНМЙЕААГЗЛПЛЗБ}qfisДДАБГДДГЗИЙКМЗАВДЙКЛЛЙЛЛММПУЧЩЦСОККЗЗЗЖЗД}wwДЭ╜╧╪╓═╛йШЛ}ngjxДЛПСЮ╡╠▀щюыу╤╛еХЛzrhgrБЕВИЦ└▐ьЁь▀─вОНЭгЪТРМЖy~Нз╚█шьш┌┬ЮЗypsБНЬ╡╧▀шшт╒┴иФПЙИЕВДГЗЛЧл┼╪цыых╒╜бПЕ~ИШ╝╓тт┘┼░ЩРИДГДЖЗМЩ│╥хъц▀╦░ЭФЧи┼▌ъыт╧пФЛЙИЖИРб║╒шящ╪└зЦТФЯ╡╨хыш▄╚╡йк╣╬╫╧╛╝╩╪▐▀▌╒                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ┐ЛКЗКНtu~ДЙВunuДТП{x{БЗРШЧЗsrtv{ЛЧ┤╦█сфшщъч▀╤─░ЮМuhpБЙЛНОТЪдл▒┤╡╡╡мгШМxaWVmЕФЯзйеЯХРЖАБДБЖООНЛЗДББГЖОПКБ}rhisГЙЖВДГЕГГЕЗЙЙЙЕВВЕЙЛММКМЛНМПУШЫЪШТРЛКЙЙИЖДyqrДЫ╝╬╪┘╥─пЫЛwkjp|ЗКМПЧл┴╓хэяъ▌╦┤ШКxlaivА{ВР╖┘ъяэу╩кТТбиЯХПКВzu}Не┬╫хъч┌┴аЙ{u}ЖПЪ░╔┌хчу╒┬кХНЙЖВ~БАЗТв╛╘ущъх╫┐зРЖА~}ВСо╧▀т█╔╡ЬТЙДГГЕЕКХл╚рщш▀╬╖аХХв╛╪чыу╒╣ЭЛЗИИИОЪ╡╨фюэ▐╚пЩУТЩн╔сыы▀╨╝мк╖╦╪╒╞╜╚╒▐с▀╪ў                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ТКЕДЛИpyДКИ{onyКТИw{~ДНТФМzuwwz~ГОЭ╕╦╓╫┘█▀с▌╥┐нЭУГidm~ДЗЛЙЛПФШХШажо▒нгЧГn`\qЗТЧЭввЯЧРЕ~ГДГxВЛПЛИЖВБВЕКОНВ{qjlrАКЗВГЖЖГДЗИКЗКЖГВДЗЙКИИККЛМОУШЮвЭЧСМММКИЗГwntЕЫ╜╧┘▄╓╔╡аМwghuБИКМПУЮ╢═сэёюх╓╛бКuhfny~ytxЛ▒╘чюэф╬нФТбйбЩСЙ~xsАОг╝╥сшц█├бЗАГКСЩй└╙рху╪┬кЦЛДyttuw~МЫ╡╧▀цщх┘└мТИ}|Нв╞▄с█═║аТМИЗДЗЕИСв└┘цщр╥║дЦУЬ╢╤тъц┌┬зТЖДЗЗКЦо╩тююф╤╢ЫФСЦе└▌ъьх╓┼│л╢╔┘┘╦─├╧▌тт▐с                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ■СИЕИЛГo|МСЕsorАРТБvГДИСЧСssvvz~ДУа┤└┼┼─┬▌▀╘┼пЫХКyf`oБДДЕЖЕЙКТЖАДУЮн┤пдТ|ngwИПСЧЬЮЯШУКЕИИЖtvДПОЙЗБАВИНМГ}tmnvЖИДАВЕЕВДЕЖЖДЕЕДБВИЙЛККЛЛКНПТШазеЩФРМКИИЕВskrЕЮ╝═┌▀┌╧╝гМwhlyДЙЛЛНСЦз┬┌ыёёъ▄╞жЛtgfq~vntИн╨тьэц╙│ХПЯкбФЛДАvqАПЮ╡╩▄хх▄╚йПДДИМОФЮ╖╦▄ут╫┬иТЕ~xrqppwxЕШ▓╔┌хщч▄╚пЦЙГГБИШ╝╫▀▄╤╝дФМЖДВДЖЙРЬ╕╨сч▀╥╝жЧХШ░╚▌щш▄╚нТЖДДЗКФз┼▌ьющ┘╛аФПУЬ╕╒цыщ█╚╖о╢╞╫▌╙╞┐╔┘уут┘                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    эНЕДЙКБyДОПnnvЖТН{uЕЖОЦЧИqmsxz{~ИУазййги╞т▄╤╛гТПВxddtДЙЖЖДЕДЕИvolzТг│╢оЬЛ|{~ЛОУЦЬбдЮЩЛВИЙЗom~МПЛКДГВВЕЛОЗАvrswБЗЕБВГДГЖЖЖД}АГГВЖЙКЙКЛЛЙКММЦаклвЩТОММЛЕ~oltЙЭ║╠┘▀▌╘└жМtkq~ЗКНЛМЛОЩ╡╘ъЁЄэс╠лЙtilw}zpjsЙк╩▐щэч╓╣ХМЫзЭНЗВБyxВНЩм┬╒▀у▐╬░ФОЛЛКОСЫм└╒р▀╓┬дК|rnjknqtzДФо─╓учч▀╬╕ЫКГБ}~ДС┤╨▄▌╒┴йЧПКЕВВЖИНЧм╞▌ц▀╙└лШУЦз└╪чч▀═│ЦЙДДДЗПв╜╫шяь▐┬еЦСУЩп╠тыы▀╬╛▒│┬╙▄╪╦└╞╒сфф▌Є                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   ╥ОЖЕМЗxtДПНxkqАООЗ}~ИНУЧТ}ilswx|ВОЩЯЩПЙНб╤Єю╫╝бУМАqaeyДЕДДДГДД~hccmЕЫй┤┤жШЙАЛНРСТШЬздЭОДЖЙЗfbtИМКИДГББВЗМИГytuzВЕЗГАВБГВГГАy{АВВДИЙМККККЙИЗКФЯлмеЬФПНЛКД}lhwЙЬ╢╩╫▀р╓─еМtluБИКМЙИЗЙТк═цёЄяф╧кЗqkpx{xkfuЙж┴╫хыч┌╜ЧЙЦбЧЗАБ~tzДНЦг╖╠┌с▀╙╛иЧРНЛМНХа╢═┌▄╒┬аЙ|rqnpstv|ЖФй╛╤рчшт╘╝гОЕИГzНз╚┘▐╫╞пЬТЛЕДВГЗКТв╜╓тс╒├кШТФб╖╥тшт╥╗ЭМБДИПЩ▓╬уюэу╦кШУПУж┬▌щэу╒┬┤│╛╧▀▌╬┬┼╥рхцт▄                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   йЙГЕЙБvxДСНvhwЛХПБw~ИНХЧКqalw{}~ИЦЫФГxwЖЬ▌∙є▌┼зХНВpgo|ЕЖЗИДГДГwbZYcyПак░мбЬЧУФЧХУЦЫбвЮСЖЖАw[]kАОМИЖЖББВЕЙЙД|y{{БВДГГВАДГДДВ~usyГЕЕИЙЙЗЙККИЖБАНЪй▓нгЧТНЛЗВwiiyКЪ│╔╓рр┘╚йНwr|ГИКМЙЕЕЕЙЩ╞уяЄЁх╧зГllu~zrjjyКЭ╖╧▐цш▄├ЪКПЩО{yqkr}ЖНУЩл┐╥▌▀┘╚┤вХОЛЛНРШл├╘┘╓├вИ}ssrv|А~БКУе╣╠▌хчф┘─кПБwtuwЕЬ╛╙▄╪╦╖гФМЗЖДДЕИРЪ┤╙рр╫╞кЧУФЬ│╠▐шф╪─иСГ}АЕМФй╞▌ьЁч╘╡ЧРОТЬ╕╘чэч╪╚╢│╖╩▌у╒╔├╠┌хцх█¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  СЙГЗЛБs{ЛХКpmБТУИ{zДМСЦСhany}БИФЪСГvknАау∙єс╧╢ЫТВnfsГКЙЙЙЗЕЕГt^VU_pЗУЬвкивЮЮЫЪХЦЦШЫЮЫТКИ~iXYgyНТЛЗД~БИКЕ|}}БВЕЕДВААВГВАyqptВЗИЙКМККЛЙЖВ}vГЦи││иЩТПЙЖ}sefzНЩо├╙▐с█╩кНtvАЕИЛМЙЖДАЕХ┐▀эёЁф╨зБkoxyumem~НШо╞╫тх▀╔аММОГshcnwБИЛНУЫ▓╚╪▀▄╬┐лЧПМИЖМСЯ╢╠╫╪╚жНЕ}|АБДГДКУап╟┌фцх█╔оЦБtpqvУ▒╧┌█╨╛иЧМЗЕГГЕКРЩо╩▌р█╔оШТФЩм┼▄хх▄╩░ХИ|zАИСа╗╘шяъ█├вРОРЦо╠уьщ▐╬╝│╡╚┌у▌╬┼╔╓учцсэ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 №СИАЕЗwДППДwvЙЦПА~ВЙПТТИua`p|ВИТЧЧЙyndjГЭу∙Єх╫┴кШЗvtНФУТРНЙЙГpZSOZn{ВКЧЮжлп░меЫЩЧЦЩЩХСМИБlW[fxЛУОЙЗВБББДЙЙВ}}~АБГЕДА}АВГГВxkfqВИКЛЛКИКККДАwtАУдп┤нЮШТМЖ{rdj~НЦи┐╬▌т▐╦лОzzДЗЙЛКИЕА{~М║█ъЁЁх═дАos}|nhbmМХг║═▄тр═йРЖД|peiv|ЕЙЙКЛУд╛╘▌▌╙─пЬТМКЗЛНЦй┬╥╓╦▓ШПЙГВВГДДЕЙСЮо├╓тцч▀╬╢ЦБupsx~Ое╟╪┌╙┬░ЪСКЙДГЕИМФй┬╫▌▄╠╡ЫРПЧв╜╘тц▀╨╕ЮНГ|{ВНЪ░╧хюэс═нУОПХе├▐ыьф╒┬╡╡┬╫ур╓╔╞╘тчшх▄                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 эОЗБЖГ{|КФПБt|СЩН{yГМТШСl``rАЖРШЪР}shbkДЮтЎёч▌═╣аМ~МШЮЫЫЦФРНИnVRS]lyxwВУЯм╕╣╖░дЪХУТССРПОКu^]gxКТНИЕВББДЗГАААББВДЗГ~ААБВ~tgfpВКМОМКЙЙКЙЕ|sm~Тв░╣▓дЫУМГypgpБНЦж╖═┌тт╥░Рz~ЖЙЙЙЛЗД~w{О╕╪ъЁЁч╨жБuz~tgfguГКПЩм┬╘рр╥▒УДА{rmn|ВЖЗЖДГКЧ╡═█▌╓╟│ЯТЛЖА}|МЪ╕╬╓╤╜иЩОЗГЕЕЕЕЗКНЩк┐╤▌фцр╤║ЫЕzsy||ЙЬ┴╒┌╒╚┤ЮФПЛЕДЗЙЛСб╗╥▐▄╨╗дФЛТЫ┤╠▀хт╘┐еТИzЗХл╟рэюц╙│УННТЫ╕╒чюш┌╞╣╢╜╧ру▄╤╟╧▀чыъс·                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ╤ПДБЖwНУЙ|tЕУЦДw{ЗНЦЧЗre[dxГМШЬСБwrjcoЙйтїЄыу╫╟▒ШКНЯп╡╖▓пгЩФНr]RSaptrnqБЧк╝┴└║пвШФНЙИКСФФ|eahvЖСУМЗЕВВБВГБ}~ББВДЖДВАААypeerГЛНОНЛЙЙКЗВznl|Сбн╣╖иЮЦМБxjesДМФЮ▓╞╪ут╓╗УГГЙЙККЛЕxsuИ╢╓шЁЁщ╨иЖy|}pdimЕКНХЮ│╠▄р╓║ШИЗГztwВЕИЖГ~|ДРп╩╫▌╪╦╖аУКБwxxГХ▒╩╪╒─┤вТКГЕДЕДЕИМШе╗═█фцу╒└гЛ}vxx}ГШ║╙┌╫═║еЦРМЗЕЗЗЙПЫ▒═▐▐╒└лШМНЧк├┘тс╫┼оЦЛ}x{ДПг┐█щэш┘╝ЫМЛСЪн╠фэы▐═╗╢╗╔┌фс╒╚╬▌цъъцщ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                зРЕГВ|}ЖЛЛЕ{{МЧФtКТФФka[j|ЙЦЪФВ}ytggvР╖цЇЄэщ▀╘┼│йк╕╞╦╩╚┬╗наУucXXfrvngdnЕг║├─└╡йЬХЛВ{ВПЧЪИpgkxДНССЙДВВ|ВВ{ВББДИЖВАА{nfjuГЙНООМММКЖАtkm~РЮм╕╖овЧМАthlxВЙСШм┼╓уц▄─вПМНМЙКИДtosК│╘цэяъ╫▒ЙБАzmbiuБИЙЛНЦк╞╪▀╪┴ЯПЛЙЖААЕЖЖГyyВПи├╘█┘╠╖ЯПВvqqr~Сн╔╫╪╠╜кЧНИЙЖЕДДЗЛТЮ┤╚╪уцф╪╞жОБz~{}ДХ╡╧┘┘╤┐зЩСМЗЗЗИЙНЩм╚┘▌╫╞░ЩСМТЮ╣╥сс┌╚┤ЪНВzyВМЫ╕╒хыъ▐╟зПИОХе┴▀ььт╤┐││└╘ут┌╬╨█хъьър                                                                                                                                                                                                                                                                                                                                                                                                                                                                                СНЖДДz}КСЙyАСШОyuБНХЧМuc^^qГТЧУКzzxrkjАЬ╞щєєЁюцр╓╩╟╩╨╫██╪╙╦┬╢ЭГn`altrj`\atУ╢├╔┼╛│дЧКw{ОХЦРБqn{ЖМССМИЖГБ|v{БВ{{~А~АИЙЕААyhbkxГИМООМЛЛИБzqfkБРЬм╢║│зЩПАpfj{ЕЛПЦй└╘сцт╙╡ЫУПНЛЛИД}qmvЛ▓╧сьюъ▄╣УЗwjal{ДИЙЗИМЧ╕╨┘╫╚кТПНЖБЕЗЗЗБzus|Нг╜╥█┌═╖ЭЛ~snnuБРм╞╘┘╤─пЩПИЗДЕДВЕКРЩн┬╘рхф▄╔нПГx|БПи╔╪█╘├оЫСЛЙКЙИЙМЧз┴╓▐╪╦╢ЫСМОЧо╩▀с▄═╣ЯСЖ|z{ЗЧ░╦сььт╧│ЦМЛУЮ╣╓щэц╪─┤н╡═ру▄╥╤┘хыюыцў                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ¤ПКЖЕwБМРГ|}ЖФФДwxДПШСВpd_]vМШЩП}rx{tltК▓╤юїїЄЁэц▀╓╤╥╫▌ст▀▄┘╤╟▒ХАtqvytg]V\mКк╛╟╚┼║йШК|szМХЧСНВz~ЖЛСХМЖГБyuw~В~{}БАБЖКИА|z|vd`lyВЙМНПОМЛЙГynekАРЪж│╣╖йЫТngm|ЕКНХг║╥▀чц▄╟нЫУНЙЙИГymktНл╚█шэыс┬ЭОГvfasБИИЗДВЖУо╩╫┘╧│ФУФРЗДЕГА{uqq|ПЯ╣═╪┌╨╕ЫИ{plovДТи┴╥┘╘╔┤аУКЖЖЖДГЕИПЧй╜╧▐фф▀╬▒УЗ~Б}~ЗЭ┴╫▌╪╟▓ЭСЛЙККККЛФд╝╥▄█═║бРЛМУв└┘▐▄╧╜жХИБ{zАРй┬▄шьх╒╜ЩНМПШ░╬чэъ▄╚┤зк┬█фс┘╒┘фъюэщч                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ЁРККИАtГМОАx~ЛЧО|rxИТФМ{oiceАЦЬРАvvyytq~Ъ─▀яЄЇЇЄюш▀╘═╧╓▌суус▌╪╨┴оШЙВВ|uh\TWhЕЭ╢─╩╟╛пЫИzryКФХТОЗАВИКОУПИЕГАvpryА}АААДКИАzz{tc_q}ДЙМОППОЛИГukeoБОЩб▓╕╕мЮТ|nhqАЕКНФЫ╢╬▌чыу╓┬мШРКИИБwklwОг┐╒фыэф╬пФВtklyЖЙИД|yЖг┬╙┌╘║ШХХУЛИИБxsqqВРЫ│╟╫┌╤╗ЪЕxomqЛХж╜╨╪╓╦╖вТЙЖЖЕГГЕЗКУб╕╦█уфс╒╣ЪЙ|~А}}ДЧ╕╙▌┌╬╗жУОИЙЛКЛКТЭ╢═╫┌╥╛еФНМУЭ╖╘▐▌╙└йЦНГ|z}ЖЭ╕╒цьч┌┼дРЙНХи─съыс╬┤гд╕╘тф▐┘┘тъэюьу                                                                                                                                                                                                                                                                                                                                                                                                                                                                              █ОКЛИ~xГЛЛ{xГНСИxr|МШЧГunjelКЫЦЕ{zy||svК░╤чЁЇЇєёьф╫╩┬┼╬╫▄▀▀▐▄┘╒╩┐░бЦМЗ}hZRSeЧк┐╔╔└░ЭКyqvИПЧУРЙЖЗИЙНПМКЖБ~vmisВГ}|ААГЙКБ|{{qb`s}ГЙНРССОЛИВrhcsВМХЯ░╗╝▓ЮСxmlxБЗКНХЫп╞█цыыр╬╕гУМКЕregyПЫ│╠▐шьш╒╖ЦГsiqЗЙЗДzutВЫ╜╨┘╫┴вЩЬЦИДЕБ{vsrvЕПЪо┬╥┌╥╝ЭЕypr{ДЙСЮ╕╦╫╫═╝жФМИЖЕГГГГЙСЫ▒╚┘сцф╪└бОГБГГГР░╤р▐╘─мУОИЗЗЙКЛСЩ░╟╫▄╒├иХМЙНХ░╠█▐╒─нЩОЗА}ДФм╦съчр╬░ЦККТа╝█щьх╘╣вао╠▀фт█┘съяюющї                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ╣ОМЛЗ~zГМЙz{ЗУТun}РЫТyttnkvТЪП}wz|~zu|Ф╛┌ыЁєЇёэх╪─┤м╡└╠╥╒╫╫╒╙╬╟┐╖мбХНГi]RSe{ПЮ╢├╔┬▒ЫКwntДИОРПКИИИИЛТТНЙДДtkgpБДВ}~~ВЕЛД}|wp`au~ГЖКНСТРЛЖnigvЕНФЬн║╛╖бТxoq{ВЖЙНТЦж└╒уьюц┌╞оЩПЛГ{nbj|ЛЦи┬╫фыщ▄┬ЬГqkyГИЗЕБuno}Ц╖╦╪┘╚оЬЬЧКЖДyuqq|ИОЧз╜╬╓╥┴вЙ|yГЖЙПЪ░╞╒╫╨╜зФЛИЖДВГБГЗПЫм┴╘▀фф█╞йТЕВББ~АНз╬▀▀╪╔░ЩСЙЗИЙЙЛПШл└╥┌╫╞оШОМНФй┼╫▌╫╚░ЫПЗВ~{Нв┴█чъс╤╕ЭОЙПЫ╖╘чьц╫╗еЧе┬╪ху▄█▀щюяяэц                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ШРРМД{{ЖКДy|ЙЦПyop~УЪЛttsmmБЦФГvvz}|zvБв╟рыёЄЁэч▄╞зФУЭп║┴╞╚╚╔─└╗╢╣╢▓йЧКrbWXh{КФк║┴╛▓ЭЙxqtБДЖНРМЛКИКЙНТУМГujirАЗЗАВББДЖЛЕАztn_dv|БГИМРСУМЕ{lgj|ЙНФШй╣║│вСumuДКММПТЭ╡╬рыяъс╬╡ЭТМАwhdoЛФа╣╧тщъ▀╚ЯЖvr~ДЙЖЕ~pklЦ│╞╒┘╬╣еЯЫМЕВ{wtuwБЙРЦа╢╚╥╙╟лПЕДБГЕКОЦз┴╥╪╤└йХОЙДБ}ВКЦж╝╬▄фх▐═│ЧЙДБВАГМЮ╩▄▀▄╧╖ЭСЛИЗЗИЙПХд╕═╫╓╩│ЯУМНФг╛╙▄╪╩╣бУМИГ}{ЕШ╢╤тцу╒╛аРЙНШп╠уьщ▌├зХЭ╖╤тх▐▄▐чэяЁэц■                                                                                                                                                                                                                                                                                                                                                                                                                                                                            МНРЛБy~ЖИВ|АНЧИsmrДФЧГruutwЗСИ{xy{||yvЙк╦▐шэююър╬▒НБЖТЪжл▓╡╢╡ожЬЯл╡╣┤жШl`amzЖОЫ░║╕нЩИ{rwААДЗЛМКЙИККМРУПВ~tihtГКЗ}~~БДЛИБ{vkakz~АГЗМОТСЛГxhin~ЙНЦЪй╡╜╕дОwp{ВЖЙКЙМСШл─█шЁэх╒╗гУЛАugfqАКСЩм╟┌фщс╠зИxxДЗЙЖБymikАФм┬╤╫╤└нбЭПЙЕГ}su}ЕИНТЩм└╬╘╠╢ЧПИЕЗЙЛНФа╖═╓╥├оХКД|zzxz{ГПЬ╡╚╪уфр╙╜ЩЙЕГГВДИЩ┴┌▀▌╙╛жХНЙДГГЕЛФЭ▓╔╪╪═╗жЦСПТЭ╡╬█┌╧╝зФМЗВ}Мз╚▄цф╫┼йУЛЛЦй╞▀ъьр╩оФЦй╩▐ф▀██уъЁЁяъї                                                                                                                                                                                                                                                                                                                                                                                                                                                                           °РТСКАy}ЗЗ}yГТХomvЗФТ|tywrАРЛyz{~~|~ВТл╞╓рцшъч┌─Ы~wЗОУШЬЮЭЫЦЛ~ДТд┤╗│вП~hdnzЗТЫзмжШЗ{t{ДzВКМКЙИКЙМПРНД~sljtВЙК|}АВГЖИГ{tmdq}АВЗЛОСУОДsedrБИМСХд┤╝╗йСwr}ЖККЛКОНФЭ╢╤фююш┘└жУИzpgjuБИОЦе╛╙▀хс╧йК~ДИЗЕАug`oБФе╝╦╓╙╞╢жЭСЙЗЖyrwАЖЙМНФб╢╩╤╨└зЧНИЖЖЗЙСЫ▓╞╥╥╟▒ЦЙБxutvswv}КШл└╙рфс╫─йУКДЕЕЕЗУ║╘▀▐╓├мЧПКДДВВЙОЦй┬╒┌╤┬пЪСОТШм╔╪┘╥├пШПИГАБЕШ║╘фц█╔│ЩНКСв└┘щьф╥│ХРЯ┐┌фр┘╫▌шяёёэч                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ъКМЛЕ}{АЖГ|~ЕРСwjm{ОЦМxuy{ВПЦЖyz|ААБАЕЧж╕─╚╪цщц╒║Рvs{ЖКПТТТУРИ{kjФк╢╖лЯМxnr|ГГКУЩЭЮЧКБx|ДАrtГМЛККМКМРУПЖ~tqoxВЗЗБ~}ААБДЗД}voksААБЖКМНППЕsdjuГЙЛПЩд░╣╣лТ{xГЗИЙЙЗЙИНУи╚▐ыюъ▄┼лХКwnfjzВЗЛСЦо╚┌ут╤░РЖЕЖИИБzodhuЗСЭ▒├╥╓╠║меРДББ|x~ВЗЗИКНШк┬╥╙╟╡аТНИЗЕЗНЦи╛╠╤╚▓ТДunmoqqww|ЖХж╣╬▐ус█╩▒ЧНЙЗЖЗЗР░═█▀┘╩│ЫПЛИЕВГЖМТа╣╨┌╘╔┤аУОСЧж┬╒┌╓╔╖аУМДБ~ГСп═рх▐╧╜гТЙНЪ╖╙цьц╫║ЧМФ┤╘ту▄╫┘цьЁёяш■                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ╘МКЕА|{ДИВ|~КТЛpioБССГ{БВВИССА{~ББВБЕРШЯЬе┤╒чьх╙▒Кqo|ВДЙКННМКpb`qКЬл│лдЪИ}y|{ВИРЦЧФНВ|ЖОzjyЙНКИККЛКОРЛАxtt{АЖКЕААААДЗЗ{vppyАААБДИНООМЕscjzЕИКПФЬи┤╗мХА}ЗЛККЙЙЙЙЙНШ╗╒шюы▀╩▒ЦКukgq~ЕИКМПЭ╗╥▐с╒╖ЦОЛКЗДАukcfwЙСЦж╣╧╫╥┴лЪО|suwyАДИИЖЖЗРЯ╜╨╒╬┐йУНЗЕГЕКСб╢╔╤╔│СЖwqnmnnutzГПЭ│╩█ст▌═╢ЫПММКЙЗРж┼┘▀█╬║бТМЙЖГДЖНТЩп╔╫╫╠╗жЦМПУв╜╧╪╪╧╜кЦНЙДБАГОв╞▐хр╓─оХММЧн╦▀ъщ█┐ЫНСл╦рфр╪┘тэяёёыї                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ╡ГВА|z{ЖД~{АЛНДiiuЖТЙ~yБГЙРИ~АВВЕЖЗМТЦУНКТл╒яЄч═оДpq~ДЖИЙЛЛКЗwgVXjБТЫгегЬФЙВА~ВДИНЦХОЕАГЙЙnasДЛКЙКЛНЛНННД{y~ГЕИЗВ}}~~БЕЖА|ux|БААБГДЙМППЗuhmzДЗЙНСЩд░╕▒ЫЖЖМЛЙЙКЙИЙЖДРн╬фяьт╧╡ШЗqigpАЕЕЖЖЗТй╟╪▀╪┬дХПМЖБzqifm}ГЙСЩ▒╔╓╙╞│аНvkgq|БДЖДА}~ЙЧ╖╦╙╨─░ШПЙЕДЕКНЧм┬╬╩┤ТЗxsrtvz}}ВЕРЭм├╓рт▀╙╣аРОФУНКОЮ┐╪р▐╘├йХПИЖВДГЗМУе┐╙╫╤┴мЪССХЭ╡╩╫┘╙├▓ЩРЙДВВГЙЩ╗╫уу┌╦╡ЬННХз┬┘шыт╞еНЛа├▄чу▄┌▀ыЁЄєяш                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ФГА~zz~Д|}ДПО|bi{ЙОВx}ЗПУУНz}БДЗЗНФЧПЗВДПг╫яЄц╔е}nsАВДИИИИДБsbQTf{ЙОПЦЬЫЦНДВ}{|}ГГНФТЛЕЗГ~cYkВНЛКККЙЙМНЛЖБ~ВДЕИИЕА}|~АВЕДАz{АБББВГГЗМОПЙwkp~ГЖКЛРШЭм╢│бСООЛКККККИД}Жа╟уююх╘╝ЫЗqijvГЗИГАЖЩ║╘▀█╩▓ЯТЛЗВxmghtБГГЖРж┬╒╒╩╖бНxglvАГДЗА}yzДУп╔╥╙╔╡ЭПИГБ~ГПв╜╦╦╗ЫЛГ~{{|БЗНШз╜╨▌ур╘║ХМОТЩЩЛНЩ╕╓р▀╪╟пШСЛИДДЕЖЙРЮ╕╧╪╙┼▓ЫСПТЫо┬╓▄╘╟╣ЯУНЗЖГДИФ│╨▀ф▌╨╗гРМОЫ╖╤фъу╦лПЙЩ╣╪чцр█▐щяёЄЁы■                                                                                                                                                                                                                                                                                                                                                                                                                                                                         ЙБ|yy}ВЗzv}КПИsdj}КЗ{}ГКРСОВ{~ГДЖЛОУЧХЗ}}Лг┌∙∙х└ЧwqxБИЙМЛМЙЕ~p_MPevВГБМЦЩХНИ|}АВБГНФНЖЕ~sZVg|ОРНКЛЛКНОСЙВАБГГДИИД}}|ГЗЗБ{~БВББГГЕИКОСМ|wzВЗЙККРХЪй▓╢кЭЧТНЛЙМЛИЕБzАЦ┼сьЁъ┌┬вЖphnzБГЗЕy~Пм╠┌▄╤╝йЦНЗqhdizВА{~ЕЬ╛╤╓╧└лТАww}ВДДБ{wsuАРл├╤╘╠╣аУЙГ{yvzЖЧ╖╦╬┴иЦЛЖГББББГЗНХв╣╠▌ус╓╝ЬЙИЗЛТМЙУ▒╤▀р█╦┤аУМИДДЕЕЕЛЧм╦┘╒╞╢ЯУОРЦе╜╤┌╓╦╣дХМЗЕЕЖЕТк╟▀х▀╘┴мХНЛЦл╔ръх╤░СИУп╙учу▌▐чяёЄёэї                                                                                                                                                                                                                                                                                                                                                                                                                                                                        √ЛГБxwАЖВwzГККБm`lВРЙv|ИПУФЛz~ВДГЖНСЪЩО~w{~Мз▄∙·ф║ХxvЙМОПОНМЙj\NRfzГzst|ЙХЦСОБ~|{~|АМРОНДkZVdyКОМЗЗИЙЛКПЛЕАБЕЕЖИМИА{{АБЖЗВ{|АБААВВДЕЛПТТЕ}ДИЗЙИЛРЦбн╢▓йЯШТОЛКЙИЕ}u|У┐▐ьяы▀╟жИnkq}ВГЕГ}stЖв╟╫┌╓╟оЦПИ}pgep|А~yzБХ╣╧╘╨╞│ЪЗz~БГЕДАuqor~Пж╜╬╙╬╝бФЙ|sqrwДФ▓╚╧╟▒ЬТЛЕГГДГАДЕМФЮ▒╞┘сс┘─зСЛЖГГЗЗНи╩┘▐▐╧║зЦПИЕЕИЖЖЙТк┼╪╓╠║зФРПУЮ╡═┘╫╠╣жФМЖЗЖЕЕПв┐╪хт╒┼░ЪОКУа└┌ъш╪║ХЛРз╦хщцсрфэЄєЇяъ                                                                                                                                                                                                                                                                                                                                                                                                                                                                        эЖ{twГЛЖsvДРНxiamЖПВtГМФШЦЕu~ДЗИКРЧЭН~vv{ГОл▄··у╛ЩБВНХЬЬЫЦХТЛlZLVky{wjcnzКЧХТЖВА|}z{}АКППЛzXVdxЛННКЛЛКМЛПЛЙГВГГДЗЙИВ~{ААВГВА}ББВГАВГИМОПЛДГЕЗЗЙЙКРЦЮл│╖┤лЬФПМЙИЙДxo|Ф┐▄ъЁьу╠кЖomu}ВДЖВymq~Ч║╤█╪╠╢ЭТЖykfiv}xqu}Ф░╩╓╘╠╗жСЖЕЕЕГАyqkjrАПЭ╡╩╤╧╛дФДypmpwВРо┼═╩╗жФМЖДГЕДВДЕЙСЪн┬╓рт▄╔░ЧПЙГВКЯ┬╪ср╒┐нЩСКЖИИЖЖЙТд┬╒╫╧┴оШСПСЧп╚╓╫╩╗зХНЕЖИДЗНЫ╖╥рр╫╚╡ЬПКОЪ╖╓чш▄╛ЩЛПв┼уъъфсфьёєєєь■                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ╪ЗА}x|ЙРГszИЛЕtf`tКНА|ЖРЦШРБyГЙЙКПЧЫФzvtwЖС▓▀∙∙ц╔▒УЧй▓╡▒▒згЪТГj^OZn}}rfY_nБСЦХЙД~}|ywq{ЛУЦТЖd^fwИНРЗИИИЙЙЛЛЙВАДДЖИЛЙЕ~}ААААААБ~АГГГВЙОРСМИЗЗЖЖЗЗКНТЩг▓╗╗▓дШУПНРЙsn|Х╜┘щяюх╧мЗnmzАГЖДvik{У░╩╫┘╨╗еТЖwfdmy}|wmmyТп┼╥╫╨╞│ЩНИЗЕА|vnlovБНЩп─╤╧┐дП{qilpxГСи┐╬╬┴нШОЗЕЕДГБВДИОШи╝╥▐т▌╧╖ЭУКЖВГФ╖╘ст╫┼┤вТЛЗЕДДЕЙТа┐╙╫╥╞▒ЭУОПУк┴╨╘╦║жХНЖЗЗДДКЧн═▐▀╓╞╡ЬРНПЦ░╬сш▌─вРРЬ┐▌ъьшфхъЄЄЇЇэў                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ╖ЕА{wПСr~МРБndg|КИz}ЛТЦЧК||ЕЙНОХШЦЙlkq{ГОЮ╜т∙°ы┌╦║╜╟═╧═╩┬╝░ЮОuaV`s{xn_TXdzНЦЦОЙДА}xqapИЦЭЬСoko{ЙПФЛИИКЛКЙЙИВ~БВЗЖИИЗ{А~{~ГБАААБГГГБЖМПССМЙИЗЗИИЛКНФЬн╝┴╖мЪУОМЛЕ}pkxХ╝╫цэюц╙оЗqq|БГЕДodhuМв└╙╪╥└лХЖtfgszzxnhn{Тк┴╨╫╘╠╛гТНЗД}vpmjlzДНФж└═╬└еН{rjkq|ЕТг╣╩╧╟▓ЭПИЕДГГБДЕЗПШг╖╧▌рр╓┐еЦПЙГВАГРо╬▀с▄╧╛мЦОЙЙИЗИКПЫ╕╬╓╘╟┤ЯФППУб╣╩╤╩╕гЦМЗЙИГВЗТе┴╓█╙┼▓ЩПКМСд┴╪с▐╟жССЫ╖┘щьычцщёЇЇЇЁь                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ФГВ}ЗСН|sВРР}ldmБИВ~ЕПФЧПДyКМПТЦЧПv_cq}ЗТо╔цў°ючр██▀р▀▌┌╓╬├┤ЯЖqgn}Д~l_QVbvЛСУСОИГ|vl_lДЩбаЭrs|КОСОЛЗЖИЙЕ}ВБББВЙИИИЙД}~А{vu|БАА~ГГДВЕЙМРУУЛИЗЖЗЗИИКРЩз╣┬║▒вФОМКБzokzХ╡╤фьюч╘░ИtxБДЕЗГyjbdsЕШ╡╨┘╘╞░ЧИrciv~{skfm{Те╝╧╫╫╥╟лЦПИБzrlllr}ДМТЭ╖╩╠┴зНxokszБЖПЫ╡┼╧╩╖вТКЕГВВБГЕЗМЦЮ╢╦┘сс┌╟░ЫТКЕДБВМа┼▐у▐╙╞▒ЬРЛЙЙИЗКПШ░╟╥╘╔╖вТОМСЫ░┼╤═╣дЧОИИЖЕГЖНЩ╢═╒╨┬мЧМИЙМШ┤╬▐▌╦мТСШ▓╤чэьщчъяєЇЇЄы                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ИДБ|}КТКzyЗСОwkiuЖИ|ИТЦТЙВЖНПФЩЫТ~hZbtВОЬ╗╙эЎЎёюьъщщщщчцт▄╘╔╡ЩЗ{|ЕДzk[PXfxЕЛТУТОЙАui]mЕЩбаЬП~x}ИНУРМИЗИЗБx{АБААДДИИЗГ}~~{rsyАВАГАВВГ~ГЗКРУТЛЗЕЕЗЗКЙКМУб╡┴╗╡жШПКЕvij{Ц▒╠▀ъэщ╓┤Кz~ЕЕЕДАwe^cp}Оп╦╪╓╚│ЩЖqgm|yqfdnАРа╖╩╓╪╓╠╡ЪПИБvqjkquГЙОШо┬╚┬йН}ss|АГДОЩо┬╧═╝зФМЗДГББДЖИЛФЬ▒╞╓▐т▐═║еФНИЖГБЕЦ╛┘с▀╫╔╡аТНИЖЖДИМФж┐╨╘╩╡ЯУНКНФе╛═╠┐дФНЙЖЕГБГИТж└═╩║зЦНЙЕЖСа╜╓┌╩нФОФи╩уььъцшьЄєЇЄя°                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ¤ИЕБ}~ИОДvzЙТЛrln}ИГ~~КФЫТБ~ДНСФЫЬЧЕvcZdyИХм╩ряїЎЇёяэьыъщчхур█╥╞░ЭТППОБmZTZkzВЕНУУСЛАuh^pЕШааЭУИГЙМСУОИДЖЕzovАВААЕЖИКЛЖ~}|xklwВААБАБВВААВИПЦЦМИЕГЖЗЙДБАЛЩн┐╜╡жШРЛЖzrij}Хл╟█хъч╫╡ОБГИЖЗД}s`ZbkwИи╞╒╒╩╢ЧДphsАВwpeitГРЪ░─╙╪╫╧║ЯТЗtqlqwzБГЙЛЦд╢─┴лРА{{АВГЕНШи╛══└оШОЙДГААВВДЗРЩм┐╨▌с▀╙┴оЩПЙЖБАДР╡╙▀▐┘═╖бХПЛИЗИЙКРЫ╕╠╥╩┤ЭУНКЛТЬ╡╔╠┴лУЛКЙЕБААДКЧи╝┴┤ЭТЛЕББКУм╔╘╚оСЙМЬ└▀юяьцхщЁєЇєЁэ                                                                                                                                                                                                                                                                                                                                                                                                                                                                     єЗЕБ|}ЕЙБuАКРЖoluЕИ}ДНШЩК}}ЙФЧЬЯЫС~uc[j}НЪ║╘чЁїєєЄяыщцффутс▌┌╘╩┐│йжгШИs`V^nzАБЕНФХРЖzi\oЖФЬЯЬЦКГЕКНРУТЙГГГugqБЗА}ГЕЖИКЙГ}{tihuЕЙВБАВББ}|ВМУХРКЖДЖЙИГ}~ДУи╣╜╢жЦСЙДvnel~Те╛╘счц┌╣РЖЖЙИЕБyo_X`hsЖд┬╤╓╠┤ЦВomyВ}skbfyДНФз╜╬╫╫╤╜жФИ}tpnv}АГЕЗРЪл╝╛нЪНГАГГДЕЛТЯ╖╔╬┬▒ЫПЙГДАБГДЖИНЦг╖╦█ус╫╚╡ЭТЛЗВБВОз╦▌р┌═╣аУНКЗДЕИКОЦп╞╧╔╖ЯТНЛЛРШл╞╧┼пШНИЖД}АЕОЬм░йЪПЗВАБКЦ╣╦├пПАЖХ╖┘ыяьшуцюЄєєєы                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ▌ДВА~~ВД|r|МПВnp{ЕxxЖСЧХДxГСЬвздЫЛ|v`\mБРд─▄ыёЇЇЇЁыф▀┌╪╒╒╒╒╙╧╦─┴┐╝║╢иТ}jaftz}АВЗСХУЙАh]nЕРЧЭЫФНИЙКНПРПЙЖГАqcnБЙГБГЕИЙКЙЗАyrfguБГББАВББА|yy~ИСФРЛЖДЕЗЖАzt~Пг╢╝╖жШТЛВrlfmВСЫ┤╠▄фц▄┐ФМЛКЙЕВwm`[agoЕб┐╧╒╧╡ХАqt~Б}nfem|ГКОЪ▓╚╒╫╥┐зУЕ~wrv|АБВГДГЙСЯ│╜▓ЪПЗГГГГГЛСЫ│├═┼│ЭРИВГБГЛУЬ▒╞╫ст┌╠║вФЛЖБА~ЗЭ┬╪с▄╧╗аФНКЗЕЗИЛПХз├╨╠╗дХНЙНРЧж└═╔╖ЭНЗДГ~{{}~ВОакбЦОГА|{}ГМд┐┬░ПАР▒╘чяющфхьёЄєєэ∙                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ─ЕВАББАБzwАЙИ~osВЙ}vКХЩС}xЗЧж░▒дФЗy_]rЕХо╠▀ьёєєЄэф╪╦╞┐┐┐└┴┐╝┤пн╖┐├├╢ЬОtjp{~АБДМФХМЕpfrВЛОСФСНККЙЛНРТНЗВ}lcpВИВВГДЖИЛЙБwqigtЕКДВААБАА{upvВОЦФНИЗЖЕДwqxМЭ▒╗│вХПЙqifqБОЧо┬╘▀у▄├вУПЛЙЖqi\[acmЙЯ║╦╥╬╕ФБruААvgfjsГДИУи└╧╓╨┐жУЙБusy~АБВБА{БМЩл╕╡ЮТКДДГЕГЗНЧк╜╦╞╢ЭРЗВВ~~ВВЛТЩк└╒рт▌╨╝дУКЕГБДФ╖╙▌▄╨┐дФОККЖЕИКНТв╝╠═┐иФНЛЛОФг║╩╠┴дОЕВА~{{{||ЕХгвЧМДzxxyДЪл╣│ЦКЕПк╦уэюъххъЄЇЄЄяя                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ЭВААБА~zuГЛЗynzКН}wГОЦХЙ{}Ма▒╝╖вРЗБy]awЙЪ┤═▌шяЄЄЁщ┘┼│звЫвжжидЧМТЭ╡├┼└мЩЛ}|ВВБ}БИПСПЙwuzДЛЛМПРОНККЛНОСРЙВ~kerГМЙВГЖЗКММБzqilwГЗЖБААААА|wno|КУЦСИЗГГГ|pisИЪм╡░аХПИncfsГОХд║═█с▀╠▒ЭФОКЗ~ng^_ccoЙЭ╡╚╤╨╝ЦГvzА{pccn|ВА}ЙЪ╢╠╘╨╛еПГwnr|АААБА}u{ЖУб▒▓бХМЖДГЕДЖМУЭ┤╟╞╢ЫЛГ}yvuwxz}ЖМЦж╝╥▐т▐╘┴лЧНЙЕБ}БРо╦▌▄╘┴йФПЛЙЗЖИЙМПЬ╢╚═╞пХЛКМНУа│╚╧╚пТГААА|z|zwПЮвЫСЗАzuux~Рж║║жУМОв└▄ыЁьххъяєЄЇЁщ                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ЙБ~{xzЗКБvwБЛК}|ЗСФРrzРз╡╜╕ЮЛДАvZg{НЪ░┼╘сшюЁЁх╧│ЩТСОРССУОДsxИЭ╕─└╡дУЛИЙИГЖААГЛССМ~БЕЗДДЛППМЛКМОПСРМВ~nkuДЛКЖ}ГЕЙММВ{tnqxЗЙИВБВА|zqmozЗФЩТИЗЗЕГznemЕЦе▒мЬУНЕzmcfxЕМУЮ│╟╪ст╘┐кЪТЛЖzmb[]^crКЫ▒┬╧╨╛ШГ|Аyj`dr|~}ywАТм╞╤╠║ЭЙymoz}А~|wqvАНЩк░жШПИДЕЕВЕИПЧй└╞╕ШЖ|utqqtwxzАЙФа╕╨▌тр╓┼пЪОКЖБ}}Кб─┘┌╒╞оЦПЙЗЖЖИЖКПЧ░─╬╩╢ЩЛИЛМТЭп┼╨╠┤ФИААА|{{zwНЭегЦМГztrszЗб╛┬╖гУРЫ╢╘чяьшфщэёёёёъ·                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ■ЕВzw{Аvw{ВГ}xzИНД|БМХШЖvr}Ул╖║оЦЖЖЕrWj~РЬж╡└═▐шююф╞иРЗГГЗЗККБtdgyПй╗╜╢пгЬХРНИЖА~ДПУРЖВГЖКЗДСТПМЙМНРТУПЕpoxЗНМЗВБВЕЙМНДwsu{ЖНЛЕАВВА|xqgfuЖТЫУИЕГГАxiblЕУЭзеЪСМЙyicjzДКОЧй╛╥▌т┘╚╢вФОЕvf_]__dvЛШк┐═╨┴еОГБ}uf`hvБА}uoyЛе┴╬╩│Х}pnvАБББ~xrnr|ЙУбпкЫПЙЖДДБВГЙУЯ╣┴╖ЪЖ{trmprstv}ЕТЮ╡╦█сс┘╔│бСКЖВ}~ЖХ╛╓┌╒╔░ЩТЛЗЕЕКЙММЦй└═╬╜бРИЗКСЩк├╨═║ЪНГ|А}|yОЭлоЭУКАxsqtВЬ╜╔─▓вФШп╩уяэшччьЄЄёЁыя                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ЎД~uux~{tv|ЖБxwАНМА{ВПШФ|pqВЧн╕┤вУКЖАpboГЧЫЩЧа╝╫хээ▐┐вНВАББДЕГ{hZ_jЖЩинп▒▒маЩУНИВ~ГКУЦЙЕВГИЙГyИРРМЙЛЛПСУТИtt~ЗНОЛ~~ВЕЗЙНЗБ{y{}ДКОИАВА{ulfhtЖСЧТЛЖДГ}sgcpДСШЭЬЧПИЖvien}ГИНФб╡╦┘р█╬┐йЦМГtc[[^^g{КЦж║╔╨╚оЦЛГ{qd^ly~zokuИЫ╕╔╚┤Уzmp|АБАzupmkq|ИРЭпмбУМЗГ{|БИШ╡├╣аМАxvrqsstw{ГОЪ▒╟╓рт█╬║иФНЗГ~}ГС│╧╪╒╦╖ЯТЛИЕЕЙКЛЛТв║═╬┴нЦЛДЕНЧе└╨╨┴дСВ|~БББГПЮ░│иЧНВyrnq{Щ╛╬╬└▒бЫй─▀эющшчщяЄёЄэт                                                                                                                                                                                                                                                                                                                                                                                                                                                                  цЖ~qt{wrw~А{y~ЕНК}zИУЫПrkoДЭп▒еХЛИЗАpczПЧУЛНШп┘яєь┘║ЫЛВ}|||s`QXb~ТЩЬбл▓┤пзЪСМДВ}|ЕКСЛЙДДЖЗЖГЖНСПЙЛИЛЛОСОГuzВЙОПОВАГИЙЛКД|z~БЗЛМЗГГБ}|uiaeuИПЧУНЗДБyod`pБНРЦШУМИДqffo}ГЙКСЧй┬╤▄▄╘┬оЫОБpa\\^_j~КУв╢┼╠╔╖ЭОЕzndcp{yuljtЗШ▒╛┴╡ЦАuv~ББА|wsnjnu~ЖНЩп▓еХНИАzusrwГФ░┴╜йУЗ{wwyxvw{ДОШй┐╥▐с▌╥└пЪПИЕБ{~Ми╟╘╫╨╗еХРМЙЕЗККЛТЫ╡═╥╚┤ЭОЖЕМФг║╬╨╞оХЗ}}АБВГБЖОЮ╢╜┤ЯТИysnp{У║╧╥╔╝иад╝┌ыэышфцэяЁЁяф№                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ╠Аxrw}~unyГЕyv~НОЖ|}ЙЧЪДkiqЗапиЦМИЛК~wzЖУХЙДЗСн▌Ї°я╒┤ЪНГ|||В~q^LR`wИПЛНЯп╖╢░дЩРИЕА~АЗМНМЖГДБrewКТМКККМОРТРИz}ДКООЛДБ~АДИЛЛЖА~АБЕКПИДГВ|te_hxЖНФЦПИДГxnegsВИМНООЛДnfisЕЙКРФЯ┤╔╫▄╘╞▒ЪОАo`\\^bqАЙСЬп╛╠═┴йФИvl`du~yqghuЖЦз║┬╣ЭКАБ{xunljoyВИНХй│зХНГyrlkkq}Рл╗╜│ЮТЛДББББ~АВЖНЧб╢╠▄с▌╒╞╢гУЛЖА||ИЭ╝╨╓╤├пгХРЛККЛЛНРЪ▒╚╥═╗жТИДЗПЫ╡╠╨╩│ЫЛ{~ДЖЗЕКТа╣┼╗йШМ~snmrП▓═╓╤┴░гд╡╥чьъцфхщяяяэчЁ                                                                                                                                                                                                                                                                                                                                                                                                                                                                 пДwpvААwr~Г}uzДЛКА}АНЧХ}dfqКЯкЫМИЙКЗВyАПУМВЖСм▌ї·Ё╒╡ЭОД|~~|А}pYLN]vДИБ{Ле┤╣▓жЩРДГ|{y}ИММЙИГtc`mЕУОЗКИКМНТТМ~БДКНПРЗБ}БЗЙКЛИ{АВЕЙЛКЖЖГВ}re_jzЕМРТРКБukafuБЗИЗИЗЖБyibjxВЕЗЙЙНФж╜╤┘╫╟▓ЫЛiZYZ^euБЗОЩй╢╚╬╟│ШЛvkblx~smekxЕРЭ│┴╝гСЗГББ}zuqmkls|ГЖКРз▓дФЗ|smjllq~Рд╗┴║иЩРЙГГГГГДДЖМУЬ▒╞╪с▀╫╠╣жШРЛГ}{ГУ┤═╓╒╚╝│иЬУРММММОХн╞╤╧└нФЙГГМШо╞╨═╗бПГzyАЖЕЖКОа╕┼├│аСВxpntКо╩╫╒╞╡ив▓╔ръъцссцэяюэшр                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ЙВslwБuzВИВyАКУЗ{{ГСШОrbfsКЯаСЕЕККИБГОФПЕ~ВКФо▄Ў√ё╫╗жТМЖДЕДЕ~nWGO_tГАupБЦй▓░иЮХКДАtpzЗООМГp_UiАНОЙЙИКЛМРТНБ~ДЙЛМОЛГ|}ДЗИЗИА}~БЖЙЛКИЗДАzo`_lzЕЛПСРКГ}rfahyДИЖЖДГБ}vedkzБЕЗЗЙИМШ▓╔╫╓╩╡ЬЙ~e\[^`h{ВЗМФЮн┴╬╦╕ЬЙsigqy}xlhdp|ДНЩл╜╛лХМЕГzupninrz~ГЗКНЭкбРГuljilpzВРЭ╢┬┴│ЭФМИЕЕЕГГГГЙПШй┐╘▀▀╪╠╣дЧТНЗА~ДТп╦╓╓╤╔├╣пвХТНЛЛЛУж╝═╧┼▒ЪНЕЗФз╝╔╦└иУЖyz}ВЕЗЛСЭ┤╞┼╣еУГwnipЗе╟┌╪╠╗ндл┴╫шщф▀▐ущьэьшр■                                                                                                                                                                                                                                                                                                                                                                                                                                                                ЕokwВБxБЙЙ~uВНФВx}ЙТФДi\evМШФЖГЗКЛЙМТХОГААДКФ░▄ў√Є▄╞▓ЪТНЛККЙkVHNbv~ymiyПЪжквЫСКЖБ}tlm|ОФТМ{e]hyЙМКЗЗИЙКРПЛГБЗМПРМЗА~ВЖЕЕЕБ~~БЕЗИЛЙЗДБwj`bn}ДИОСТЛВ}ncakzЕИЗЕБАА{rber~ДЖИЗДГЗСи┬╥╓╔╖ЯЙycYY\bpАДИКПЧб╝╦╔╣ЮЛsikvzzrfceuАГКУе║╛▒ЬРИГ~wqnnnry}ВЕИОЩаЫП~qiikqzВЕРЫ▓└┬╖еЦОЙЖЕДВГГГИОЧв║╤▌▀┘╠╡ЭУМКИЖДРн╚╒┌╫╘╥╦┴┤бЦНЛЙЛРа┤╚╧╩╖ЭТЗААНЬ╡╞═├░ЪЛ~xБДЖЙОЪп┴╚┴лЦДvlgsДЪ└╫█╨└▓дж╡╧фшф▌▄▀хэьъчсЄ                                                                                                                                                                                                                                                                                                                                                                                                                                                               ·ДБjlzВ}КОЙ|ЕСУ}yВМСП|f`ezОФЛДДИКОПТУПЙГАБЗНЩ┤▌ї№єт╙─▒еЯЩЧШФЙrYPSfyБyheuЙТЩааЫУОЛЕ~pdfvНХЧФЛn]fvЗОМЗЗКККЛНКДВБЖЙМОПЙ|}БГБДВААВЕЕЖЙМЙЖАwj]bq}ГЖЛРТОДzkbcoЖЗЖВ}}}{p`hvБГЖИЗЕА~ЖЭ╗╧╥╩╖ЭКx^Z]bhuАДИКМТЫ▓╟╚╝ЯЛsoswzypeelxГЗСЫ▓╛╕бУКД~xolmou{}ВВДИТаЯПАrnnu{АБЕПЧм┐┼╗лЩСМЙЗДГЕГЕЖЛЦЮ╢╠┌▀█═┤ЬСМКЙКЖЛШн╚╘┘┘█▄╪╬└мЧМЗЖКПЧн┼╨╦╗еУКГИХк┴╠╟╢вРГzz~БДИОХл┴╩┼░ЩИvjenАЦ╕╙┘╥╞┤жбп╟▌цт▌┘┘сыьышс▌                                                                                                                                                                                                                                                                                                                                                                                                                                                               юДor{А~}ОТК{{КФСzzЕОСЖudcj~ПОДДЙНСУТУЛДВЖКУз└уЇ·Їч▐╫╔┬╝╖▒кЮР~aW]o|xfdwЕНПУЫЮХПНЖoc`qЙЧЬЫШАgesГМОИЖЗЙЙЖЗЙЖВАЖЙММПКА|АВz|АВАВГГЗЛКЗАukafsДЗНРРНЖzkdeqЖЖЖВ}}А|obkzБДЕЗИВ{yТ╢╩╧╔╢ЪЖs^]]alzБДЕИЗЙТй┐─║бКrnw~{wn_es}БГМШй╝║йХКЕ}xomnuАББВВЙНЬаХЕxwzВГЕНЦи╝╞┴░ЮТЛЗЕДГЕДДЕЛФЬ░╟╪▀▌╤╣жТМИКМПЦе╢╞╙╫╫▌тс╘┼пЦПЖБЖНЦв└╨═┐йЧМДАГПв║╚╔╝зУИ~y{|БЖНХе┐╧╟╡ЫКwhanСо╠╪╘╩║жбз╝╪ут▄╪╒▌чщччу╫                                                                                                                                                                                                                                                                                                                                                                                                                                                               ╓А~hr~В~АППЕ~АЛСМ{~ИСН~rffrБЙЕАДКНРУШЬНВАВЖЙНЧ┤═чї·Їэщу▄╪╙╬╦├╖ЫЙqckwБГyhjzЖЙЛОУЬЪЦСОДtebqИШЯЮЬЗvnsАМОКИЗИЙДГВАВЗКНПКВ}||xsxАВБВГГЕИМЙЗАuh_gtАДКОРНИxf`fuАДДГБ|~ГВtgn{ДДЖИИВyv{Он┬╬╟╣ЩВo]ZZapАВЕЖЕГГМЮ╖┴║дЛtuyzvrh_iwААЖУг╕╝пЩОГ{tlluz~АББААИКЪбЬПИГАГДГЕЛУв╣┼┬╡дФОКИЖДЖГДГЙРЩо┬╫рр╒┐лЧПЛОУЩз╖╚╠╨╤╙▄хр╙┬зУОЖААИРЪ║╠╧┬пШОЗ}АЛЪ╢╚╩╛мЧКВwvyАДЛТЫ╕╦╔╢ЪКvhafuЙв┬╘╘╠╗кЮд│╨▀р▌╪╥╓фъчцс┌ї                                                                                                                                                                                                                                                                                                                                                                                                                                                              ┬В}qw|БГККВ{АПУИtБОФОwpih|ЛМ}}ЗМОРЧЫЦ~ГЗЛМУг├╫щЇЎїЁяьшфр▌╪╥┼░ШЗ{zБЖЖ}qo~ЙИИНРЩЬЮЧСЛ{ngtЖХЮЯЬН~wvИПЙЖДДДА{y~АБВЕЙНСОДБ}~qluБ~БГЕЖИЛЙЗБxlekw|ДЙЛОМИufchuАГЕЖВАГЗЙwmv~ДЕЖИЖvpvЛе╜╩╔╕ШГn`\\btБЕЕЕВ}wАХм╛╜зКxx|~vmfaly||yxОЬ▓╗▒ЭПЖ|wootАААА~{zАИЩждЩПЛДГЕЕДЕЛСЬ┤┬┼╣жУНКЗЖГДДВГИОШи╛╙▀▀╫┬пШСМОХи╬щ▌╙╩╟╚╘тц═иУОМЗБ~БЙХ┤╬╧┼│ЯПКАВЙЧо─╩┴▒ЫОГxxyДКНЧ┤╔╩╗ЮЗrd_bqДЩ║╨╫╧╛йЬЮл─┘р▌╫╨╙▐чцфт▌т                                                                                                                                                                                                                                                                                                                                                                                                                                                              Ыykv}АГЖЕВ}{ДОНЕ{ЖСХЗqrnsЕРИt|ИНСУФУЛ~ЕЙМОЩп╚▐эї°ЎЄЄЁэшур┌╫╧┬нгЪУРПОВu}ГЙИЗКНШЬбЯЩСБvpwЗТШЬЪУЗyv}БПНИГВВ}w{АВБВДИЛММЙБywmhq}ДБ~ВДЖЗЙЙИГykclzБДЙМНЛИuecjwАГЕЕГВДТЧБu}ГЕДЖЖГ}sosЙЯ╡├┼╕ШВl_[[exГЖЕГxryМв╢║мР}~yrja`r{}xut{ЙЦл╕┤ЯРЖ}vnpy||ywКЦй░дЦСИЖДГГГЙПЩн┐╟┐мШОКЗЕГДДБВЖОЦб╖╧▐р┘╟░ЪТППШ╣эЎя╨║▓▓╜┘┼дТИАИКГАБИУн╚╬╚╣вУМВГЙУз└╚┬┤ЮСИ~xwВЗКНХл╚╦╝вИqe^aoВФп═╓╧╛наЬж║╙▀▌╓╬╬█фхтс▌╤                                                                                                                                                                                                                                                                                                                                                                                                                                                              И~yqw{|ВЕГА{|ЕОЙ~}ЛУФВqvrxИСВuГМРТЦЦС}vАЗКНФа╗╤фяЇЎїєЄЁъу▌┌╒╧╟╛╖пп░ниЫРИЙЙЛККМЛЦЬЯЯЫХЙ|qzЖРФЧЩРК~vz~ЙЛЛДААzsixДДБВЙНРПКВ{vihqzББВГДДЖЙММИ}plqzВГЗЙЛНМujhoxАВЕЕДДКЧвРБДИЙЕЕЕБxmjqЕЪл┐┴╡ШАnd^^i}ЕЕДБ{shoЗЩп║оФЕГ~xpgbeu}zvpmsАПг┤▓аРЗ~wux||}{xrq|ИЩн╕░вФМКЖЕДЕЙОЦж╗┼└пЩПИЕГВГВААДКУЮ│╩┌р┘╦│ЪПМРЩ░▐ўх║ЦУРУРОИzsvГИГБГЖНй─╬╔╣жХПЖДЗСб╣╟┴╖гФЙАyw~ГККТз┴╔┴еЗpgcfsБТз╚╘╧┴░гЩЯо╩▄▌╒╬╠╙рус▐█╙∙                                                                                                                                                                                                                                                                                                                                                                                                                                                             А{rjsxy{{x{ЗМГw}КТПrttАЛМ}xЗОТЧЩФБqrБЙМПХд╛╪чЁЇїїЇЁъс╫╦─┴╝┤лик│╝┐╜┤бФТСПККЛНУШбвЭХЙ~vАЗОСФФОМВ{{~ЕЛОИГБyofrАДБ}ИКНОМЖzvhhq|ЗДЗЖЖЕЖЙЛНЙГwnt{АААДИМОПzkhpzАВГДДЙПЮйШПЛЛКЗДДАvjgpЕЦз╕└│Ч}j_]^nЕДГБyqgnДХй╕┤ЫОИБxmfakx{ypmilyКЪп▓бТЙ{ttx}Б}|zvsnpyЙЧо║╣кЩОЙДГГЕИМУЯ╖┼┴▓ЫСЙЕДДДББАВЗПЩл┼╓█┘═│ЧРПОПУж│зТЙЕАГ|umhhqЖЛЕГДКНа╜╦╔╜лЧОЗЕЕОЩп├─╢дЦМГywzАЕЛРЯ╗┼╛иЗogcixГРЯ┐╨╧─┤жЫЫз├╪▄╒═╦╨▄тур▌╪щ                                                                                                                                                                                                                                                                                                                                                                                                                                                            ∙Аyrrvuruy|xv{ЗЙБyВПТК|x{~ЕЖВ|АМРФЩЦЖtlpБКНПФж┬╓цюєїЇЄьт╤╛одЬШХТСЩл╗╞╩╞╝пжЪЦПММНПСЫаЮФЙБzАИМОРХРОЖБ~|ДНСЕ~}vg_pВИВ~ДЙНПРК}ujjqЗЖЗЗЖГЖКНОКК}tz|БВГИНРУ~sns}ГГВДЕНФанвШТОКЕДВrgjtЕУЭо╖пШzjecesБЕДБ}wlakВУв▒┤еХМВwjdcp{{umgaivГЦдмаУГuqvzАА}zwqpmozИЧи╣╝▓ЭПИЕДДЕЗКСЩп──▓ЪРЗГББББББЕОЩз┐╥┌█╨╖ЫЧФИvnzЖКИБ}reb_\`mЗЙЗГАЕКЩ░┴╚└нЪПКЕИНЦз╛┬╣жФНЕ{uxЕКПЩ░┴└кИmbfnzЕПЪ╣╨╨╚╢иЫЧЬ╗╙┌╓╬╩╦╪▀▀▄▌█╨                                                                                                                                                                                                                                                                                                                                                                                                                                                            эxljpnlpxzuv|ЙЖzxЕТСЖvv}БЛИА~ЗРФШШРzkfqБЙКПФж┐╥▀щюёєяч╒╛еХРОНДyuАФ│─╠═╚┴╢кЫФПМЛНПФЩЬЧМЖВЙКЕБЙНМИДА|ВЙОЙ|therДКВzАИНООКxnmqИИЖЖИЖЖЙННЛЙz|АААБВЖМСУДvryАГГВГЕМХЯмиаФПЛЗГВ~rfgwЖРЪднкХ|jcafxВГВБ|qifpБНЪм│лЪОБrhgks}{rgbdlvВПЮивН{vwzААzwrnnkp}ЙХж╗┐╡вУЛЕВБВБЕЛФз╛├│ЬНЕАААААБГЛФб╖╦╫┌╤╜дЩК|gakqtЕБs_WURUYfАЖДААБЙУй┐╞└▒ЭТКЖЗКСЮ╖┴╕жЦНИАyv{ГКЛУе╣╜иЗnjiqzЕНЧ░╦╨╔║йЫЧЪ│═╫╓╬╔╞╤▌▀▄█┌╨■                                                                                                                                                                                                                                                                                                                                                                                                                                                           █АuotuliqywsxГ}z}ИОМБ{АДКОД}ГОЦЩЬЩЙl`eqАКНРЦв╡┼╥▌чяяы▌╟нФЗГГ~vldkГЭ╕╞╠╬╚─╣йЩТОНМКРФЧЦРЙБЕИЛЖВКОМЙАyЖЛКВ|uh`tЕКД{~ЕМРСНД|sqvАЙИЖДЖГДИМНЛЙДБААБВВЕЛППК|w{АББГЕЛФЮ▒│зЪТНИДБ{ofkyДНФЪбдЧ}lgdm{ВДБ~wnfarГМХд┤▒ЯП~pggpw{yncabls|КЩииПА}|ВАxsnjjmvБКТг╕─╣дХМЕБ~ААГЗПЮ╣┴│ЪК~zvy|~~БДЛСЪп─╒┘╘┐ЭН|l][chhkljb_ZVUUV_mxz~АБЗНа║╞├╢жЦМЗЕЙНШп╛╕йЪПКБ|vu~ЗЙОЫп╢бЕsoouЗЛСк╞╨╩┐мЬЦЧм┼╙╒╨╟┼╦┌▀▐▄┌╙Ё                                                                                                                                                                                                                                                                                                                                                                                                                                                           └|unonihu~vnvГИ{uОРЗ|{ДККДББИФЫЭЬУh[dtДМОФЪбел╡╦▌цъц╓╜аНГБylbZ_wРй╜─╦═╔┬│гШУСРНРСХЧХЛВЕИИГАГКЛКАz}ВМНЗwnhwЗЛЕ}~ГЙМПОЗuuzГИКИЗИЗЖИЛЛЙКЗГ{ВВДКПФОВ|}~ББГГЙТЭо╢нЭУНЗЖБykcjzЙЛРУШЧЧ~khhqВДВsifdxАЗОЭп┤вП}kdkvyzwi`bitt{ЖХдзЩМДБАА}{upljmr{ГМФа╖└╗жЦНВwtqu|ЛЩ▓╝▓ЭМБ{x|{}}~~ЖПЦж╗╨╫╙╛ЩБg`cjmlha_^gifd_XSZhnu|БГЕЛЩ╡╞╞╗мЦОЙЕИЙТе╕╕лЫТЛЕБzwzБЗЛФднвЗurrxБЗКТЯ║╦╠┴░ЯЧХе╝═╒╨╞└╔╒▌█┌█╒┌                                                                                                                                                                                                                                                                                                                                                                                                                                                           Я{pnsnikz}rr~ДВwwВНОД|}ИПТИВПШезЬН{e\fzЖОУЩЭЩФЧд╛фёьт╥▓ЧЙБ~~vgXOTlЗЦи╡┴╟╚─╗лЮЦУПММЛТШШНЕЕЖККАzЕННИВ}}АИМЙАyngyЖМЙБ}ВЙЛОНЛБvzЕЛЛКЖЖЗЗЖЙМЛМИЖВАВВА~ВЗНТТЛВ~БББВДДИОЪз╢▓вУОЗЕБwfalАЗИМПТЦТ|khkxБГЕВzofdg{~ВЛЩл░бМzlgmz~yqe`fnspxВТбндЩРИВ~{zqnlnqyАГЙПЫ│└╝зХМБypllpwДЧм╕│дСЖ|}|}{}ВЗЙОУЯ╡╚╓╘└ЩВmiosusickyБКАvkbYXens{АГИЙФ▓╞╩└░ЭСЛЗЗЗПб┤╣░аФЛЗБzuxЕЖПЫжбМ{vu}ГИИПЪ▒┼╠┴▓бЧХЭ▒╔╓╨╞└├╧┌█┌╫╫═                                                                                                                                                                                                                                                                                                                                                                                                                                                           Жyrnojhmw|tzЕОЖsvЕОЙА}ГЛТТБzЖУЭнмЬИte]k{ЙСЦЫЪОЛПЧ┼Ї°ют╠оЧКБ~vbUKQj~ЛФд│║┴┬╛╢лЫЦСПОМНУЪТКЖЕЖИАmpДЛКГБ~}ГИЛГ{vp{ЖЛЙЕ~}ЖЛМПОВz|АИКЛЛИЗЖЕЖЕЙКЛИЗВАВВ~~ГЗОТФСЗАБАВАВВДИТд╢│гХПЙЖАreaqАЖЗЙКМПП~kjowАДДАwjbbl~|ЗХд░вИwgft{yuob^fuwryГРв│▒ЭТКГ~{smklqv{ВЖЛСЩп┐╜зФЗzoagelsГФз╗║мЪОЖБА~ЖИЛЦЦЧк├╙╘╞дЙ}vyБ}xop|ИПевНxj^[airzБДЕИСм┼╠┼╢вТЛЙЗЗОЭм╖│жЧОИДxu{ГЕКЧждСГ||ГИИЙМТз╜┼└│жЪХШк┬╙╙╚└┐╟╓▌┌┌┘╥ў                                                                                                                                                                                                                                                                                                                                                                                                                                                          vpqujdkwyr~МСВowЗСИ{}ЖСТМГАЙХЯниХВvgemАОУШЧУЕЗОЫ╬ў√яс╠пШЙБ}r`OFPiyДОЦво╖╛╛╜│жЫХРЛЙЛПХФПИДВ~xkm}КНЖГ}БЖИД~uu|ГЛНИГБДИМПОГz}БЖИКЙЗЖЕДГДЕЗККЗГБВААГЙНЦЪХКДАААББААВОб╡╡еШСКЖ}nabsВДДЖЖЖЙЛВjgryВЕД~uhbfoyz{ВПЯйаЖulnwzyqmdclvuqvБРв│╢йШОЕvqhimt{}БГИПЧй╝╜зТГunhkoqxГТа╕╝╡жЦМЕБДВАБВДМФЪЪг╜╧╘╟░ФИВБАА{qtИЦл┤гЙub]`ks|АГЕЗМе╜╟╟╕гУНМЙКОЩк╕╕кЪСКЕБ{xw~ЕИТЯеЩОИЗИИЙЙЛОЫ│┬└╡иЪХФв╝╧╤╦┬└┼╤┘╪╪┌╘ч                                                                                                                                                                                                                                                                                                                                                                                                                                                         √sstticmw{{ЗПОБnxЛТБyБКЦХЙ}ГНЦайЯН|ve^pЕТЩШПЗБИПб╙√№яс╬▒ЫНГВ~o]MFMiwЗОФЯй╡╜└╣▒иЩШСНПРЧЧУКГ~xn[`xЙКЖДА~}БЙЗАyyАГИОРВ}ВЕЛМЛВ}|БЖЙННИЖДГВВГГИИЗВБВАВЖМУЫЩПЗВАБББ|{ЖЪп▒иЫТМЕzlcevДДГВВВДЖ}lms|БДГ}pc_gu{tv{ЛЪзЯЖukqxytngchsyxnt~ОЯ╢╣▒аРЕ~tmcjs|АБДЕЙНХж╕╛иУАtplovx{ЕТа╢╛╝оЭУЙИГ}xtnnАТЦФЬ╡╔╥╠╖ЮФКЕГАvryДТ╖┴╖Шf``lu{ВДЕЗКЭ╣╞╟╖вФМЙЗЗМФж╣║мЫУЛЖБ}xw}ВЖНЩаЭЧМКЛМЙЙКНЦл╗└╣лЫФУЬ╡╩╤╔└╝┐═┘╪╒┘╓╙                                                                                                                                                                                                                                                                                                                                                                                                                                                         Ёqnusecoy{|ЖСО~oyНО{xГРЦОБ}ЕРШЯЯФДypabwМЩЭУДБГНТе╒√№яу═╡ЮОИДАlXLFPjvДМСЩвн╖╛╛╕▒аЦРМНМХЧХЛЕБuf[_tЖМЗГА|}БЗКД||АДИЛСД}}ГКЛМДАВЖЖЙМКЙДГБА}ВЕЙЙЗГВБААВИСЩШТНВБГБ{wuБФй│оЯУМГvjahyГДГВБААzooxАДДБ|ma_jvuqpsДХаЮЙuou|yrhbalxyuos|ЛЩ│└╕жФИАvqgmv|~БГГЖЛТЯп╖░ЧИ}vv}ДНЦЯ┤┬┐┤аРД{tmfc_^hБКРЧн├╤╧╝дЧРКЕГxtvБС┤─┬иКndcnw}ГДЖЗМЩ┤┼╞╢аУОЛИИЛСв▓╕оЪТКЖГБxv|АГИЧдвЩСТТРНИЖИРв╢╝╕нЮФТЧм┬╬╩┴║║╞╓╪╪┘╪╘■                                                                                                                                                                                                                                                                                                                                                                                                                                                        █zqsxrffq}БДЗЛЖyq}НК{|ИУТИВ~ЗТХЪЦЙВ~v_eАТЧФМВЗЙОУз┘·№Ёу╨╗иХРКnZPMXmw|БИКСХвн╖┐┐╕иЬЦТПМСХЦОИВrcV^pГМКЖА}}БЖИЗ}БДИЛНЕА}~ЕЙЙДАБДИИКМКЙЖДБ}vxАЗЗЗДВББ}~~ЖПШЬЦОЕГГА|ztoxПв╢│ЯХНГuhdk{ГДГГА|z|zvx|ВЕДАxk_alxsjjn~ПЫЪН{ry{wogbgpyzwss|ЙЧо┐╝лХИ|tkjsz~АБГДЗЙПЩм╕╖гСДА}БВЕЛТШЯп╛┐▓ЫКxld_[[^altГЙУд║╬╤┴лЫФМЗЕАzstУ│┴╟╕Фxoir}ДДЖИЗИТм┴─│ЮУОИЖЖЙМЫо╡мЩТЛИДА{uv|БЖУаеШККММКИЖКРЬ▒╛╣▒вХСХв║╞╚┬╖╢┴╤╫╒╪┌╒Є                                                                                                                                                                                                                                                                                                                                                                                                                                                        ┬xnpuqhhtАДЙОМГsmВРЖx|МЧХА{БКТЧШМВ}|q`kЗТФПЖГЙЙОУм█·№Ёх╘─┤дЦРИp^TP]p{БЕЛЛРТЪз░╗┴╛░гЦТОКНОТСМЗydZ`mИЙИБ}}ДЙЕ~~БДИЙСЙГ~АГГААВАВЖЙЛНМЗЕГxuxЖЙЗДВББ}{y~ЛХЭЪТЕГВ|wqnuНао│еХЛГre`l~ГГВБ||zАБ~|~ВДГ}vh_dpuneek}ОЭбТВ|~{ukdcmwzzwspwДТй╝╜оЧК~rlqyБААВВВГМЦй╝╝пЭФКДВЗНПФШЮн╝╗лФ{ga[\_adjos|ДПЪ┤╩╨╟░ЫЦОКЕА}ur|Сп╟╬─дИ}z~ЕЖЖГЕГЗНв╝─▓ЫУОЙИЗКНЦй▓нЭУМЙЕБzvy|АМЫЮХКВЖЛМЛКИПШи╕╜│дШТУЫп├╟└╖╡╝╠╓╙╓┘┘▐                                                                                                                                                                                                                                                                                                                                                                                                                                                        ЬvouypfjvАКРПЙss~ИБx~ПШПz~ЖОХШТГ}obqРЦПДБВЗКПФо█ўўЁч█╤╚╝огФ|g]WbtЕЙЛЛМОФЫм╣┐┬╡кЬШФНММРТРЛВo[cm{ЗКЗББ~}АЕЛ}БДЗЗЙЛЕ|{Б||~БВЕЖКМЛИЗД|tek|ЕИИЕВВВyvzДСЪЬХИЕГ}ztmfqКЬо┤зХОoecoАЕДВ}yyy~ИЙБАГДБzqd`guxm`ak}МШЯЩЛБ}zseagp{}}wppuБОб║└░ШК}ssw}ВБВБББДКЦи╝┴╣йЫУЛЙИЕГКСШг▒╡дОykfhjnpqoorxБМХм╞╧╚╡ЯЧСМЙДБwszОй╟╥╦┤ФИБГИЗЗЖИЗКНЫ╕┴┤ШРНЙИЖЗЙУвнмЯХПЛЖДА}{zzzЕШаЧz|ГЙННЛЛМФе╣╜╕иЫФФШг╜┼└╖▓╣╚╓╒╒╓╓╤                                                                                                                                                                                                                                                                                                                                                                                                                                                        Зslrtojnw{ЕРМЕ{ruЕЙ}xГСШЙszЖТЧЦК{~ВrmВФПГ~БЗМПУЪ░┌ў·Єыф▐┌╤╚╗иИqeeq}ЕМОППППХШд┤╝┴╗▓ЯЩУОЛКТТСОКВfgp{ДККВВ{z{}ГВА~БЕИЗЛЖ|~}wz~БВГДЙЛКЖЕЖqei{ЗИКИГВБ~wqvАОЬЯЩЛЕБ}xqkfoКШо╡кЦНykbdsГДГВ|wtw}ИКИДДДГwn`]ixvibeqВМХЯЬТЙАwofbktyzyojmq}ЛЭ╖┐╡ЮОАvx|БДЗВГГГАГМЩк╜┼╛▓гЦКЖ}wst~МШгкаТАvvxwxyxtpszЛФд┬╨╦╣гФММЙЗГzsyЙж╞╘╤└бПГГЗЙИЖЕЕЕКЧ┤└│ЫРМЙЗЕЖКПбоодЦРЛЗЕГБ}zxwАПЭЧБyАОУПМЛНСа╡╝║оЯЦУФЬ╖┴└╢▒╡┴╨╫╙╪┘╒·                                                                                                                                                                                                                                                                                                                                                                                                                                                       pnutlgowz|ВЗБztИГ|zЕТЦr|ИФЧФБw~ГВБГЙОКДВИНПТХЮ┤▄ў·Їюьъчу▄╙├иНБ~ЖНТЦФСПСПФХЫл╢╜╜╕лЮШПЛКНТТТНЗpsw}ВИМИГ}{zyБАВЖКМЙ}z{xoqyБВГЖКЛМИГВp_g{ИМНКГГБ|xnkyМЩаЫМИБ}vohaqЛШл╖лЦМyjbhwГЕГАzrpp{ЛПИГДВvkbbmtqfbguБМХвдЩОГumcdow~ztifhq{КЪ╡┐╖гР}{}ВЗКЛИИИЗКТЪан║┼┬│ЬП|lda`eoБОЯкдШОДАА~{{yvrqwЗОЬ┐╧═└кЦРКЖЕГtvЖв├╓╓╞пХЙДВЗИЗЗИЙКХ░┐╕аУМЙЖИЖИСЫо┤йЧСЛЙИЕВxsqzМЫШЙВДПЧХПКМСЭ│┐╝┤йЫФУЪ▓┬┴╢▒▓║╧╫╘╒╪╫ы                                                                                                                                                                                                                                                                                                                                                                                                                                                      №~olrqljpwtxА}xvВЙБ|АКУУzqАМФЦН||ДЙЕЖСМДВИОСФЪан└▀ї°ЇёЁЁЁыч▀╘─│идбвзждЫЧЧФХФЩд░╖╗╕нЯЧРНКЛПФХТКyw|БЕИКИГ|xus|А}~АДИЛЙБxwtjkxАВВВЗЗЗЕГВp]e}ЙООМЕВБ|tjktИШЫШОКВ|vpgeqЙЧи╢нЧМxjgmyВДВ|unkozКСМЕЕВ}qi_cpwna`lwАЙТажЭСГsidfrzyuqebhoyЙШ▓╛║йУЗЕЗКОООООНСЦЬбкм╡┴└▓ШГle]Z_fpБКЩжиЬРИЖГБА}xrqwАЖОЧ╖╠╬─▒ЪПЙДЕДxyДЪ└╘╫╠║бПИВГЕЗЗЖДЕТм╜╗зТКЖЖДДЙРЩн╕мШРЛИЕГАypmuЕЩЭОЖЕМЦШТЛКНЪ░┐└║пЮЧУЩл╛└║▓н│╩╒╓╓╓╪╫                                                                                                                                                                                                                                                                                                                                                                                                                                                      я|opwsjjruqrzzwzИЖ|{БОФМusГНУТЖ{АЗЙЙОХНБ}ЖПУШвк│╜╨сюєЄєЄєЄэът╓╩┬╜└┴┴└╗╡лаЫЦУТХЭзп╖╕▓зЫУПМООСУТЛГ~}АЖНМИ{uqwАГ}~БЕЙИБ|wphgvВЖЕЕИЙМЙЗЖo]k}ЙНОЛЕВА}tgenДХЭЫПЙГ}wldasЙХгомЮЛuigo|ГДВzphfl~ЛПМЗЕБ~lfcisulabnyАЖПЮжаТВqickuzztlcafmwЗЦм╣║пШНОМРУЦЩЭЫЮаЯббагм╗╝нФzoidfkrzБИХбжЯФНИДБ~}xsqy}ДОШ░╔╧╟╢вТЙЖЗЖБxxВХ║╨╓╥├иУЙВБАВЕЗИЗРе╣╝пШЙГЖЖДИКЦй╣пЩОКИЕГА}xnhqБЦаЪРИМФЧТНЛОЧк╛─┴╕зЩХФд╖╛╣▓ко─╥╙╓╪┘╒                                                                                                                                                                                                                                                                                                                                                                                                                                                      ▌{qstpnpwunqzzwy}Г~{}ЗСТЕuyЖТЦНyГКМНСХГ}ВЛУЩж│└╔╥█щяєЇєєЄяых▌╨╞┴┴╚╧╨╤╬╟╛┤нвЩФФШЯжм▒пвШСННОПРРРКИЗЖЗЕЗЛРЙ}yrqxА~~{}ВЗКЕ}vogiwДЗГВЖЙКЙИИГscmБМСТРЗДАypbblГТЪЪФИА|sgaeuЗФЭмлЯЙtkhqВВ~zoffn}ЙФТКЕБ{hb`jusi^cr{НЩжвУ~okgpz|wrk`cjqyЕХй╝╛╣мбЫШЭлолежвШПЗЖЗУЬ┤╗мТДwsvuw}~ВДПаиаТКЕВА~~{xrszДМХй├╬╠╜зФЙГЕДyw~Р▒╦╫╒╚▒ЪНЕ|БДЗЕЙРЮ╕┬╢ЫЛГВДЖИКСб╢░ЦКИИЕБАzsjenБЦвбШНКТЧУОЛМФе╝┼╞╝нвЩЦЭ░╜╜╡мн╜╧╙╤╒┌╪ї                                                                                                                                                                                                                                                                                                                                                                                                                                                     ┴xlqtpkmtspwБ|АЕЛ{{АЛУПitЖРОД~ЗМРУХФАЗСЩд╡├╧╫▐хыюЁєєёюыф▄╥┐░м╡├╧╫┘╫╘╩┬╖наЧХЧЫЮекйбЪУОННЛНОМЗЕИЙКМКНРЛАztpuГБ|{{БДИЗvphh{ЗЙЖГЗЙКККИЗwhsГЛМОПМЖАxma`mГУЪЭЦМБxpe^`uГРЩдлвИqijwАГГ|ujedmxДТФНЕБxebbmtpg_gt|{|КЦежШВokks{zvnhflrv}ИЦл╝──┴╣╝├┴┬┐▓ЭЭО~tpowЗФл╡нЩИБ|{z{}~~БЛЩгаПИВГ~zxqtxДКУа╛══┴кЩНЖДДВzx|Ли╟╫╪═╢аТЙ~~ГЕЖЗОЧ│┴╣аОДАБЕИИОЪ░мЦКЕЖДБ}yofajАХиовФНМТЦТОНУв║╞╔├╖иЩЦЪй╝╛╖нм╕╦╥╙╙╪╪ф                                                                                                                                                                                                                                                                                                                                                                                                                                                     Ьwournlotqs}~z|ЗПМxzГМПЙwltИЦС~yДМРФШЦК|ДНХво┴╬╪▌уцъьяЁЁэч▀╒╦╝ЯОПЧ│╟╒┌▌▄╓═─║маЪЩШЧЩЬЮЫХТПМЛЛЙЙЛЙЗЖГААДЙНИАzsrr}ЖД~||АГЗИГzuml}ИИДГЖЙЛМЛЗК{qyДМОСРМЗАxjaalВОЩаЪПВxmb^dtГМХЮебЛrknwАББ{rg`bisАПТНЖАsc`enpm`ZjvxvxЗФеиЫГokry{ytkiglv}БКЦо┬╚╩╠╧╫╒╤┬лЦЗxlgbdjqПд▒пЭНИ~|{|}{|ДТаЫКГ{{||~|xrrxЗЛТЫ╖╩╬─оЪОЙДГВz{Зб┴╓█╨╝жХКБ}|ГЖЖИЛФо╜╕зТД|~ГИЙКУжкХЙЖДГА|xmcbkВЦп╖▒бУННУФОНСЬ╕╠╨╦└▓ЯЧЧи╝└╣по│─╧╙╙┘┌╘                                                                                                                                                                                                                                                                                                                                                                                                                                                     ИsltsnknqprВБВЛСМuzГНМАreuНХМwyИРФЦЧОВЕЛФЭл║╔╙┌▄▐ррчьюыц█╧┴┤ЬЖwvБЧ║╠╫▄▌┌╒╦┬╡иаШШЦХЦЫЫШФОНЛЙЗАВИЙДБyosxАДВ|z{zАЕДАz{|АДИЖ|vosАЙКЖЖЖИКННКМ~w}ГКМПУСЗАwg`akНЧЭЭРВxlaZfvВЙРЪвбМslpzАВА{rd^_cn|НЦТЗ|nbahtrh`_musnsВТглаЗsrw}|{urq|ДКОТЫз┤┼╩╧╥╓╤╦║ЯЖtgaedejq|ЕОЯ▓▓аСКБ{vssstvАНЩЩИ~uwwz|{wpszАЗЛСЩ┤╟╧╞│аФНЖДАyxДЩ╝╘▌╘┐мЪНЕ}y{АЖЙКСв║╣йТГuzДЖЖЙРЯиЬМВББА|tkaaqДЦ▒╜╢йЧНМУХСНРЫ╣╠╙╤╟╣зЧЦг╣├╜╢░о┐╬╥╤╓▄╪¤                                                                                                                                                                                                                                                                                                                                                                                                                                                    }urypklqqlrВБ}ГСЦЖs{ЙСНynkyНФДu}ЛТХХРЖДЖСЪй╡└═╙╘╙╥╥╙▄цэш▐╧┐пЭЛscdoКк┐═╓▄┘┘╙╩╛▒йЪШУФУХЧЧФККЙЙИБ~ЗЗВyhbgp}Гz{}ЕЖАz{{|БЖЙ}zswВЛМДЖЕЖИККЙКГ}АЕКНОТТКveabpНЦЭЯТГxi_^iyБЖНХЭЯЛupt{ВБyn`\]^lyЗХЦК|laglqpg\bqtrkn~СакаМvx|~}}y|ЖЛТЪк╝╚╤╬╔╠╨╨╤╟оС}ld^deilsyБЖМЫо▓бРК|snjjimnzЖПСЖ{ssuy|{{xxzАЗМРХн─╧╟╢еУОИЕА}zyБФ╖╤▌╫╟│ЭОЖА{w|ГЕЙМШ▒│зТДzyАДЕИПЬжбТЖАВБ{sh^evЕУм╛╜░ЩНКХШУОТЪ╕╧╒╒═┐лЭЩа╖├├╕▓н║╩╙╘╓┘┌Є                                                                                                                                                                                                                                                                                                                                                                                                                                                   №|snsnnnqniuГЕДЙООДx|КСЖrig{ОО}tГОФШЧМ}АЛЧж│┐╚╧╧╟╜╜┴╦цїяф╪╞▒ЭУАfWYeГЪ▒├╬╘╫╪╫╬─╣пвЬХФУФХХХЙЖЖЗЖА{zАВГzjcajyДД~~|zЕВzwxz|АБ|{x{ДЛМЗЗЗЙККЛЗЗЖДГЖКМРФУЛАtc_erАНУЫбСГvh`_mzАДКРХЭЛwpv}ВГxi^Z^]jxЖФЧК|j_grvmc]ftunfh}ПаожО}~АВВДЙЩж╜┌ьЎЎщ▄╥═╨╠╣ЭЛ}phdiotxxzАГЕЙЦжмаОАsmgfgkmqwВСФИ{srty|z|}|zБЗЛОУе┐═╔╣иЧПИЖГ{wu~П░═▄┘╩╣гРЗБ|{zБЕЙСенеРДyz}АБИОЪонЦЙАypg]d{ЕТз╕╝┤ЯОКФШЦРТЮ╡╬╓╪╙├▒гШа╖┼┼╜┤н╖╟╨╤╘▄▄у                                                                                                                                                                                                                                                                                                                                                                                                                                                   Ё{svwkkpupmyБВДКПМuВНРБogjАЛИ{ИПФШУГyДСЪл║─╩╔└▓вЭо╤яўЄф╙┐йШМv]TXdБУж╖┼╠╥╓╫╘╦┬╖йЭФТППФХУКЖГДЖ~tyВЕЖВxsmt}ВА{{nqv{~{wyz{Г~{{ДЙЗГЖЕЗЙКЛКЙИЗЗЙМНСФХОБp`_gtАИТЦЫПГtfabpxВЗМРЫМ}yy~ББ}vh]ZZZhxЕУЩМ|h_hrug_`juslcg|ПЭмкХЗЕЗКЙЛУи┴▐Ї■■■№ъ╓╦╠╠╚зНВumhjpuyzz|АБВДПЬеЮЙxqlihjostyЛУН~wuuz{zzАДБГИКМТб╣╚╚╛нЩСЛИД|yx~Ли╔┘╪╬╝жУКГ|zwzАЖНЫжЯТГyvzАБЖНШо┤аНБ{ulb[f{ДРа╣╛╡аПКСЦЦФТЪ┤╠╓┌╫╔╢зЬа▓┬╚┐╖н┤╟╨╥╨┌▐╫                                                                                                                                                                                                                                                                                                                                                                                                                                                   ▀zppolnrrkn}ВГИЛМИzДОН}jgnДНЖz~ЛПХЦК{wКЦв┤┐╚╚┬░ЫОПг╤є№Їф╤╜дХИoXQXiБПЪк╢└╚╤╒╥╧╔╜пзЪЦХУХШЩМЖВВВxjexИКД~~}~ВЗЗ}ylfmw~|zwvuxА{z~БЕЙЕЖЗИКЛМКИККИИККРТТНБm^^it~ЖРФЬСДsecdtz}БДИМХОy{ВГГ{tg^ZZYhyВНТЛ}g_irse[amtqg`i~ОЫннЫУПРУЧз┬┌ё¤ ■■√ы╫╞└└─├зЙ{rnkqw{АА|АЙУЬЪКvnnmpuxy|{АЕОРЗА{{{z|}}~БКНЛПЪ│╚═┬░ЬТМЗДА}y{Йг┬╓┘╤└йЧМИВАzy~ВКФЯЮСВ{uu|ГЗОШн│гСВ{wri]Xd{ГКШ▒┐╢аОЙЛЩЫЧХЫ▒╔╘█┘╬║мЯап╛┼├╖о▓┴═╥╥╓█╪√                                                                                                                                                                                                                                                                                                                                                                                                                                                  ╚yrxtjnsskpГЕКНИВvwИСМvgftЖЗ~yГОТЧУГuwЛЩк╣┬╞├│ЪПЕИШ╨Ў■Ўф╙╛дФДoVQ^qГЙФЮй┤╛╟╤╤╧╔┬╖лЯЧУУТУХПИДГ{lcatЗКЖББ~ВГЖЕyojkuБzsqosz~~zz{{АДЕЗИЗЙКЙИКММККНУУФНБm]cnwЕКПЪХЖqa`gwzАБЕИКНРГ{|АББ{qe\ZY[n{ВМЦП}d_kspa`djpoe_mОЩм▓иЬЪЩи╟цЇ√  ■¤ўф╠┤н░╗┬┴еЛ}vppv|БА~~~y{ВНЫЫЙ|vuuy{|}||ДТХКГА}}}zwtuy}ЕЛМОЧо─╦┼▓ЭТНИДВy{ЖЩ╝╨╫╙┼пЧНИГА~yz|ББЛЯаФЕ{yuw{ЕМЦз┤зТВyqnf]VaqyВТй╖▒ЬОЛИУЫЭЪЮо┬╙┘╪╨┐пвал╝╚├╖мп╜╚╬╤╓▌█я                                                                                                                                                                                                                                                                                                                                                                                                                                                  кxppnkswsku}}{БИЖ|ryЗОЙqejxЕБ}~ЙСФФМ{pwМв▒╜─└╡ЮСИ~ВФ╩° Ўф╙╛жЧИoWTdyЗКСЦЬж▒╝╞╦═╠╟╛┤зЭЧХФУФСНЖВue]\pГКЖВВАВВГЖА{vwv|ДД~pjcfs{|zwvyzЕЗКЙЙИЗЙЙЙКИЙКРТУТЕo]coyАГЙОЦХЙqbbiwy{АБЕИНРЖАБАzpe\ZY^t|БЙФТ}dbntl^ZgpqmfbpБОЩл╖╡╡о┼рЄ№■■■■·э█пУПФдп╗╛йН~tqty}АББА}|yutzДУЪОБ{{{АБААА}ГПЧМЖВ~{}{ohknw}ГИНФж┴═╟╢бФОИДВ|{ВТ│═╫╘╚▒ЫПКЖГyzx{ЕШЮХИБzuwyАЙСЭоеУГxrlf]U\hr{ИЮ▒лШОЛИСЬааем╝╧╫╓╨─┤дЭг╢╞┼╡кл╖╚╤╧╤▄▄▐                                                                                                                                                                                                                                                                                                                                                                                                                                                  Мvr{okquunw}{z|АА{u|ЙНГlcmД~|ДОХЩСДtivСж╡╛╛│аФПДx{С╟· Ўч╓└йШИp\_oБИКОТЦЫе▒╗├╚╚╔├╕кЯШУСПРПОМЗzi\]kВПКВВБА}БГ}uxy~ВЗВrnhcl|{yxuw{ВЖЗЖГБАДЕКЛКИЛРРСРЖp]dry{ВЗНХЧИrffmxy{~ВДЕЛСЛВ~А~~uma[[X`wВЗОРБgjrri^blpnihfuЖТЭн╗╝├╙ъ√■¤¤Ўэу╔жРАБЙСЬи╡╣кСАvtz{}АА~zvqjouВНЧУКДАААВДБА~ГНТЛЕГА~|zmhis}АЕЗОУа║╠╔║жХОЙГВА|y~Нк─╘╘╦╖бРКЗДБАyutuАТЩЦКГvux}ДЛЪжгФЕzrkdZWYbipАХееШНКЗТазйло╣═╘╘╨╞╖иЭЮо╛┴╢лм▓┴╧╤╤╪┌╫                                                                                                                                                                                                                                                                                                                                                                                                                                                  {uprklvxsmz{vsyАxuИИ~hds~|zАЙТЪЮР{nkzСг┤╗╕бТНКtyР┼√■Ўш┘╞┤гЛxjoЛММОРТУЪгп╡┐╞╚─╜▒жЫЦУТСТТРНБn[Xk}ИКЖВА~{wyБВzyy|БИБuqkjnt{yyustyАЗЙЕ}|АЕЗИЗИМРССИtbetz~БЖЛСХЛrgjpwxz|АВЕКСПЗВББsi_[XWcyАЕОХЗkosod[_pvnffj}КХЯ░╛┼╠ъў·√Є▀╬║ЩИyrpzБПЦг░╖йТГz{}БА~yojfkv~МЪЩНИДГДГДВГА|ЙХНЖГА{{ljou}АЕИНСЬ┤╩╠╜йЫСЛЕВ}xyЗЯ╜╙╓═╛лХНЙИЕБ}xss~СЭЩКДyusxВИСЮбЦИyri_XV]djqzМЭбЦОККРЮн▓▓░╖╔╥╙╤╩╜нЭЩж╣╛╢нин╗╦╧╨╫┌┌·                                                                                                                                                                                                                                                                                                                                                                                                                                                ■{trvoptvqo}|vrx||ytБКЕwfezИБ{ГОФЫЬИsiezСап▓жСККМБrvП─√■їщ▐╧┴▒ХАxБПХУРСПТУХЪен┤╛┼╚└╡кЬХСРНПТУТКwdbn~ИКЙДВxsrvzyxy{БЕГ{vrsqvyyysnko}ДЖД}uv~ВДЗЖЖИЛОРТНxhouzАВЗПУМwhks|yz}ААДКТСЕАzpf[ZYZfzАДОШМqtunaXcrrkhmvЖСЭй┤╜╞╥сыч▌║ХЛБ}vqknv~СЩЫз░йРВ}|А|~А}xrggbkv}ЛЪЭТМЗЕЕДВБВА~ВЖПНИГБА|znnoxАДЖЛОЧ▓╔╠└пЮСЙДВАzzДХ╢╤╓╥─▓ЪРЙЗДБ{vt{ПЮЬОЙГ}xsw~ДМХЬШЙzqe\W[bjqsvЕЦЭЦНКНТЭо╗║п┤╞╤╙╤═┴▓гЪЮ▓╝╢пкк╣╩╥╨╥┌┌ю                                                                                                                                                                                                                                                                                                                                                                                                                                                ўzuqqinuwpoxwqs{Бzy|ЗИБuhlВЖ}yДРЩЮЩБldd{ТЯвЯШМЛМЛ{mxР╞№■Ўыу╫╨─мЯЧЫжзаЩЦФФСУХШбй┤┐┼┬║░еЪУСОПТУУРЗkdp|ЗННЕБtpov{xxy|АГГ~vrpmpy|{woin{ДЗВ{tu}АВЖЖЕЖЙМОРО}prx|АБГЗПФР{pmsyyy{|АЗОРЗА~}wmaZXYZk{АГНЩР{yumd^ittqrvБРЮйм┤║├╔┐╗гКА}x{xnhhlpzОХШЮжеНД~А|А}wolgghpyАМЪЬЦСКЖЖДГВВБ~АГРОЙГББ{jnpw}БЕИКМЦм┼╦┴│вФЛГДБАwvБСо╧╓╙╩╢аФЛЗЕГБ~zx|ПЯаТЛЖБxutvДТЭЩКzpbZZ[eqsoq~НЦУПЛМПЫо╣╣┤┤┴╬╥╥╧╟╖жЩЫл╡╢▓мк╡╞╧╤╘╪┌▌                                                                                                                                                                                                                                                                                                                                                                                                                                                ыwsvvmouuop{rpty{y~ГЗД{qktЕГ}ЗТЫЭТzjedХЫЦУОИППЙ|q|Ц╦√¤їюъу▌╘╦╜╡╝┴╛╖нзЮЫЦХЦШЫво╕╛┐╜│жЪТСООСФХРТxmq{ВЛРЖ}yqjap~ww{}ГЕАytrlhqvzzvlo~ВЖЖsu{~ВЗЙЕЕЙМРСРВvvz|АБГЗМРН}rqx{{{{{z{ВЛНИД~{si_XXX_n{}ВМЧФВ{ula^nvxw{ВМЪо╢│░│╗╗ЮИ{tsuvrnfcbfmrЕЛПУЯгПЗВ|}~zunjiglqx~ВМЪдЪЦПЙЖДДВБА}АПТМЕВБА|lkow}БЖЙКЛУи╛╟┴┤дЦМЕЕВyv}Об╔╓╒═║вУЛЖДГГА|y|ЛЬвХМЖД}xutx|ЛЫЬЛxo`ZY_gt~yv|КХФПККНЩо└┐╡│╛╔╧╨╤╠┐лЬЧв╡║╡нйп┬╦╦╬╒┌┘                                                                                                                                                                                                                                                                                                                                                                                                                                                ╒utrohrwuqrxoot~~{~МРГxqnzЗБw}ЛУЩШЙulhfБЧЫРЕЕЗНМЛ{sГз╤∙∙ЄЁяьщхр▌┘╪╒╙╦┬╣пжЭЩЦЦХЪжп╕╝╜╕нЮЧФРСТФФПОА|{}ГЖЛЖБyoe^pА|y{{БЖДzrnhiov{}~{z~ГЖЕrowГЗЖБДКОПОЕzw{~БГВЖКМЙВyvy{{|{yuxЙТНЕБvf\XZYaqz|ВЙУХКunffq|ДКЧжмйлнмойХВxvv|zslb_cgkpyДЙОХЫУКГВ|}~xqmihlqw|АЕЛЧбаЩРКЖДЕБВАААКХСЖБАxkknu}ВЕЗИКРб╗╚├╖еШОЕЖГАzx|Йб─╘╓═╝гУНКЖДГВА{{ЕХЬЧНЕГА{vrtzЗХЧКxl]X]dlwzyz{ГФШОМКНЦз╗┐╢┤╣─═╧╨╧├▒бЩЮ▒║┤лжл╕╔╬╬╘┌█·                                                                                                                                                                                                                                                                                                                                                                                                                                               ╗wtutpwwqmswlow|yxЗХУВutuАД~|ДОЦЩО~slfkКЩУДАЗНПОЛ{К▓╫ЇЎєёЄяюьъшчцфт┌╘╠┬╣░еЫШЦЧЮж░╖║╡нЯХТПРТУФРЛБ}ВЕЗМЗВyng]sАБ}yy{АДД|sng]kxБАГЖИЖЗqpt|ВЖЗ|~ЗМОНИЕА|АВВВГЖЛОИ}z||yzzvqt{ДПСЛВ}re^Z[\et|АВЗРУОВumgkyВДЗЛУЩЬШХУУЩжеСАvw{zupg_ahljnyГДУЭФНЖГ|wnkggjnv{АБГЙШжгЫУМЖВВББ{|ИХТЗВА}xlinw~ГЕЗИИПЫ│╞┼╕еЦПКЙГА|xzИЪ╜╨╓╬║дЦМЙЗДДГВ}|ГФбЬПЙЕБwrswГЦЫОuiZX`iq{}|{{ВПЦСМЛМТа╡╛╕╢╖┴╦╧╙╨╚╢еШЪм╣╡йджп─═╠╥╪┌ь                                                                                                                                                                                                                                                                                                                                                                                                                                               ЫuuvoirvtpwwkmyГБЙХР~uuxЖЕ~{ЕРХЦЕ{snjsМРКВГЛСУСНВЗЦ╛▌ъэяЁЄёяэьыъщщшфр█╤╩╜▒еЪЧЦЫбйо╖╖пвЧЦРРСРППМГВБВГККЖypmryГЖwwzГГ|tndbjyБВВВЕИЛЙЗАqjpzБЖД}zwАЙНОМЖААГГВГДИНМЕ{{|{zyunquМСНВzpb[XZXgv{||БДНШТЕwruwБИЙЛПОГ{uptБПЩЯР}uy|{ujedhmljoxАГБЛЫЧОЕВ~{skggjnwБВЖЙХгеЪСКЕАБА~~{ЕТТИГА{vmloxАВДЖЗИОШп├╟╗йЦОЛЙДГАzzДХ╢╠╓╬║вФНЛИЖДГБ~|АОЮЯСЖЕГАzvsxВУЫПxk\]fow~|yАПШУММЛРЪм╛╝╖╡╝╞╠╨╤╩║иЩЧз╡▒зЯЯз╛╩╠╨╫┌▌                                                                                                                                                                                                                                                                                                                                                                                                                                               Гsruonsroqxsjq{Бz}МУЛzuwЗБ{ИСЦП{xtpn|ТПДЖПТЦФСКРп╦▀цъьююэычхфхчшшщчф▐╘╦╜░жЫЫЫЭдз▓╡овФТОПОНМЛОЗЗЖДВБЕЛЙ{spo~ГЕА{wyВЗАxpfak{ВДВБЖЙКЗГsin{ГИЙАxuzГЗЛОЙГББВВАВЕИНМЗА|{{{{ulkr}НЧТВ{k_ZXYZjx{||~ВКЦЦЙ~|{БЙЙЗА{pfa`cm{ЖЦЫП~vx{znfcdjmmkoyАГБИУЦПЕ~zunhfhox}~ГГЕЙТЭаЫПЗГА|~}yxВНМЗВА~volmyАГДЖИЙНЦй┴╟╜йХМЛКЙЗАwxБРн╔╘╧╗ЩТНЙЖДДГБ}||ЙЪЬХНЙЕБ{utvБТЩРyi[bltzБАА}АМЪШКИИМФд║╛╣┤╣─═╧╤╠└пЭЧЭппеЭЫа║╦╧╧╘▄▄                                                                                                                                                                                                                                                                                                                                                                                                                                               xrsvjgnqrt}qhsАЖЖЗКМЗ|z{ДДА~ГМУЦЖvvvtxЙТЖАБМФШЪШЧЦж╜╬┌▀шъышфр┘╫╪╪▄тфчшчф▄╥╟╣нвЭЬЭЯбйнмгХСРРПМЙЗКЗИЗЕБ~ВИИ~yxyАЖЙГ}xw}Вysigl{ВДГГЗЙЛКИГyoqАДЖЖБvou}ДЙПМЖДГГГАБДЖМПЙ}}|{{ytghp|НЧЦЖ~g\YYZ\l{~{|{~ИФШПЗЗКОМИ}n`WURYblxБОЪПВzz{wjdbitrkhmzЕД~ГУЩРД|tpljlqv{}|}АБВГЛЩбШНЕА~xwxyzxwАНРИГААvminw~БГДЗКОЦж╝╚┐оШПЙИКДБyw|Нг├╤╨╛ЬПМКИЕЕЖЕБ~|ЖЪгЪОЛИВytvАНШФ|g_gqxАЖДВА|АКХХНКИЛТЬ┤╝║┤╡┴╔╬╤╬┬▓ЮФЪйнзаЫа╡╚╬╥╒┌▄ў                                                                                                                                                                                                                                                                                                                                                                                                                                             №upruonrqquxokwБДЖЙЛКАwzВКЖ{{ЖНТТБuxy{ДМД}ГКТШЯжзил│╝╟╙┌▀ччр╙╩─├├╞╠╥┌▀ухфу▌╘╚╕лвЮЭЪЫбедаЦРНООКЕДЙКЛКИДАБЕЗА{xzВГИИАxu{ДВ}vljmzГГГВГГЖЗИЖБxwВЖЗЗАsnq{ДЛСПДВБАААБЖЛМКБ}{{{xrecn|НФСЗ}d[Z[[^ozА|{z|ИХЬЧТТТЛ~sbWRPOTZbnzАЖТРЖ}{wsfbgmutnikyГЙВВРЩТЕ{qolknuy}~||~ААБЕУЬЦЙВ}upnlmnot}ИОЛГ}vkimv|АВГЕКНТЯ╗╞├▓ЬПЖЕЕЕГ|z|ИЬ╜╨╨└вУМЖЕЕЗИДБАБЖЧеЯФРЛИГ~xu~ЗРУВc^mvyВККЕГА~ЕУЧПМЙКПШ░╝║┤┤└╚╦╧╬╔╣зШЪе░мдЯа│╟╦═╤┌▀ш                                                                                                                                                                                                                                                                                                                                                                                                                                             Їsqtphlpqrvymo{ББЛЛЖ~u{ЖНyАКСУО{syz}ЛЦЕ{ЕПШЯй░││▒░┤║╣╚▌щц┘╔┐плн▓╣┬╦╘█▐сс▀┌╬─╢нгЭЪЩЫЭваЦТМЛЛЙВ}ДМКИЖВА~ВИВ|z~ДДИИВysy}ВАyqnp{ГДДГДЕКЙИЖГА~ЕЗЗЗЕujnvАЙННДБААА|ЕЙКЗВ~|{zwodblМЧЩЛxbYY[[`s}~|z{}КТЪЭЭЧЛАm_TPRTYVXeqw{ГТТКА{uoc_gsxxslkxБВ}ОУПЕyppnory~А}|}{ВОЩСГznkhghkloszЗПМВА~smmnx|АВЕЗИЛТЫ╖┼─╢гСЖГГДГБzzГХ╖═╨├йСИЖЖЗЗВАБААЗЪийаТМКЗБzzЗЦШГigt}ГИЙИГВ~~БПЪУМЙКМФз╣╝┤╡╛╞╦═╧╠└мЭЪд░│мдг░┴╦╠╧╫▐█                                                                                                                                                                                                                                                                                                                                                                                                                                             сqnqnluunnyymp{БА~БЗВys|КУwБМУТЗ|}АВЖФФ|{ИТЫд▒╗╣▒кггЮк╫шьх╥├│жЫЩЫг░╝╟╤┘▌▀р▐╪═┴╡лвЪЩЩЩЫЫЫУЙЙЗЖД{zДЛЙЗГБААВБА||ВВЖКЖzrx{АВВwtt{ВДДДГБЕЙИЗЖБАИЙЗЖЕ|okq{ЕКЛДА}{|{{zАЖККД|||zulacmЛТЦПx^YX\[cu~А~}}ВКРШЪХКkYVQTZ^`YZhty{СЧМАzrm_amxywshmwД~~ИХТЕxnkksy|~~~|}}|{|АЛХРБuledcfilmtwДОПЖААywvvzДДГЕЖЙПШ▒└┬╣зУЙЕВВЕЕxАРп╟═╔▓УЖДЕЖЕДВВАБЗЧлнжШТМЙГ}{~ДТЩКlftВЗЛККЗЕБ}~ОЩФМИЖЙПЮ▓╣╕╖╗╞╦╧╨╧├┤дЪг▓╕│ивм╣┼╦╧╒█┌■                                                                                                                                                                                                                                                                                                                                                                                                                                            ╠qpsohoonszxjp|zzАВ~wuНСywДНСМБ|ДЗИЛНЙАЕОЧам╡╗╗паЩТЧ║уєєц╥┬▒аЧФХЩал╣┬╠╘╫███╘╩╛▒зЯЪЩШЩЪЪФЙЖЕЕА{y|ДИЗГБ~}~АБАВГЖЙЗ{sw|ГВ{vv|ВЕДЖЕВЕЗЗЙКЗДИЙКЙЗАvpnwВЙОЖ~|{{zzwzЗЙЖ}{{zti_eqКФЩУw_WYZ]gy}~~ГЗЙМХЦМzhXUSW]de`Y^ovuw~НТМВyojcgs{~urhmuВ~АДПТЗwmlsy{|А|zyyx|ЖММВvkkijmqtvxzВКОЙА}vxvx|ГБВГДЙОХк┐─╗иЧПЗДАА~z}Лж┬═╩╣ЮЙБАГДДГВААЗТгпкЫТМИДА|~ДПХКpblyАЗЙЙЗИГ|КШЦНЛКИНЩм╣╗║╗─╦╬╥╙╩║йЭе╣╛║неи╖╟╦═╥┘▄Ї                                                                                                                                                                                                                                                                                                                                                                                                                                            йqoqojvqlqyvjs~АvoВБ|tvГОНuzЖСФЗz~ЖЙМСОД~ЙСЩгп╖║╡бСЛРг╛э·Ўш╨─▓аФСССЧЬз╡└╔╨╓╫┘╫╧╟║пеЭХУЦХЧТМИИГxkgwЖКИЕЖz{~}|}АГЖЕwuw}ВЗД|z~ГЖДДВАГЖИЗЙЗЖЙККЙКЗysvЗЛЙБwyzxuqu{ЕКИА|zvrg^grАЙУЬЩ~b\[]_k|БВДДЙННКРСГkZVQW^ekjcZ`nwut{ЙУНВvjg_muyxrngnuЕ}ВПУКylqvz{|~}|{yvtsxВООДxtsquwx{|{|БКРМВ{vzzz~БИГДГДИЛФб║─└кШСЗГА}zysxЗЫ╗╠╦╝дРВ{ДДВВБВДОвмзЩРЙЗДБААБНШУvgdgrИЙЙЗДАЗХЩТЙЙЙНФг╣┐╗╝╞╧╥╥╤╠┐░вд╣├└┤кз▒├╦╬╤╪▌ч                                                                                                                                                                                                                                                                                                                                                                                                                                            Нppsnmqmjqzrkw~|vtЖА|x{ЕНЗuБЛРЛА}ВЛРФХЗ{ГОЦЬз▒╖│дСГЕТй╞Ї¤ўщ╤┼┤дШФФСФФЩж▒╝┼╦╤╘╘╥╦└╖йаЪШЧЦШУПКЗ~od`pВЛМДВyvz~|{АДЖЖ{vuzАГБ||}БЕДЕДВВДИЙКЙЕЗКЙЖЖЖБ|wx}ДНЛД}zzxsnrxГККБ{zvqe_gtАЙТШЪДf^]^cpАВЕЗЛРСКЗОТВj[YWYcknj`YcotpnwДННГsgccry{xqmglq|ВВ~БНЦНzlrz}||}АА|wuqlkxКПКБ{{y{||АА~~КРМВ|qorx|ЗЙЗГДЗЛСЬ╢┬╛нЪТЙД{yusuБУ│╟╬└мХЗ|zВЖГБББГИЫибЦОИЕДГГББЙЦЧ|mfckzЗЛЙИГwБФЩУМЙИКПЭ│╜╝╛─═╙╘╘╧┼╢гй║├┼╣одо╛╚╠╬╒▄█                                                                                                                                                                                                                                                                                                                                                                                                                                            yopqlovmjqyslx{twЗА||БККБ{ЗРЦПzzЗОФШТВКТЦвкнпгХГyВУ▓╔ї■∙ш╥╚╢жЧУТСРОУШгн╖┴╔╬╨╥╬─╣ндЫЧХСФФТКЖ|f^ZkОПДГБ~vsy}|y}ВЖИД~wwz~ВВВ|}АВВГГВББДЖКЙЗЗККИЙИЗqqyВМРДzvvvninuАЙЙВА|wod^hu}ЗРЫЮЗka^aeuВЗЙЛРПКДДКРЖma_]`elni_^fqrpnuБННБodbhvzxtojdjp~ЖДБЛТН|sy}}|||}wslkknt}ЖМЛЗА~{~~|А}|БЗОЛДngglrz}ДЗГВЕЙПЧп┴┐▓ЬТЛЕБ~|xstАПм─╧─▒ЪЗ|}БГГГБББГЦЭЩТЛЙЖЕДБ~}ЗХЪВskhn{МПНКЗАzАТЩФНЙЗКМЩ░╜╜╛┬╠╬╤╥╙╩╜лй╕╞╟╛▒дй╝╔╔╩╥█▄■                                                                                                                                                                                                                                                                                                                                                                                                                                           spprkopjktwon|}yu|ИВЙОК~zИТХЙs}ЙТЧЧМ|ДНХЮеммеФДttДЪ╣╨ў■·ш╓╩╝░дЫШУФМРТЧЮи╡╝╞╦╬╬╩┴┤иЮЩЧУТФХРЙ~e[Ue}МЛДЖБ~vv~В~{}ВДЕЕВvvvz~ГВБ~}БДГЖЖЖГВДДИЗЗИККЕЖИИ}pktАМПЖzvtunilsКОЕ}|wn`]ju{ЕНЩЭИndadn{ЖКММЗ|xw{ЗОКwnf\`hone]^hsqiktАЛНВnbbp||xpjfdhlyИК}ЗТПВ||~~|{{zxqmgehmv{ЖППИБА~ББАА~}}БЖНМЖ}mhfkrwwx}~АДИМЦл╜└▒ЫТЛЖА~{utНз┴═╩╢бНБ}|БГВБА~ОЯЧМЖИЗЖГБГРЫЙypou|ОУНЙЕА{АСЧЦПНМПНФл╜┐╜┴╦═╧╥╙╧┴░н╣├╚├╖кк╕┼╦╩╤┌▐Ў                                                                                                                                                                                                                                                                                                                                                                                                                                          ∙pmomjrvjkrummyzwz}Г~ВМНКЕ||ЛТСВtБНФЦТГ{КУШвкпйЭИyruИж╛╘ў■·ъ╪╤╞║░зЭЦХППСУШЭк│╝├╚╦╦┼╢мбЪЦТТТУПНАl^Zd{НСЗЕББxuЖВx{ГЕЗДzwvv|ВА}|}АВДЗЗА{~ВЖЙЙЙМОЙЖЗЕyljqПТИztprroot~ИОЗА{vk__lu{ГЛФЫЙvnjq{БИКЙГ}rekuЗУРАqe^cknka_bjpmd`m{ЗЛГodluzzwmeaagkxЖМВzДУХЗ}А}|{zxqhheelsv|ВОТЙ~~~~~БДМПИ|mjinuz|vuyГИЙТж╗┴▓ЮУЛИБА}{xt{КЮ┐╨═╝иУД|v|АБГВАЗЬЦКВДДЕВАz{БКХСuvz|НПМЙЖБ{~ПШЩХРНОНТв╖╜┐└╚╦╠╨╘╨┼╡░╢├╩╚╛пк┤┬╟╩╨┌█ъ                                                                                                                                                                                                                                                                                                                                                                                                                                          эqoqposohktumnwxwzВИБГРФЛБ~БОХП{sЖПХХМББМХЯзнлЮР~tnwП▓─█ў ·ь▐╫╤╠─╝│зЮЧФТТХЧЮи░╣└╟╔┼╣░еЬЪУФТФТОЕsi\h~КНЛЕВ}|ВЗД}}АВЕИЗyttty|А}{{~ВВЖЗwzАДЙКЙЙЙИЖЙЖvhhmБЛФМ}tonquuw~ЖЛЕzsh_`ku{ВЙРШЙzswДЛКИ|pe[]dtДПТВtd\bnogb_cnpk`]jyЕЛЕpdmxzzthb^^fiuГИ{wБНТЙГАА{wvslghikrwy{ВЛОЙБ~}|{{}БЗМКznjgmw{{ww|БЗКРЯ╕└╢вФМИВ|yuqxЖЪ╝╠╬─оЦЙБwwАБВВ}|ИЩЧЕ}ВДЕГА}{~ИШХД{z||ЕСПКЕББОЭгЯЩХТПУЮ╡╛└┴─╞╚═╘╘╩╗│┤┬╬═├╡п┤┐╩╠╧╫██                                                                                                                                                                                                                                                                                                                                                                                                                                          ┘qqrmnvtoosrlovuu{ГАИТЧК}}ЕРСЙ~|ЙТЦТЕzВПЧглмгФЗВypyХ╕╩▌ї¤·юхс▀█╒╬├╕пдЭШЧЦХЪбип╕└──╝│зЬЧРТПУУСЙ~rfo~МПЛЗБ~}}ДКИ{{}АГЖЗ|wsstz~ББ|АДЖЖЖ|ux{ГЗЙЙЙИЗДЖГtdclАКПЛБxqqpsuy}ГРКВ{qf^`ox{ЗНМЗ{ИКПЕzl]UU]ftБМНЕub]fnmda`fnoj`_lxДОИqlw|zxqd_`cfjpv|wt}КУМЕБ~}ztqnhgkosv}~~ВЙРЛЖВБ~~|||{|ЖПК|pnkou{АА|{|ГЗЗНЬ┤╝╖жЧОИВБ~wrvГЦ╢╦╧╟┤ЬНВzxzАГВ|ГЦШЙ|~ГДВАzz{ГЦЩК~|}~КРНЗВАДПак░мбЩУУЫ▒└├║╗┴╞═╥╪╨┴╖╡├╬╥╩║┤▓╛╠╬╬╓█▄■                                                                                                                                                                                                                                                                                                                                                                                                                                         ╣pqrnrsmhotqnrvrq|ИИЗЛТТД{~ЙФСЕx~ОФУЛБzДСЩднкЬНЗВyq}Ь┴╨сЇ№∙Ёъщшчф▀╓╠─╗▒йвШФШШбзп╢╛┴╛╡йаЩФЦУЧХУОЗzgpАЛСОИАБАВГКК~z|АВЖЗ~zrqop~АБ~АБЗЖЕ{sryВЗКЗЖЗИЗЖДteckВКСОЖ{upmmqv|ВЙМЕ{qfZaqz|БЕЖЕВВЗМКЖvgYPRVais}ЙТКuebgmkb]ajpnfYbpzБЛЛwuy|yvn_]cjijozznpzЗУРЖА~zvrnnkhlty{|{~БИННИВБААА}}ДРПrkfmv{БААБДЖИМШп╝╕кЧПИДВВxtwАТо╔╤╠╣вТЗ~yx|ВВ||ВРТК}yДВ~zzyПЦОДАБАГЙЛЙГВЕРв╡╝║▒дЪЧЫй║└╣│╕└╔╙┌╒╞╗╖┬╧╙╬┬╢│╗╩╧╬╙┌█°                                                                                                                                                                                                                                                                                                                                                                                                                                         ЪoqrintrnqrppurmqЖИЗКППАxБМТНБyВТШРВz{ЖТЩдлбСЖЖЖypБд╞╘фЄ°ўёяяюэьшт▄╙═╞╜│иЮЪЫЫазп╖╛╛╖йаЦУТСХУУОКБuuГЛРТОААВБДИЗБ}y{БГИВ{tpnp{А~~ГГБ{tptБЖКЙЗЗКЛЙЕsdclГЙНПЙxrkkmszАЗЛЕzpe[cu{{}АБВГКМЙВwcXSTW]jmszГСЛxbbkpk^]fnpkb_fs{ВЙМ~z{ywqh[^jpmknuwsqzЖССИБ|wsnhjhiqy}|~АБЖНПЗА~~}||}~|БМРГuokow{ББАБЕЕЖМХи╣║нЫТЛЗЖГБ|uvАОй┼╤═╜жФИyvyАБА|НЦПАw{ААzutw~ПЪУЖДДБ}ГЙКЗЕИТз╜╞╞╜паЧЧв▒║▓м┤╜╚╥┘╪═┬╝┬╨╪╒╔╜┤╝╔╤╨╤╪█щ                                                                                                                                                                                                                                                                                                                                                                                                                                         АmnqlpumgquqrxrlrВЗЕРУОЙz{ЕНПЗ}yИФЪОymsЖТЪЮЯЩЗДЙЕysДм╦┘цёїїёЁЄєЄяюыцт▄╫╬├╡лгЫЬЬвй│╣╝╕огЩЦУФХУУОЛГz~ГИНОМЕББГИКГ||~АВЗД~sjddvБВА{ДЖЖrns|ВИЗЗЗИИЕЕvhfoДКННЙВ{teejpw}ЙПИymcYgw|{}АГБЗОРЙ~rcUSSU[dilryДООzdfkmf]_inmg_Zkw}БЖЙЖ}|zumd^dorllqxysu{ГНТЛВ{wsnkiirz|}~А~~ГМСИ~~}|||~|z~ЛСДwmhow|ААААГЕЖЗКТе╕╜┤вУКЗЕГБ{vu{Кв┐╥╨┬оШМВztv|Б}}~ИФСБvy}xtopzНЫЧМЕЕБ{zГОМЙЖЗСи┐╠╬╟╣иЫФЩй╡иЭк╖┬═╓╫╘╚└─╨┌┘╥┼╣╛╩╨╧╥┘█┌                                                                                                                                                                                                                                                                                                                                                                                                                                         plnliouqoqqntyrmvГЖЕЙНЛЕvyДПНГ{~МХХЖqmtЙСШЪШОДЕЙДxsК│╬▌чяєёЁёЁёЁюююьъчу█╤├║пзгагжл▓┤▓мгЧТСРСРСПНЕБВЕЛМСПЙЕАБВДЗЕ}z|ДИЗtnifsВДДАzzВГВtilzВЙКЗЗЙЛИДwkhqДКМСМВyqbagowЙОК{kb]kz}}АГЖИПРДwj\UXYXW\fmkmuКРБgjnmdY]kpld^_qyВЕЛКВ{wpib\krsonqxГvvzБИРМБzskkglrz~}~ВА}}БЙОЛВ|{{{{|}|zЙОДznhmw|АВАБГДЕДЙРЮ╢┐╡еХМИДГВ|yv|ЙЬ╝╤╙╟┤аРЗАxrw|АА{ДООГwtz}wqmmvИЦЦРЙДД}ГЛОЙЖЗОд╜╬╤╨┴░ЭФФЬжбЩан║╚╘┌╪═─╞╤┌█╓╚╗╜╟╤╨╤╪██                                                                                                                                                                                                                                                                                                                                                                                                                                        ■smomkpoihppnvyuqwББГИКЙВtuЗНЗАДСЧС}jhuКУЫШОГАИКЕxwО╣╤▐чэюёЁяюьъщщыыыыщф█╤╟╗▒йдббдилпиаЩХСТРОМНПИГГДЙЛПСМЖБВГДИИГ{z}БЖКВumgfuВДДБ}}АВВ~wmlzВЗИЗЖЖИЗВ}sluГЖКОМГyn\^enw~ИРКzpc`q{ВВЕИЛОМ}hXQXZZZ\]cjginzЖОЗmoplcY`omhb`dvz|ДМКВ{umeaaruumkqx}{z{ЗРМ~wrnmntx{}}{~~}|АИРКБ}{{yzz~zЗМГznhnv{ВВВДГЖЗЙПЫ░╜╢жШПЖГГВА{vzЖЦ╢╧╥╦║жФЛБyvszАА{БНРЖytuwuojgsГУЧУМЖВА~ВККИЙКОв║═╙╥╔╣жЦСФЫЪУЫз╡┴╤▌█╘╩╚╨█▀█═└╝┼══╬╓██°                                                                                                                                                                                                                                                                                                                                                                                                                                       їqnojiqokmrokxwqnyВАt~ЖЖ~pwКУЖ|АЙЦЦМsflxКХЩПДВГККГz~С╝╧┘сщэяяэчфр▐▀схщщъшф▌╘╔╛│йдабаЮждЭУСООПМЙЗНЛЗЖЙОМНПОЗ~БГИКЕ}zz~ДЙГyqjjvБЕЗЕ|АГВВzmo{ДИЙЗДЗЙИЖБysxАДЙМЛБxhZ]gow|ЖОЛ~tnkv~АГЕИЙЙКИxeXX_gf]Y^gladjxИТЗsroh^Xcpnf^]iwxz{ИЛГ{rifdiwzuoloxЖ{yzЗТР|upnoowy{}А|~~|}ЕМЙ|{xvttwxxwx{ГПИ{niou|~~~ВГГЕДЗЛЧк╣┤гЧРЙВВДА{vwВУ▒╬╘═╛мЦНЕ}vsw}АБКПЙ{uvrple`lzПЪЧОЗДА}АЖККИЗНЫ╕╦╒╫═┐пШПКСХОТЯп╛╨┌▐╓╨╦╥┘с▀╙─╜└╩═╨╒┌█ь                                                                                                                                                                                                                                                                                                                                                                                                                                       чplmjnuqiinnnyxrrw{uxАВ{s}НРБzГНТФДkajzМЧЦКБВЗММВ}ЕЪ╣╟╬╪▀шээч▐╓╨╧╤╘█сфццхс▌╥╚╗░жЯЮЬЩЫЭЭУПНООЛИГЖЗЗЖЖЙКМПРИААБГЖЙЗ~zzАГЗВ{tnqwАДЖЖ~{~БВГtq}ГЗЛКДДЙЙЗГ{w{ВДИККБvfW\jsz~ЖККВ}wwy~ВЕИККЙЙИyh_ajnh]ZahhbbkxЖОЙzsme\Yenjdacmsuvv{ДЛГxrf^dowztmjmuЖ|{|БЗОНАwonpu{{}~А|~~{y|ЕНЙzupnmmlppruyАИЗ{lhntz~~}БДГЕЕЙНФв╢▓ЮУНКЖГГ~{vxАСн╩╙╨├оЬОЖАwsw|}{~КТМ}wqomic_ixМШЧРЙДВБ~БКПМКМЧ│╔╒╪╥╞│аРЖДИКПЩд╢╩█р▄╘╧╤┌тс╪╩╛╜╟╬╤╘┘█▄                                                                                                                                                                                                                                                                                                                                                                                                                                       ╬llolnrqnoqloxxpoyАwq|ГГzxДПМА|ИРФНye^lТЩУГ~ЙМОПИЙХап╗╜┼╪шыщ▌═├╗╖║└╠╘█▐руус▌╨─╖нвЮШЧЧЦШХПЗКЛЙЕБДИИИКККМРСИВБГЗЗГ{x~ГЙЗ{vvzВЖЕД}{}АВ}tv}ГЖКЛЗЖЗЗЕЕБ}АЕЗЗЗЖАvdT]my}ВЖМОЖ~{АГЕЖИИЗДДГ}rknpoi\[dmi]anzДКИАvlcZZhnib_eswtst|ЖОДvl`bjrwyskhlvВ}yz}ЖНОГwnpu{}|}~АБ}||x{ДНМzoecgejkllpw~КК~plpu||~|АВВДЕЗЗРЭооЭСЛКЙЗДБ|xv~Мз┼╨╧╞░ЫПИВ{trw{{|ЖТРВzqnlg]XfwЙЧШУМЗГДААЗРСММФл╟╙╓╘╩╝еТЖВЖВИХб░┬╫рр┘╤╧┘фф▄╨┴╣╔╥╙╒╪▄█                                                                                                                                                                                                                                                                                                                                                                                                                                       ╢olmjptohjmkn{vqqwyutАЕВ{}ЙРК}}КТСГra`mДЧЦЛГЖПСУФУУХЭвкм╛рьъц╙┐┤кеип╝╞═╙┌▐сс▀╫╦╛│еЯШЦХЩЩХСЛЙККИ|}ЖИЖЕЖЗЛННИГА}БГЖЗДy}ГЖЕБ|wy{БЗЗЖВ|~ВЕЖГzy~ДЗИИДДЗИЖЖЕБДЕЖИИЗАt_TaqzГЖКЛИВ}ГЖЕЙИИБz{АГБ|urtqg\[fpgZ`ozАЛНГwj_Z]joh`blrrpopzЕОЖujccmwyxphfjvБА{z}БЙРЕxsvz}БА}|}zyvtyБЙИ{niikkmlnopu{ЕЛВuqquz||}БВГДЕИЗОЩймЬФНЗЙЙЕА|yv|Йа└╨╤╞┤ЯРКЕ}xsou{ЕЛНЕ{rplbZZfvЖХЫЦНИГВ~ЗУФНМТи─╨╪╓╬┬оЦИДДГЖОЩй╜╙▐с▄╒╨┘хцс╒╔╛╟╤╒╫╪▌▌·                                                                                                                                                                                                                                                                                                                                                                                                                                      ХnmmimpnmqpkqytmowvruГДВВИККДБМЦТ|l`aqИЦПДАИТХЩЩЫЫЫЪЧЫм─ьїят╧кгЩЧЧЭк▓┐╟═╓█▐▀▄╤─╣меШЦФУЧШФИИЗЗЕxt|ИКЗЖЗМЛМИДБ}~ЕИИxДИЕБ||}ВЗЖДГ~}АГГВ|}ГЖИЗДГГЗЗЖЖГГДЖЖЖДs_Xdt|АВЖКЛЙВБЗЙЙД{pqu|ГЗГzywqfZ]inaW`nw|ЖЛДwi_Y`kmi^_lvrkgjwБНГtibgrxyungfiwАА}}}~ЕНИ{ux||}}А}{zxsppt}ЗИ~umnnmqqqpsw|ГИИВzvy~}}}~БГЕЖНЦвиЯХЛЖЖИЗБ}zz{ЗЩ╣╠╨╔╕ЯТКЕБzunpwzВМРИ}sogaWTfvГФЪЧОКЕДВБЕРФООТв┐╨╓╪╥╟╡ЬПЖААВНЪг╡═▀т▀╪╥█фцт█╬└╚╥╒╒╪█▄я                                                                                                                                                                                                                                                                                                                                                                                                                                      АnnkhnrnkmkjsxrnruqnzЕГБИТТЛВzВРЦНuj_bvЛУЖДОЧЫЮваЮЦРСЮ▒╬Ў№ўт╚еЫЦУТХЫвн╕┬╩╨╪█┘╘╦┴▒кЮЩХХЧШЦЛЙЗВ{qrtАЕЕДДККММЖГБАЕЙИБu{БДДГА{||ВЗЗЖД}БВГГБ}~ВДЕЕГВВДДДЖГГГДЖЗЕАw`Zfw|АВДЗКЛБ{ГЙЛДxod\lzВИЗ{wtrdX^om]W`nw{ЗКГtf]Yelkd^bormgcgq}ЗВujfktyxqjddisДАzz{ДСЛ~{}|~|{|}|yuokhgqzЗНЖ|yxwvwxyvwzzГЙИГ~vwАААВЕЕЗМТбмбЦНЖДГДБА{yxГФ░╚╧╔╢гТКЖБ|tnqwz~КТМАunf_WXesАСЪЧСЛВВВАГЛТТПТЯ║╧╒┘╓═╜жТИЖЦб▒╟█тр┘╘┌фчц▐╤╞╟╥╓╓╫█▌▐                                                                                                                                                                                                                                                                                                                                                                                                                                      smomhoonoqnjsxqkpvuu|ААБНЩЦЗ~ЖПФЗundg{НИ~ВЙСЩвйлдЧОРЧб▓╥°¤Ўф┼аЧТРРТХЧвм╢╛╞╤╓╪╓╤╟╗оЯЩХЦФЦХРЛИАta^mБЙИЖЕЛКМЛЗБ||}ДИИАxy}ГЕЖДАВ}АДЗИЗВz}БВГД}БЕИЙЖВБДДЗЖГВВДЖДГБx`]kxАВГЖИЗЕАГЙЙ{l^R[ixБЗЕ~xvqcXaomZXcouyБЛЗte`\imhb_esrkfcgsztgenwyvof^aio}ЖГ|zyГООД||}~zz{zytolljjqyГЛЛБ|{zz{{{z{}|БИЗГАБЕЕГА~АБГЖКРбоиЪРЙДГЕДВ~zvПз└╬╟╖вТЙЖГ|yqkrx~ЗПЛБund\VXeo}НЧШУМЗЖГВБЗТТОПЩ┤╩╒┌█╙─пЦЙБ|ДСЭн┴╓сс┌╘┘тшшу╒╩╚╤╒╓╪▄▌┌                                                                                                                                                                                                                                                                                                                                                                                                                                     ¤pmoigprnlmijuwolosnsАЖДЗСЪСВ{~КУТБslgnВФЙ|АНХЮиплЮОЙРШЬ░╘ў№Ўц╞зЭЧУТУХФЧак░╝─╠╙╓╥╠┴│еаЪШЦЧЧТРКБnZ\f{ЛЛГВКЛЛКИГ~|~ВЖЙДz{|АБА|}|ДЖЙИД~БЕГ}ДЖЙКГ~АГДЖГББДЕВБАwccq{АВГДИЙЖЕЗМВn]VXclwАЕГzvn^YammVZhqux}ЕДtd_apnha`huqhccjv|Вsjmtxwqi_Z_hn~Д~yyyКОЗАА{yxurjiiijlqyБЛКЖ~}А}~|{{{}АДВ{rkt~ДЙИЕАВДЗИПЮнмЭТЙГАГДГАzv~НЮ║╔┼│аУЙЕГБzunntzГОНБslbWU[ep{КЦШФОЕЗГВ}АСЦПНХп┼╨╪▄╪╦╢ЬНАzxАПЭй╜╒тт▄╫╪▀чщф╪╩╚╬╒╒╓┌▌┌·                                                                                                                                                                                                                                                                                                                                                                                                                                    ЇmmqkjonmqtkktumiorrxАГЕЙРЧО~{ГНУП}sokuКФАzЕРЩвкмгФГЕПЩЪн╤°¤∙щ╚оеЩХТСССФЩЯи│╛┼═╤╙╧╚╕збШЧФТХУСОДo[[eyЛПЖ~ДЙЛКЙГ~{zБЖИЕ~z{}}~||{АДЖИЙЖ}~ГДВ}АЕЗЙИГАААБВГБАГВВБА|iht|ААВВГЕКЙЗЛЖu_UX[dnu}АГ~ytk`]ckj[]jqrt}ЗЖufacolf_dlsof]amx|Аwnouwtne]]ahnxЗАwxwzКСИ~}}|{wsokfgijmrw{ЙНЗВА}|}}}|{|}ГЕ|slnwzГВ~АГЖЗМЫкнбФЗВ|~ГГБ{uwДУ░─└нЩСЙДГВ~wsqrwАОТГrhbZX]fq{ЙЧЬЩТМЙЗГ~}ЛЦСМРз╛╬╫▄█╥┐зСЕ|wАМЭз╗╥сх▀╪╫▐чъч▄╧╚╦╥╓╓┘█┌я                                                                                                                                                                                                                                                                                                                                                                                                                                    фomnilqpnnnhnurmnqonxЖЛОУФУД|~ЖРФЙusqq{МОВГМФЯйнеЧЕyАПЦЦк╨ў■√э╧║░бЪЧХУТХЧЪЮи▓╝┼╔═╨╦┐пдЮЪЧХЦЦФТЙta]ezЛРЖВЖЙКЛЙВzz}ДЙЗАzvxvx|{{~БГЖЙЙАyyГИЕ}ВЖИЛКД|~ВДДББВДГББ~nnw~АББАВВДКЙ}kbWUZ`fpuzАА|wrj\\hneX]kqqr{ДИwdagoie^dprmcadny|ББzuwwwrid^]ekpuyxrppvИОЙВ~||xupkhehinsvz|~ЖЛИГБ~|}А~|{{|{АБ}vstvwvvz|~БДЗИНЧипбУКГАz|ДДttОд╕╣жУЛИЕДГ~zuqos~ЛТГsg^X\ajt|ЗУЬЪХНКЖВ|{ЙЦХНПЮ╢╔╒▌▄╓┼оХЕ|yКЧб╢╨рхф▄╪▄цъщр╥╚╔╤╓╓╓┘▄▌                                                                                                                                                                                                                                                                                                                                                                                                                                    ═ommhnokmqqlpvpmnpnr|ЕКПФФУx}ЗСТВyywyВМЗ|ВОШбййЪЙxr}МФФй╨Ї■№ю╙├╕мгЩЩФЦЦХЩЪем╡║┴╔╦╬─╡йЭШФФСУХФМ~l^f{ЛРИАВЖИЗЙКЕzw|ВЗЗГ{yytrv|}АБВДЕЕАzuzАДДААДИЙЙД{{|ГЖГ}БВВ||zsuz~АББГДДГГ{gXRS]gmmpty}|wpf_cij_Y`knmozАЕwifjoieahrqlcbiqy{БДБ{wxtoc``dhlqr}xkekxЖКЖВ~|xspkihikryy{{|ЖЛЗД}||}}}|{{{АГ~ttxzzwssvyz}БЖЗКУгмаУЛДА}y|АsqzЗЧйкЯРЙЖЗЗДАzvsqs}ЛСГre][`epy{ГРЩЬШТНКДАzДФХРСЩм┴╙▄▀┌╦╖аНБ{}ЗЩб▓╩▐цц▐╪█цъъу╓╟├╤╫╒╒┘▄╪                                                                                                                                                                                                                                                                                                                                                                                                                                    ╡olkfloooplgpspmprpnЖЛСУРПyxЗОЛ}z|}АЙЗАБЙФЬвебН|mi|ЛТТй═Ї¤№ю╫═╞╜┤йдаЮЭЩЦХЩаип╖└╞╚╞╝паЪШЧХХЧХРЕyik{КНЙД~ВЖЗЙЙЗz~БЕЗЗwspqsx{}~АВЖЖЕАzv{АЕД~ВЗИЗВzxy{БЖДАБББ}{xy|~~АБВА}yl[RR[gpx}qqx~{unbZ^lj\Wbnpjku~Гyjgnoebbiqph[bmsw{БВ~yvqj__bgjjnrvsjdjxБЛЛГ|zwqnjhjksxy{{||ЕЛКГ~~А}}|{{{yx|ЕДyty|{}zvuxw{~ЕЖЗМЯжЮСКДБ}|yy|wpuБПЭеЬЙВГЕЕДА~xuoqzИРВqc][biuАГНЩЫЭЩРЙЕБ}БНЦУТХж╜╠┘▀▌╥┐жРВz{ГУЭ▓╟┘цчс┌▄фыьх┘╚─╬╒╒╘╓▄┘√                                                                                                                                                                                                                                                                                                                                                                                                                                   ПkllhnmjlnolsrnlnpnpДЗББЙМКsv~ЛТДx|БАЕНЖ~ДОЦЬвбШВujk~ПХЩ▓═Є¤№Ё▌╪╘╠─║╡млзбЭШЫЬди░╖╜┼─┐▓аЪЦХТФЦФПИ~wwАЛПНИВВДЖККЙ{xz|ВИЖА{tkinx~}}~ВЕЗЗДyrt|ВДБ~БЖЗКЗztt{БДВ~АГА}|}||}АБ~АГДА|sdURXalrzwssxzzxslb]`gh]Yeplbbqy}{uqplb_dounf^antvy|АБ|xtne^ahmnmorwtlkny}ЖЙЕ|upjhilntyz||{{}ВВЙКЖВ||z{||||wx{БВАz}|~~~|vxtz{АВГЗШЯЧНЕГБ~{wwurt|ЕЦбЬИ|}ДЕГАА|yssyЕПГqdZ`ptzААБЛЧЧЧЦТЛЕВ~}ИУХССЯ╕╔╫▐▐╓╟▒ХЖ}|БТЬн└╓хщф▄█тщъч▄╩┬╚╤╥╧╓█┘Є                                                                                                                                                                                                                                                                                                                                                                                                                                   sklkfnpnpqkhqpmloqnsДДytИЖnvГКЙА}АЖЖИЙ~}ИТЩбвЧЙ{qikАСЦЫ╕╘Є№√Ёху▀┌╒╨╔┴╝┤кдЪЩШЫЮео╕┐┬╜┤зЬЧЧФЧФФТЛДuxВКООЛВВДЗЛЙЙzyz~ЖЙАyqkghx~ААВГЖЗЗ{nnxАВВААГВЕГzpovГДББВА||ААААААВВГypcXX`fls|yqosxxwqi^[dkeYZflhabmzА~xtrl^^gmolaZdputw{Аyric]dmrpkkn{zuosx|ЖЙГzrmhgjnrxz{{z{|}~~КНЙГ}|{||}~|yv{ВД}v}~}~А{zy{~ВДВДСШУКЖВАzzxvuqopxВРЮЮКyx}ДВ~|zvuzАЛДsd]ewwАЕГБИХЧЦХСНЗВ~|ЖУЧХХЮ▓┬╙▄▀█═║ЯЛБ{~НЮк║╤уыц▐▄рцщш▐╦└├╠╬═╙╪┘у                                                                                                                                                                                                                                                                                                                                                                                                                                   pnojiomjoonkqokmpnkvЕВts~ИБoyЖРЛ||ГЙНЛГzВОХЭбЭОВ{qioГХЬй├╪яўЎяшщшхс▌╪╧╩┬╡пгЮЫЬЫбк▓╕╛╜╢иЬХФТУСПСНИА~ДМПООВ~~ДЗЗИА}yz}ДЙГ{tlggxБАААВЕЗИzjkuДВВГВДznkt|ВГБ~АААААВБГГЕГ}xohbbflnrwwsppsvsoh_]glcY]gjd[aqyА{tsk_]fqph`^irttuy}}ynf^[hrvsljn}xqvy{ВЗГwnkfilpvz{{{{{{~АЙНЙБ}||{||}|zwzБДВz}~||}{yw{~АДВДЛЧЦКДВВ}zxwrqonu~МЫаНxx{БГВБА{ux~ЗЕs`[h{БЗЗГГИТЧУФСОЙГВЖЦбЮФЭ│┴╧█с▐╙┴жСВ}{ЙЧв┤═▀ъщр▄▀фщшр╬╜╜─╩═╥╫╫╘                                                                                                                                                                                                                                                                                                                                                                                                                                  №pnngemnnrpjjonmqutowА~tt~В|t~КПЗx}ЙОСПГyГОЧЭЯЧВ|zohsЛЫй╕╬┘чяЁэььэыъчф▀┘╤┼╖лдЭЬЩЩгл░┤╕╖пЮЧФУУПЛМНЛБВИЛМНМЖБГЙКОЕz{}ГИЕvnjh|ВБВББВЗЗЙ{lht~ДДБ|ААВЕ~jco{АДБ~}А|АГГАААВВ{yuqmjklmkpywqoqutsng`^ehbY_igb]epv|~|urg]aknlf]`lrsrsv|Вwlb]_ktvqljn{Г{rxy|БДБwojikotxz{|{z{{|ЗЛЙВ~}{z||zzzz{АБ}{}|}~}~}{{{ВДВВЕПРКВБА~}{xsonow|ЗЦЫСzxy~АБА~ywx|ИЗub^kЙЙИЕГЗРУМРТПЙВГВЖЦвдЬг░╝╩╪рр╪╚░ТД}zДЦЭо╚▌щът▐▀ушчр╥└╣╝─╔╠╒╫╒■                                                                                                                                                                                                                                                                                                                                                                                                                                 Їqolginmmoplmplmsvmm}ГyruАГ{}ЗНОВuМТТКАyИСШЮЪКxzzrn}Ти╖─╙▄ушэьэююэьыычс█╤─╖пеЯЫЫвжио▒▓мЬСТРСНЙЙКЛДДЙМППСИДВГЕЗЛЙГ{y|~ЗЗВwnll~ВГГБВГЗЖИ{omrАДГБ~АВГЕ~kcn|АЕВАБГГБАБВzvutrroqqmmorssoptusohccii_]cjfaYesy||up`Zalqicadosqoqtx~~tha_eptuqommx}{wxy{ВЗВyohhptxzy{||{z{}|{ДКЙАzzyyyxyyyyАВБ~~~}}}АА~|~АВЕГ~БОТКВГГА}zvpnksyЕЧбФ}xxyАББАБ|{|}ДЗv_Yl~ЕЙИДЕЕМХПППМЙЖЕДИХвейкп╕╞╒рс█╧╕ЫКБ~ДХЭл┴╫цщу▐▄рчщф╘─╕╗─╩╔╘╓╙ї                                                                                                                                                                                                                                                                                                                                                                                                                                 тlnmfhmjoqoiloklsztr{wtxБД}ГОТНuГНТСЗ}АКУЪЪТДАГ~trВШ▓┐╠╙┌▀хшъыъъыыыыъшт┘╧└╕░заЬЮвежйкиЭУФСТЛЕЖИИДЕЖКННПКЖАВИЛОКЕ||~ДЗГwpppАЕДВБББИЙИ~qksБЕЕ~}АВГЗАkdn|АГВА}~АВЕГАВБzqggpqrqvrnjlpsrrsuurohb`ed_[bif_^grv{~~um`[fomfb`fnqojmruz{qf\`jtvuqlijv{uxy{АДЕ{plpwxyyy{{zzzy{yyБЙЙ|uvwwwvvwww{|ААА~}~}}~А~~БДЕВ}БЛСНГАВАБ}xsomovДЦбЧБ{tu}АААА}{~ГЗybYcnyАЕЖЕДЙРЛМПРМЗЙДЙУб▒░м▒╕├╤▄т▐╥┐гОБzГСЩз╝╥счх▐█▀чъх┌╚╖╖├╚╦╥╘╘щ                                                                                                                                                                                                                                                                                                                                                                                                                                 ╩mmmgmnkkomlroinuumo|~toyВГВЛХУЛА|ЖРУНГ{ВОУЦУЙ~БДАwzМб╗╟╧╙╒╪▌ххфссуфчшчшцс┘╬┬╛╡кеббгадебЪЦТОМЙГАВЗЖЕЖКМНММЗАЕИККЕ|z||ДИДzstw~ЖЗЕГВ~ДЖДztv~ВЖВ}{ГЖВnfr~АДДА{zx}АГЕДВВГthafmoqqsrljiovvttusrle`fiaYYchd]]ipuz|{ul]\hpnc_alqplfgpt{{p``hpvwupigkv~}xvxzАДБztqsxyzy{{{zyzxwvw~ЗИzokiiknmquy|~ВГБ~}~АА|АБГДБ}БИПОЗЕГВАБА{xpmowВТЩФДzrsyААВА{zБЙzf\ahrzЕКЗГЙФПЗКСРЙИЗЙОЮ▓╖▒о▒╜╔╫рр╒╞лТЕ~АНЧЮ│╩▄хц▀█▐хщч▌╠╖╢╛┼╞╠╙╘╘                                                                                                                                                                                                                                                                                                                                                                                                                                 пknlgmllproiokhnvuppyyrrzБГЗРХУИx}КСПЙА~ЗСШЧМА~БЕy~Тл╛╞╠╦╞╦┌хф┌╬╥╒█▐стууу▌╫╨╚╛│кздЯЫЭЬЯЮШТОНКЖz~ЕЕВЖЛММНЙБ~ВЖКЙЖ~wx{БКЙ|wx|ВЗИЕДГБЖЖЕБ}xyБВВ}{|ВЕГrlvБАБДВ|wz}ЕЕДГЕЖk`Xaossssohfgls{wurqifdffa]^dga[_lsuxzxsiZ_ink_aflppkacpv{zp_`ktxwrokfhs|tvz{}ВД}vuwwyyy{zzwvwvtqt|ГЕyniiighhmuyz}ГБ~~~}ААААБББГГДА}ЗССЖГВ~|zxtoouАНЬШИ|sqx|~А~}zzБЗ}h``elyИММИЕРТЗЗОРМКЗИМЬн▓пкм┤└╤▐р┌╠▒ЦИ}ЗСЫл┴╪фчу▐▐фщъу╨║│╗├┴╞╧╙╥                                                                                                                                                                                                                                                                                                                                                                                                                                 Сnnliromnmjkpkgnurjr|zoqzАГЙФЦПГ~ГНТМВ}}ЙФЩТЖВВЖЖДБИЪо╛└┐╗╝╦▄ц▌╧╛╝─╩╤╘╪┌▐ср▌┌╙╔└╡нжЭЫЪЩЬЫЪСЙКЙЖ~w{ГЗЗЖЙМОПЛВ}ГЗЕЕА{vzАЕЙАzz~ЖЙКЗГБГЖЖДБyxБВВ}x|БДВunvБГВГ~ysow|ГЗЕЗЛЗhYV`nsproigcflsВ}yurlgglj^X_hfa_bonruwwuh[bnpj\Zioqnh^gsx{{qadmvxupmjghs~|uuz{z}ВА|vxyzzyyyxwssojls{АБxqkifegfmu{~|~ББА}~~~БААГДДА~ЕПСИГВББ|{yvqps~КСЦНАwrtx}~~~zxАЗ~meafjtКТПИЖМНИЗСЦРОКЙКЦй┤мЯел╖╩┌с▌╨╕ЭЛА}ДСШд╕╨ущф▀рфщых╒┐▓╡╝╛┴╬╙╙∙                                                                                                                                                                                                                                                                                                                                                                                                                                ynpmfkikoplkojhntrnvzxruАДЛРФТКА|ЖПФЛ|yБНЦЩНАЖКЙИЙСбм░н│╣╛╪Ў°т┼по┤║└╟╩╤╒┌▌▌▌┌╧┼╛▓лаЫЩЦЫЪЫУКЙИБvow~ГДЕИМНОЛД}|ВИЙЙДАyxГЖБ~z}ДЗИЖДВАГЗЗЖГ~|ВЖДБ|{~БАzvw~АВЖБ{sntzАДКМКzcVVbquomnhc^fms|ГДvrljiid^]eif_`conorwxtgZcmofX_lpqle_itxz{tdhrwvsnhecisz{ywvxz~ЖВyxyyywyutnjfcdgpxАЕtqonlljnuyxy|ВВААА|~~}|ААГЖВБЕМОЗДГАББА}{xolq{ЕРЦПВzurs|АА~}zzГБtifmszЗУСЕГНСЙЕРЭЪСЛЛЙРЯнеШЩап└╒ср╘┐дМВzРШа░═ршцсрфшыш┘┬░о╢╣╜╔╨╤ю                                                                                                                                                                                                                                                                                                                                                                                                                                mnpmfojmpmjmshipvrm{zuxАЕОРФСЖ}}ЙСХЗwzДРЩЦД{БЙМКМРЪаЯЮз▒╜┼ф■№ф┬еЯдйп▓╗─╩╤╒█▐▐╪╬─╕▓жЭШФЦЧЩСКЙД}i`h{ЗЙИЗЙНПЛЕА|~ДЗИЕАxx}ВДГБАДЗИЖДВДЖЖЕВ~{АГЗЖВ{y}БВ~yy~АВА{ojrzАЖИВwkVVZfrxsoke^\_hozГЗБ{vmmkje\]fjd^_ehhinswue^gmle]cnrnha_nwyyysiotwurkd_akrz~|yw{z~ЖЖАzxyyzwwqpkdcbejpx~ГДxwvvttsszyzzАГГБААБ|}~}~АБДГДЖЛРЙИДБВВБ~|ysnoyБОШСЖ}xqqx~БА{{{БВxnhry|ЕОПКЖКРММПЬЮЧПЛЕЙЩжЮФХЪе┤╧▐с┘─нТД~МЦЮо┼▐щчустшыш▌╟▓м▒╖║┼═╧┌                                                                                                                                                                                                                                                                                                                                                                                                                               ¤jlpmgngjppllnfhqvrr}~suЗИФПНЙА~~ЛФУqvЕФХОЕБДННРХЩЪЪУЩд╡╜═ъ ¤ф╛гЪЭвежл┤╝╞═╒█▄▄╙╦║│йаЫЧЦХЧУПЛГua_dvЕЙЖБЗМПЛЗБ}БДЗЗЕГxwzАВГБ{}ГЕЗЗЖДББДЖЗЖВ~АБЕИДyv|ВА|vzААДБyldjw~ДЗr\RLR[grxsojb[[cjowБЙГ{tkkkhd_aiid\_gmfgkrwtibjoi_^gqplf`cqw{{~{rsxvrme^]`ipw}}ww|}ГЖБ{wxyxtoidcccdimsy~ГГ|}|{xwxwz{z{ДДДГДВА}z~БГЕДГЕЙЛЙЕДВВВБАzvqrxБЛХУИАyoqx~Б{{zГЖrow{|АЙЛЙЖКОКЗМЫгЫХРЗЖМЫЩРРХЭо╟▄т▄╠╡ЦЙ|{КЦЬк┴█шщхттхъщ▀╦╖ййп╢┴╩╨╨                                                                                                                                                                                                                                                                                                                                                                                                                               їkopmmrjnookooeiqwqnxywzААМЛОГzwБМСОznxЙЦХЙБЛОХЧЪЪЧУСЩж│┐╤ю ¤т─дЪЭЪЬЬвз░║─═╓┘┌╫╬╛╡йвЩЧФУХХТМЖv_^csДЙИДИММЛЙЕ}ВДИЕБyww{~ВГАВЖЙЗЖДДГГВВДВ{БЕЖzwz|}Б~zz|}БГyichq{~dQLNUZgqwtohb\^cjnv|ЕД|uojkhb\bkia^chgddipwulgmmf^_hrsjb^bpyzy{zwvwusmdZZajpuywqopszГИБzyyxuokebcgjmpsxz|ВИВ|||{zzxvz|{|ДИКЙКИААz{|~БГЕЕГБЖПЛ}ДДВАА}zuppwЗЦУКАztnu}А{yzДАwrw}}|БЙЛЕЕППЙКЩггЬФНИЖКТОПЦЪж└┘рр╘┐дНА~ИФЫв╗╓хщцтсушщт╬╡гз░▒║╞═╨№                                                                                                                                                                                                                                                                                                                                                                                                                              шhlnkmmforoorqbhqtsvАvpy}zАЕЙ{tyБНТКskxОХНВАЗРФЩЭЯЩСКЛЧд╡├╥ё ¤т╟▓зевбЮавип╖┼╦╥╫╘╨─╣нгЪШШХФХХСК|c\brЕПЛГЖЙМЛНК~ВЖЙКЙ|wwy|~~z}АДЗИЗДДБДДДЕВ}|}БДВ{x{}ББ}zz{~БАyi^es{zmWOLNU[gswtoga[_konsyА{tpmif^_dki^[cjf]]gpwwpimmeZ\jsoha`fquyz{|yxwuni_\adgnrsrkejs{БЗЕ}|xtpjfbbbjpttty{|ВЕЕАА||zzxwyz{||Б~~БДЕГВ}}}}БГЕДБЕКК}zВВА}ysqu{ВУХК{vtrw}}zxxАГГ{w{~А~ДНЛДЙНЛНХензЪТЙДЙКЗЛТЩб╗╓су┌╟оУДАЗСЦЬ╢╧тщчуртцшт╙╗Ягнп│┐╩╨Ї                                                                                                                                                                                                                                                                                                                                                                                                                              ╠klmjoqmqpkkusgmttppvsu{АzuАДГyrvВНМljzРРЕВЕМУЦЮввТЗЙТЯй╖─╤є ¤х╨╗░покдегдк▒╝╞╠╧╤╧╩╛░дЫЩЦУФХЦТОВm_bsЕСОГБЖЛННЙА}}ВЕИЗАzwxxz}ВВДЖИЗЖЖА~~ГДА|~БДГwy~ББАzyz|БГzfcjuytfWSPTX^hv{wphbaekllruxwuspkge_Zelf[]ghb^`hquvrpmjd^`mpmf`blrvvw{~{xvrkfbcddfmrsnh`jt{БДА|ysnkfedfmquxxvy{~БДД~~{{|yxwxzzzБ~zxxy}~}{||{ГДДБДЙЙАz|~БА~{rmt|БОПИБ}xtqqv{{wsu~ЖЖАwАВВ~ВИКИОРНКУи▒овХЛГДЕЕЖМХЭ╖╥рх▐╧╖ЧЗАГНУЧо╟▐шщт▄суцт╓╜гбезл╗╟╬ц                                                                                                                                                                                                                                                                                                                                                                                                                              ▒immkmlgnpnnrjfptsqv|ns|АwnzВusxБПКygi}УС~ИТЦЪЯвЩМЖПЦЬи╢┬╥ї ¤ч╓─╜└╛╛┤▒лизз│╣┬├╩╬╠┬░зЭЩЩФФХЩЧУКvnevИОЛДГГЙЛЛЛГ}~ВЖЗЖГ{vtqpw}АВЗЙЗДЖБ||АВДГВВВАzz{АБАzwz{ББ{i]lz|tiYUTTTZiwzxridbfonijqupmrpmg`[YgneZZgjcZ^ktwxvsnibYbnpjcadputtw{|{zunfb_dhiikproggmu|ЕГ|vojgceglqtwyyy{{|АДЕБ|}zyxvyxxxzАВ}yvsvxxz{}}ДЕДБГЛНvz~АБ~Б~zrmr{БЛПЙВ{zurprwxupr|ДЖЗДДЖГА}АДЖБКСРКОг│▒зЪРИВВЕЖМФЬ▒═▀ху╒┐аКБВЙСЦз┴┘цшу▌▐ттс┘┐ЭЪдггп├╦╧                                                                                                                                                                                                                                                                                                                                                                                                                              Фlnmmqomrnjmqkhprsrvtot|~up{ЕАwv|ДМДtfjБХЛyБМУЩЫЮЫСКМПЦЮй┤╛╥ў ¤ы┌╦╩╨╧╔├╜╡оидм│║┐─╔╦┼▓иЯШЦТУСХХФН~tmzИПОИБГИЙЛМИБy~ГЕЖЕutontzА~БЖИЗВГ}{ГЖВ|АВГГВyx{БГВxux{ВЕ}hbr||tk^ZZYX^kwzxqifgjnkghkpompqnfa\^hkdY\ii^]bkruwwsnga^gpph__grqquxz}|ztmd_`kpmmmnpqjksx{{АБ{qigddhmqsuwyywwy{БВА}{|{yxxzyxx{БВ{wtsrsx}}}БЕЖДДИЛВvv{ААА~}yqosxАЖМКГ|{xsloturoozЖКИЕЗЗГ~||ЕГЖНПМОЬ┤╡оЮУИДААИУЪм┼▐чц█┼йОББЗПХв╣╒фчу▄▄▀тт╪└ЮХбгво╛╔╚                                                                                                                                                                                                                                                                                                                                                                                                                              wilomnignmnrukgoqnq{wou{|vrЕ~xx~ДИnelЖФДxГПЦЫаЮТЗЖКРЦЮо╡╛╙ў ¤яс╓╪▌▄┌╥╦└┤кгдм░┤╝┬─├╕ндЩЧХШЦШХУНЗ|kzИНПКДБЕЙННЙВ|БГЗИЗВupljs~А}ВЖИИДЖГzwzВЖИ~БВДД}sw{В}wy|ВЖБohx~xpedb[V[kwzzrjfgmtjbejnnruqke]V_ij_Y]ik[Xbnsuxvsle^^lroc\_jusqrux|~{sga`emnmkjoxwnqvx{|ВГyohfcgmpqtvyzxwwz|~БДВ}{|{zyxyyxuyБВ~{yyvttwy}~ГЗЕГДКПГvsryГВА~ztoqxГКЙД{zuoklqokmxГЙЛККИГА||{ЖПТЛЛЫ│╖┤лЧНДА~АКРШи┴█чч▌╦░ТЖБЕРФЬ┤═▀цт┌╪█▀р┌┬аХЯбЭи╛╟┼°                                                                                                                                                                                                                                                                                                                                                                                                                             gimmlqnnpkirwnioqprwspwymtБДБДКНРЖxmgpИС|ЗТЩЮвЧЗЕЙПФШв░╖├╘ї■√Ёц▐рхцт▌╓╦┐┤кзйл▒┤╗┐╜╗░гШХФФФЦУТНЙВs~ЙРТОЙГДЗЛНЛГw{ВЕИИГvtokrВВГЖИИДЖДztw~ГД}~АВВГ~uv{АГzx|АДwzАГВ}skic\Z^kxzztmilqpfabhmpuwsmd_[`hk`]bhiUWdqtwxvrkb^bqqmd]anrnoosxzyxsf]_jqqnkjoy|sqtvz{БzqjjkmrtwuvyzyzxyzyЖГ}z{zxyxywutxАВБ||||tqrtx~ГЕЗГАЗОЖzuqv~ВБА{vrqv{БЛЛД}zxrlkmkgirЙЛМЛЙЕГ~{{|ЕОУЛИШ▓╜╗│вТЕ||}ЕОЦе╜╪цщу╥╣ШЛВДОУЩм╟▌фс╫╒╫▄▄╓─еЦЬаЪв╕─┼ш                                                                                                                                                                                                                                                                                                                                                                                                                            ■dgjhjphhjjlushinoot~tov|wnuГЕБВИНТАqiiwЛЛАГЛФЪЭЭПГИКСХЩг▒╗╚┌ї√ўюъцшььщхр╫╦╛▓мййио▓╢╗╝╡йЭЦЦШЦШХТПКГ{ГКНРПКАДЖКННЕyy~ДЗЗД|vqou|}ВЖИЙЖЕВzsu}ЖЙ}|БГЕpt{АДБzu|АЕЖ{zБЗДАxnkc\Xapy{|wojmruf]_fjoxywme`Wamh^\ekeYYequwurng`adnnm`[dqrljlqw|}xqe]dnrsnjioyysstw||ААzrkilpuuuuwyyyxxy{|ВДБ~{zxuuvxussyБГБ}||{tsswz~БГЕДДЖЙВ}uttw~БВ~wqqv|АИЙД~~ytolkibeo}ЙМЙЙЙЕВ~{wuyДЛМКЛЩм╛├╗кШЛ~}ГКУЮ╕╓цъх╪┴аОДДНУШе└╓тр╫╥╙╪█╓─зЩЩЫЪЮ▒┴┬╒                                                                                                                                                                                                                                                                                                                                                                                                                            ўhllilrkmmijutkmqpqxyqpy|ulyВГВЛЧХТ}nhlЛЖ}ВОФЪЭЦЖЕЙНФХЭй╢┬╧▌ЁЎёюыыэяяьшх▌╓╚╛╡▒лййм│╣╗│мЮХУФФУРОНКДВЗКПРСЛББГЙМПЙ|{|БЕЖДzsouБЖВДДЖЗЖЕЖznq}ДЖБ}}БГЕБrtw}ГД~t|АГЕЕВЖЛМДyrpd[Yfr{}|womnqmd]^bho|{zofc^ejd]]fneUZgpuwvqle__hqomb_hpqffimuxzupd`hrxunimqxzrptxz|Б|sllruvxwwwyzyxxxz{АЖВ{zxxvtwwtqqwАГВ}}}|yursszАГЕГВЖКЖzutvyАГysnsyЕЙЕБББ}xsoif_am{ДЛММЙЕВ~|wtyБКПМКФе╗├└▓ЫМА{|АЛУЬ┤╨фьщ▌╚йТЗГКРУЮ╖╧▌▀┘╤╥╓┘╒╟лФЦЮЫЫм╝┬└                                                                                                                                                                                                                                                                                                                                                                                                                            щinkimnfjjiovrflpnoxysswwsn|ЕЖКПШШРypluЕЗАБЗПЧЭЧНДКПРУЦЭл║╞╤▌чьыъъюЁЄЄёэых▌╙╚╛╡меделп╡╡нбШФУЦУКЗИМЗГИКНННМЖБВЙМСМА{{ГЗКЗА|wvzАВБВВЖЗЗЕЗ}oo}ЖЙГВБВГ}tqt{ДИx{АВДЕГЖРПЕysnd^]ht{}|vpmnrn`Z[afmx|}phd`gie]_gkdZ^fnrstqlc_dkmmf^_kqocbeny{zumbaltutoijorxtsty{{}{urtvutvuuwwzxwxwy{}Б~{wxvusvvupmv|БА~А}|{wvuy|ВГЕДГЗЗВyusv}ВА{tprw|ГИЖБАА~xsoicZ_kxГЛПОНКДА}yuwАЗЛЛЛПб╗╞┼╕дСД}АЙСШп═тыъу╧┤ЧЙГЖПУЩ░╩█с┌╨═╥╫╒╚▓ЦТЫЭЭе┤╛└¤                                                                                                                                                                                                                                                                                                                                                                                                                           ╫jonknnjpnhjqogmooqyvnq{ysoАДЙМФЧХМvrs|ИГВЙТХЦНЗЖКРУШЩд░╛╚╙▌срфхщыЁЄЄЄЁюыф┌╘╔┐│кедйкмп░жЦУРПМЗВГЙИЖЙМРРУОИГВГЙМЛД~yЖККДyx{ЕИВВВЕЖИЗЖ}pq~ЕИЖБАБГЗЕtkpzДКАuz|АГВА{}yxwwrd[\guz}Аzrmopi^YY^bjs||rifikic^aii_T`innoqrod_empie^dmni`bepxyztkbfptwsnjkpsxuttwy|}Б~xuuuvwwwvuwwsvvuvx}Б~ytsqrtwwtpns|А}~~А{{zywsxzАДЕЖЗКЙБ{ywqqy~~{tkpw}БЖЕББА{uoi`W[huГЛПХУМЕВ}}xzЗОНМПЬ╕╚╔┐мЦЖА}АЖОЦи╞▄ыэц╫┐ЯОЖИНПЩл├╪у▌╤╠╨╙╥╦╡ЫФЧЩШап╝┐ї                                                                                                                                                                                                                                                                                                                                                                                                                           └immkonfjjjownhmokpz{ruxwtsАГПУФУСДrt{БД|ДНХЩФДАЗРТХЫвл░┐╩╥╫┘┌счцыэёЄёёяюът┌╤╞║ожбгдиооиЩХТТНЕВАДДДЖИЛНППМГ}ГИЛНЙВ|}ГЗКИyy{БДГГДЖЗЙИИtw~ГЕЗДАБВВБvklyДЗ~vy|АВБ{oefksuof__juy}}~toorl\VYaegq|zrlgfkha^cgf^]cillpsrmecjongb_fpqk`bjtzz{tibisuuqlfhnqxwustxy{В~{wtvyyvuwwtqrqstv}}ummklpstrmgqz~~}|{||{vw{АДЕЖЖЙКВ|zwtpsx{zuqqx}ГИЕААА{vph_U[fuВКРУХОЖВ~xx}ГЛОММЩ┤╞╠├╡ЬМБААЕМФе╛╫шющ▐╞йУЙЗНСЩз╛╘р▀╥╦╠╧╧╠║ЩРЧЪШЩз╣╛ф                                                                                                                                                                                                                                                                                                                                                                                                                           Чknnlpqkmkkqsmlrootyxkuzwrq|ВСХФПК}uwЗГzАИСЧЩНzМУЦЪдк▒╖┬╟╦╧═╬▀фртшыээюююьшс┌╧┬╢мдеЯдзйеЫЦРЛЙД|zАГГЕЙМНРПОДzГЛМЛБy{АЕЙЙГ}|}ГЕГГДЖЖИЕГ}z}БДЖЗГБВВГД{pqyДЙxz~А~~re^^itwrh`bowz|{xsqoog\Y\bdgmw|unjlmhc_dif\[fjifhpqnhgkrpf]^irqh_dmsyzzvpjovxwokdhmqxzvstwx{~А}{zvwyzyxwvuomijmrz~|qjgeimuwrnmqy{}~}||zz{{{xyyАДЖЖЗККБ}}zvvrt{wrtw|БЕЗББ|{une\S[fuЙНТТМИГБАzy|ГКМММФн─═╟╗жТВ~ДЛУа╕╥цюьс╬▒ФЙДЛМФв╕╥рр╘╠╦╦═╦╝ЪПФЪЩЩг╡║╔                                                                                                                                                                                                                                                                                                                                                                                                                           АjmklolfihjrvmlqonrwvqyytpsДНПМДxr{ДКДxБМУЧФИzЖСХЩЯи░╕║╖╕╣╗╖╚чч┌┘рцщъыыыышф▐╒╞║пегЮЯвезЯШСЛККГsvАГГГЙМПНПЗ}~ГНОМД{{ГЙЛГ|{{БГДВГГЕИЗЙГ}~ГИЗЙДБАБАЕ~pnzБЗГzy}АГПxg`]gwxrnffoxyyyxtonndYZ`efgkrwupiiif_^ehd]`ggd`foookllokc^aipngbgpvyyzyurtxxrid`dkq{~zvvw{АБ|zz|xyutqnifdaejt||{tmifimrvtpmsy{~}|}{{{|~{{zДИЖДИЙБ}{|zxtrvyxsptz~БГАА~{umcZV]gt~ЙКПРМЗДБАy{{АИЛКЛУж╛╬╦└лХЙАИПЬ▓╨хяюх╒║ЪЛГЛПФЯ╢╬▀с╒╔╞╔╩╦╛аРТШХТЯ░╕╣                                                                                                                                                                                                                                                                                                                                                                                                                           jjnlnnlknkkppjmqmpvwrltwurw}yДИИ~twЗИБ{ЕОХЧПА{ЙПЦЪж▒╣╣┤пммк└шЁц╤╔╘▄сучцшцчшт┌╬┴│йвЮЮЭЭввЬНЙКЙБlp{ВГЕИЛРРРЙБААДКЙД}||ДЙЙДВДЖЕЖЖЖИЕЖДВВГЖДЗЕВВА~Б}uryАЕЕ}z|БИОvf[Ydwyupllqwzyvwvpmm`Y]chhhipwwrlheb_^efdY]ggb\eqrpmonni_]dlonihotxxy{{zuwxuof]_cioz}vonrv||А|zzyxxtqkhc_`ackqy|zvrmjjouwvvruz~~}}{|y{{{|{||АГИЙЖДЖГА|zxrptwywrtx{ВАБАГzrkaXW_hqyДЖГЖЗЕДГБ}{}БЗЗИКТа╗╠╧╞▒ЩКАИРЩп═уЁёщ┌┴дОДЛПУШ░╚▄р╘╔┼┬┼╞┴дТРХЧРШи┤╖¤                                                                                                                                                                                                                                                                                                                                                                                                                          gkljknjhhbirsmnojmuupszvqs||sxАГytwБККА~ИПХРЕ~ГПУЦЯл╕║╡лжбг▒╫∙√щ╠║┬╬╫┘▌ртстфф▐╘╞╣нзЮЭЫЫЭаЮОКЗrekvАБЕЗНОНЙВА~ГЙНЗА|{ГЙИДА~БВДГДЗИКЗИЖДЕЖЙЖИЕАААДВwsxАЖЙ~wzАЕЙubWXeuywwnjruwwurrqml^U[gmgggnuwrkge_\^dea]chd]Zgsuqppqmc_afnqpjlpvwxy{}zxxurkc^]afluwqhejv{}АА~{wwvtpjfccceejnt{~~zvssrptuvxzxy{||{||||||{z{{БГЗЙЗЕЗВА~|zxropvytprz}А{~wpg]WU_hpzГЕББГЕЖГА{{zБВЕИПЪ╢╩╤╩╣вРДААЖПШи╞рюёьр╔мТЙННРЦи└╒▌╒╩┐╛╜┴┴йЧСРСПУво┤Є                                                                                                                                                                                                                                                                                                                                                                                                                         №glmlkojmojmqolppjmwwnnusqqxxpuБДqqyВИИНСПЙГАЖРФЪеп╕╕мЫЬал╝с¤ э╞о▓╝┼╩╧╘╪╪▄▀с▀┌╤─╖нвЬЩЩЪЪЩСОГzl^brВЕЕЕЗППСКД~|ГЙЙЗБzvБЕИЕВА~АДЗЖЖЗЖЗЗЕЕДЕДЖДЗЗВАГЕЕ{v{ДЙДzy}~}pbVWfvyzytquuusooqqkm]Z`hjhefmrwsmhe^Z_dd`[_fd^Xiuurpqqne^`hqsrlkrvxxy{{{yxwui]\bfhmqsj^_hu{|ВВ{xvtpkfdcdglnrtx{}~}zxxvuxxuu{|xz}~|{z{|zzz{{{АГЕИЗЕЗЗБ~|{{urmoxwmpy}АБ{wyzwpd[X[diqyАВАБЕЗИЖВ}|~ВВЕЙОЩ▓╠╘╬┐лФЗА{ГЙЦд┴█ьЄэт╨▒ХЗЙПОТб╖═┌╫╩╗╖╖╝┐нЦНОСМНЮи▒█                                                                                                                                                                                                                                                                                                                                                                                                                         ЇhjmlnmihhfjspmpojouspvxqpqxtqwБДxqv|ЕЙДВЗРХПВДНУЧЯй┤╢оЪФЬе░╜ч■ э┴авп╢╗╛┼╔╠╥┘┌▄▄╒╦╝▒еЮЪШЩЪЫЧТЗyi[aoИЗГДННРМЖБ~ВЖЛЙВ{xДИЕВ|АБЕЕЕЗЖЗЖДЕЗИЕЗДЕЖДВБВДВ{x|АГЙЗГВ|qf\]iuyyytrsusqmmquql]Wakjdbeinsrmjgb`deaZ\eg`Z[ktwrppnk_^elsvwqpptwxy{{zxxtqb^dhhjltsi``kx}|ББ{wurmiecagkmrvxx|А{yxttxyrijquy}А}}z{{z{}|}АВЕЗИЕЕЕБ~||{xsojkqpou{}~}xvwwnbWXelruzВИБ~ЕКМЙГ|{{БГЕЗМЦо╚╓╙╚╡ЭЛВАДЙПЬ║╒шёяц╘╣ЧМЙМРСЩо┼╫╓╩║▒▓╢╣░ЪКЙСПЛЩбл└                                                                                                                                                                                                                                                                                                                                                                                                                         сgmnnnnimmhlolnqojpxvnqspqtwqo|ЗЗxu{ГЗЕАЙСУЙ~ИСХЭйо▓лЭХЩбк│╛ц  Ё├ЫЪгзм▒╢╝└╩╥╪╪┘╪╨╞╗квЩХХФШЧХНАj[anАЙЙЖВЗНПОЛВx~ГИИЖ}v}ВЗЗГБАББЖЕЖЖЗЕЕЖВГДГЕГЕИЖББДЕЖ~xy~ГНКА|ГВ{tka`lv||}zutsqmjjnrol^]cjhc_cgmtwohfdefec_aed`\^ntusrqni]^emrxxrrqquwyxzywvqlb_filkntukciqx{}В}wtnjhhklporuyxx{|~АА||yvtxxrg`ktz}А~}{y{{{y{{}АБЕИИЖЗЖВ}{{zytlijkjmtz~|wrtsk_QZnuxz}ЕЕАГМТНДБА~ГЖИКНХл╞╫╫╨┐иУЕАЕКОЩ▒╧фюЁщ╫┐аММООПХе╝╙╫╔╡лн▒║▓ЪНЙММКУЭди                                                                                                                                                                                                                                                                                                                                                                                                                         ╚kooknnjjgemrnoqnmruqnvtnnuxpm|КЖw{ГЗЕБ}ВМСРЗБГНХЪвймйЪФЦЪал╡╜у  ё╞ЬЪбжзмо░╡┐╚╧╘╘╓╒═╛░зЮЪЧЧШЪШУЙp^blАМЛГЖЙМНЛД{zВИКЗ}uzДЖЖБА}ВЖИЗЖДВЕДЗЗДДГЕКЙГАБАБ{{~ГККЕВВБ|xphekuyy{zwtqojfblurm`\flh_]chlpsqjecbefc_bhf^[`quwuqqlgX\fntzzwwvuvwzz|ywtngZ_jnlintrojntz|}~Бtpjjijnprstvwwy{{||}}{zuvyyqb_jty|~|yxwyzzz|{}~АЕЙЙДЖЖВ}{y{{xqmihgls{|}tnqrgZO^tБЕДААЕДБМТРЖА||}ВЗКМТд┴╓▄╫╦┤ЫЙБГЗМХи╞▐эяъ▄╞жОКННМСЬ╡╦╘╚┤жин╢▓ЭКЕМЛЕЛЪбд√                                                                                                                                                                                                                                                                                                                                                                                                                        нinnlnnlnmkoqmprnluvoqromoxznqИЕАДМОИ}|ДМСНГ}ЖРЧЬдидЬУУХЮзо╕┐▀  є╔гЮдзйммло╢╛┼╦═╙╘╨┴│иЯЪФФХЧХТМzlepВЛНЖАГИННЛЕБ{ЖКЙАyz~ДЗИГВА}ВЗЗЖЖВ|}БЕЕГВДЖЙЖГДВЕА|zЕККЕДЕВzuliksz||{xupnha_hqrkdelnh[Z`hlruqjb_cefa_bda]\dqtwvsqke[]hqxy{yzwuspw{{zxrlb_emnlimtvokpw{|~БВ|roklmpstvtxwxywz||~|{zxxzysb`isz{{{wssw|{z{~~~БГИИЖЙИВА{|}}yrnijhksxz{zvnljaXR^tДИЖБИИА~КУУКГА~АГИЙКРЯ╜╙▀▄╤╝дНДЕИОУв╝╓шюъ▀╦оУЛЛИКОЦй┬╧─▓гвеокЬЙВКЛЗЙЧЯащ                                                                                                                                                                                                                                                                                                                                                                                                                        ПjmjjnmklegoqpstmowvlqxqkowwmrБИД}КЦФЗ{|ДМНЙВВКТЩЯиеЫСКФШЭе░╗┐▄  є╨░н╡╢╕╢┤░йо│║└╚╠╤╧╞╕нбЯШШЧШЧХПБwptГМНЗГВЖКННЙБ|ЕЛНД{z~ДИЗВ}{БДЖЕДА|{|ВЕЕВГЖИЙВ~ВБДД~x|ВЖОПЛЗЕВ~xnjkox||{xqomf\]fqulgelofXX_fjptsjaaehe^\fj`Z^hqswuqnh`Yamsy{}}}{wurz{{ytphb`hopiflswrnqx}АА|sqkknqtxwux{{{z{{}}~{zuvzzscahry{{{vpsuz~zz|||ДККЖЖЗГ||||{xsmjihox{zxvpni`UT[l{ВД}ГЗГАДТЧОЗВ}~|БИЙИОЩ┤╧▀▀╓┼мСИЕЗМПЪ▓╧фюьу╨╡ЧОМККМУа╖╞┐кЫЪЬийЬКВКМДЗХЮб╥                                                                                                                                                                                                                                                                                                                                                                                                                        uhliimlnoljnmkrqlnvtqtslhpyvmvБЖДБТЦСВxАИЛНГ~ВНУЪбжЭСМОЩЪЯк┤╛├█ ■є╪└╝┐├┼┬╝┤лло┤╣┐╞═╧╟┐│гЪЧЦТЦЧЦРЖ~uzЕНСЛГВЕЙМНКЖ{{ВИКЕА{}ДЙМЗЕВ~БЕИЖЕ|wxzАЕЖГБДЗЙЖАБАБВА{|АВЙМЗВ~|xqmjnuyyzwtplf\ZetxokinmdUWbhkotrjbcgjd\^fe^^ahmntuqnf__gqv{}А}|zwssyzzyskc[dptrlfkswqpsw{|||wsnpqsuyzuvy{|z|{{}}|zwuuyxrd`iqv{{}znnorwy{|{|АГЙНИЖЖГ}}}||yuomjinvzyxvqng_TNXalvxxzЕЙВ|БПХОИГБАЕЙКЛМХн╩▌р▄═╡ХЛДЗКОХм┼▐ььх╒╣ЧОКЕДИНХз╢▓дЦУФбжЫИБДОЖДСЬам                                                                                                                                                                                                                                                                                                                                                                                                                        fjlijmmnkdfoompnkntsktvlgmutnzДИЖЕСЦОzuЗЛЖ~ЗУЧЮббЦЛПТШШвл┤┐╞▄ ■ё▐╥╤╘╘╘╨╚╛░лино╖╛├╩╩┴╡зЭЧШЧЧЧУРКЗz{ИООНЙАВЗЛНМК~y~ЗЛЗВ||ВЕЗДДВБАБДГДutzАЖИЕДГЖИГА|}ДИД|{~ВВzz{|uojkuzzzvsnjeZXetxsonpl`QXdhkqvwjaejjbY\gi_Y`knjotsmeaamtx{АА}}|yxx{zyytjacjpurjfkqwqoqwz|АА}xqnswwyzxuvxz{{|{|~~|{wsuyxredipuz}~{vpnnruyz{}АГЗКИЖЕГ~~}}|{yuqmkpxywwvrme\QPY^bmxz|ДКГ|~МФРМЖГБ}ГИИККУз─█с▐╤╝аОЕЗЙМФв╜┘шьш╪╛ЭНИЗЖЗЙОЩзеЬФОРЫдЫИВВЖДВОЪЯЯ                                                                                                                                                                                                                                                                                                                                                                                                                       ■ejnmlmknlikoljpomotqpurjipuqp~ДЙЛМПРЙvqИЛГМУЦЮаЫМИРХЫЯм╡┐╞╩▐¤¤юс▌█ррр▌╘╩╜╡ом░│╣┐╞╞─╖зЭХЧЦФТОНМКАГКРТПНДГЕКМНОz~ЕЙИЕ{{ДЗЖЕВБВВЖВВ}wuxАЗИГГЕЖКЗ|{БИИ|{|~ВЗloz|~yqilrx{zwsniaXVcwzqmqpl\RXdfknuxncejh^Ybfd]]bjigmssmhgirxz}А|}|zvuz{zyukcfntupifkpsrqruyy}ААztuxxvy|yxyzzyxzyz{{|{yvvyxqfbjrwz}}xrmkmpw~{{АВЙЛЗЖЕГ~|}}}|{zxtmlpuzzxurlcYQPY^biwДБЕЖГ|ЕЧХПИДГВГИКЙЙСб╛╫ср╫┬жСКИКЛТЮ╕╥хьщ█┴вНИЕЕЖЖИКЪвЪНЙЛТЯЪКАИ~МЧЭЯ°                                                                                                                                                                                                                                                                                                                                                                                                                      ўelmiklkmjeglinsomptmlwzmistooЕКСХОМБqpМО{yЕРЧШЭЩНЕЛЧЧаж░╝╞╦╬рїЇъуххчшчф▐╘╞╜│ооо┤╣╛└╛╖нвШЪЧЦСООЛЛЖОРРОРГВГИКМОБ|}ГЛЙЙ}z}БДЗЖВБ~БДВВwquАЗЛЖЖЖЕЗИБz|АЕЕ}}|БЖИjnx~{qhinvxyurnj_WYfx}vsspkZT^eiipvwohijg[V`icYWcngckutmjjnsuz|А~||{{ww{{umgmrsuofciqwtnow|z|ААА|yyyyxxyywyyyxxyy{{|}{xswyyqfdirxz}yvplknsz~{ГИЙИЖЕА{y}~~}||{xokntx{xspkbVMRY_hnwВГДИДАДЦЩШРИЕБГЖЙЗЙСЫ╖╥рт█╦▓ЦМЙЗКНШ░╩ръш▌┬дПКЙИЖЖДГПШФЛГЗЛФЧОАxДГБЙУЩЪц                                                                                                                                                                                                                                                                                                                                                                                                                      ыclmmmmionmqnehqnmpropwwjjsuoq~ДИМОЛК{qrГНКw{ИСФЧЦРЖЕПЩаим╕├╦═╤█шутушыьыъшу▌╤╚╛╖░о▒╡╕╣╗╢▒гХЦФУЛКММКЖЛОТТПСД~ДКНЛД~|БЕЗИ~}~ВЕЖИЖЖГАГААypsАЕИЕЖЖЕЗЗБy{|ЕИБ}|ЙН~fjw~{rihksyyxtng]UYjz|uqqofXS_gghnv~smjje[WbjcY\fkd_jwwoklrxy|~А}|||}xy{|zwspptsrnd`hpsvtsutv}АА|{|{zyyzywwvvvuwwz{{}{vswyxod`iry{|{ytqmlqu{~ВЙКИЕДБztw~}|{zsmmsxxxspi`UOS\bnswА}ГГБАЕШббЩСЛДГДЙЙИНЧ▒═▐у▐╨┤ЫМЙИЙПХи┬▄чч▌╟кТЛЙИЕБА~ЙФУКАДЗЦШОАzВААЗОХЩ╞                                                                                                                                                                                                                                                                                                                                                                                                                      █npnmonjljfikhnsontsknyvopsspwБЖЛКДxpxЗСДwАЛУЧШУЕВИФЪвк░╜╞╠╬╨╘╪рхчъьяяэьшт┌╨╟╜┤омо▓│╡╡пгЧХУФКДЕЛОЗЙНПНММИБ}БКМПЗ}||ГЗКА}АДЕЗГДББВВАzsu~ДМЗЖДЕЗЙГvw|ВИЖ|АГВ{ffu~}shfgnuyxsmd]U\nyxusnfUQ`fbckuwroie`ZZcibW[hl_\iuvnooswz|~АА~}~}zz{}{zxuvzxtqj`]gquvutvv{}|{zvwyywuwwtrruxy{{}zsquxumfbhsw|}АА|zyxtpqptx}БЕЙЙЗЕБztpx~А|~|wsnpwxxuof\SNV^gpuuz|ГГААИЩпозЪРЖГДИИЙМУк╞▌ху╒╜аОЙЖИЛСг╝╓цш▀╦▒ЦЛИИИДБЖФШМzБВСЩУВyВГ|БЛХЩа                                                                                                                                                                                                                                                                                                                                                                                                                      ┬hlmmpminnoslhlqnnqpnsxqhmvtrx}yvzГЖАwtЛОГ|ДОХЪШК{БНЧак▒╢┴╚═╩╩╬╤▄уччъююююышт╪╥┼║░ммом░пмЭТСОНИГВДМККМПРПРКДАБИКМИБxyАЖИА~АВЗКДВББГВБГ}ps}БИИЗЕЕЕЗЗtv{ГЙЗА~БДДyfes{А~vhedlswwrkc\V]mwyusqmbQQbe_ajt|tokfa[^ef_Y]km[Zjwwqopruz||}||}}|{|y|{{{y||vupj\Xepvxxwy||~|}~}{zxyywtssrpllimtz{{xnmsxxocbjrw|АА}{{{zxtmjpvzАГЙИЖЕГ|urvyААА}xrmqwyzvqhZSQZ`mvyxvxzГГБЙШн╖│зШЛЕДЙЗЙМПв└┘цф╪├йТЛЖЖЙСЮ╡╥тшс╨╢ЦЛИЕЕДА|ЕХЩО{БГЛФТЕx|АБАИУЦЦ                                                                                                                                                                                                                                                                                                                                                                                                                      Юnommommokhkhiproqvplsvqmosrsxxssw~АztvБОМББЙСЦЧУЗАЙУЭжо│║├┼├╕╕╝─┌чшхчъэьюьычс╓╔┐▓йеежжжгЯХОННКИЖГЕЙЙИММООМЖАДЙЛКЕ|y~ДЕВ}}ВДЕВВВВГБББ~wv|ГИЗЕЕЕЕЗЗstzБКМГБВВВzidryАyjd^hsxusjaZV^luzxrnk_PVbcZ[fuxvpkf`Y^flaZ`hj]]lwwrqpsvz{z|}~АА}z{||{zyyxtodWWdmuxzw|{wz|БА}{xvvutrnlhgdbfksy|{vmjpwvnkhkux|АА}|{zxupkpsw}БИКЗГБ|upqx|БВАytmouyxuof\TU`frz|zvuyГДГЙШн╣╝┤гРЕВЕЕЗКСЬ╕╓цц▐╩▒ХЛЗЗИПЩ░╠рчф╒╛ЮПКЙИЕВ~ГРЦК|ААЗХЦИx|БА~ЖСХЧ∙                                                                                                                                                                                                                                                                                                                                                                                                                     ВhjlmplmqonoljnomqrmivyqintrsxxqnzЗВvswДОЛ}БМСЦШП~БМЧдл│╣╛└╝│ид│╘цъф╫╪тцщыыьыч▌╤╞╕нжвЭЭЭЬЭЫНЖЙКЗ~zВИИИКМПСПК}ГЙЛЙЕ|{~ВЙЖА}ГЗЗГДДДДВГВywГЗИЕГЕЖЗЗuszАИМКВВВАzmlqy~xka\fpvvqkaXT_mrxytoi[OYdcWVdtyxvmd]U_hg]Ybli[`ny|uqtxyz{{}}}}~~}|{}~|zwyyyujbZYejrxvpminu{АА{wvvtspieca^adjtz|{ulkox{vqonsx|А~|{zzvurppqvxАЕЗЖЕГ}vpmryБ~ytonsyywqg^V[elu{~{wuvДЕВКУй┐─╜оЪНЕЗГЕКПЩ╡╙хшт╥╝ЫНЙЙКНХз╞▄чх┌╞дСЙЖЕЕВ}БЗМЙ}ААГСЦЙy}ГВ}ГНУФъ                                                                                                                                                                                                                                                                                                                                                                                                                     uoolmohoohhieironqrmisvqnpqls{vpuДzxy}ЖЛЗБИПФЦУЕ{ЗХЮио╡╕╗╢ндЫЪ╩эўёс╦╨┘▐учъыыщу╪╩╝▒жЮЪШШЫЫЪХНМЗАtn|ИЖДЗММРОЙА~АЗОЛИ{}БЗИВ}|ВЕЕДЕЖЖДГЕЕГАДЕЗИЗЖЖЖЖГyw{АЙПЛВГВАzqjryАyn_Vbqxvrl_US_lqwwspi]SZcaTUdty|wocZV`ff][bjg[^mwxwsqtwz||}}АБАВ}{~{yzwvqjb[aeiputicbfr{А~{urqnkdcdeecekpu}{xmmtxywvrsux|А~{zyzzzwuqqsv{ЕИЗИДysnmu}А}||uomrxxvqg^W`jqy~Б}vrvzГЗЕЙРб╜╚─╡вТИЙЗИКСЦ▒╧тъх╪├дТКИЙЛОв╛╒фш▀╦░ЦКИЖЕД~АВЖДАБГЖНПИ~ГВББКТФ═                                                                                                                                                                                                                                                                                                                                                                                                                     hjnmlnhoolpqkkpmmpqkivwmjppov|vorГМ||БЖЛМЖАКТТСКЕБПЪдп┤╣║┤лаЧЦд▌Ї∙їс╜┐╦╙┌рфщщщц▀╘╞╖обЪЧХЩЪЬСЙЗДyhfvГЗЗЙЛОССНГ}}ГИЙЖБzАЖЗД~~ВЕДГГЖЖЕЕЗДГАБЕЗЗИИЗЖЖЙЙ|uzАИППЗДБ~zrqx|А~q_U^pzxto^VT]gkqxsph^V\b]VXfu{{xodYUagdXZfldW`nwxwtsvwwz|}}ААААА}АА|||zxukdchikpspeb]it~А~{volkgbdfijilquxy|{ytqtxzwБyvwy}А|{yyzyzzwsqpryВИЙЕГАzurnou|~~|wqlpxyxrj`]fnu|ГБ|yux|АЕДИНЮ╝╔╚╝лХЙЕЙЛНПФн╦ршш▐╦░ЧОММКПЫ╢╤ущт╬┤ШМИЖЖДБ}~ГДГДЙСМА}{}ЗРХл                                                                                                                                                                                                                                                                                                                                                                                                                    №nonllniolfghcnqmnpphitroosppxxrnxЗМ{БЙПНИГГНХЧФД{ЕЦЭдм│╕▒йЩФЧЪ░█√■°▐о▒╗┼╧╫▐тхцхс╪╨└╢жЬЩЦЧЪЫУОЙp^\pАГГЕЖКОПНЖ}|ВЗМЛД|БЕЛЗ~АГДГГДЕГЕИЖГВБДЕИМКЕГГГЖВ}{БЗМФРЕБАytw}Аt^P\oxywm^UU\dgnswph[T\c[RWgsyymd\[bd_Z]gjeYbpy|ytqtvxy{}|ААБАБББ}z{zzvrlhkhmpuuhcboyБАА|xojhbdadjnqrvvwxz{{zwtuwwrrsy~ВА{zzzyzzyuqqpwАЗЗЕГ{vsnnqx~~zrmqvxxsme_nuxАДГzxxzВДЖЙМЩ║╠═─▓аНЙЛМООУе─▌щыф╥╣ЬНЙЙКНЧо╦рщх╙╣ЮПЙЙКЖВ}|~АББГМПЕ{}~{{ВМУХ                                                                                                                                                                                                                                                                                                                                                                                                                    їcikjmmhmlkmpkmlinpohkxskkrqqz{rq{ЗИБЖОФОДДДПЧЧР}~ОШЯзм┤╢дЦРХЭЯ┤▐√■·█вжн╢└╦╘▄сфус▌╫╔║мЯЩФФФЧФТЙ|lZZh|ЕЖЕЗМПРОЙБ{~ДЙИЕБz}ГКЖА~ВГЕЕЗЗЖВДЕДГГГДЕЖЙЙГГГДЖВ~АЕИЛОЗ||АВВyszВГx`R]q}{tl]UT[`cksrph\U]`ZV[gqx}zpe^[bb\W_hibZgs|~zvtuwzzz|||}}~~АААБА}{|{}yxsomjmpsqljls{ААА|unjihhflpstswvxyz|}xuuwwmceirzА~{{{ywyzzxtqrxИКЗДА}wtokoux|{yrmnuyxtnfcy}БЕЖГ{yzzАДИЗЛЧ╢╩╨╩╝зХМККНОТд┐╪шьш┘├еРКЖЙЛУж┬█шх╒╝бНЙИИГА|{{zАГЗОНЕ}}~zzАИПУ¤                                                                                                                                                                                                                                                                                                                                                                                                                   шkolkknkoljiheknjnonhnspoqtnp{|nn}ИГЛФХНГИТЧЧО|ЕСХЭзоожТПУХЪг╗▀¤ √┘Ьбдл╡└╦╙┘▄▀р▌┌╧├░жЭШЧЦШФФК~q[]gzДЖДБЙМПОКД{|ЛЛЗВ{{ВЗЖВ~ВДЖЕЖДВЕЗЖЖЖЖЕИЗЙЙЖДВГЙЙВАВДЗД{uv|ГЕysv}БВ{`Q]mwwtl`UU\bbgrvrj`X^aYQYgpwzyrha_db]]ehg`^ity}}xrtuxz{{||~АБАБААВБ|{|{z{{xomlptwolpw|БА|ujhiiknquwwwyyyxy|~|xuwvpjcaekry{|{{ywxzyzxvrw~ЖИЖДБ~yvsllow{{xuonsyxsmhevАДДДГБА{uxАГЕЖЙФ░╚╬╧├нЩМИНСХЧг╝╘шэъ▐╩оХЛЖЗЙТа╝╓фф╫┴жСКЖЖДБ~z|~{y~~БЛЦЛ||~{y~ИПРё                                                                                                                                                                                                                                                                                                                                                                                                                   ╤cilkmmlnmlpoknjhopkhpvqmnpkq~zpr|ДЕЙПФУИzДМФШТЗyНЦЧЯжзвЩСТФШЬж╗▀¤ √╪ЩЯЯен╢┐╟╥╘┘┘▄▄╓╦╣квЪЦТФЦЦОГvbbizЕЙЗГИЛРПНИy|~ЕИИГ{|ГЗИДВБДЕЙЗЗЖВДЗИЖЖЗЕЖДЗККЗГВЗЛЗДЖЖКД{ssАИЙztw|АД}cT^mwzwmaXW\`afnrrk`^b_WV[ciqx~wogdee][dliaenuz{~zutuy{|{{||}~~А~АББА~{|}|{uonnsvtqsw|~Б{tnlmopquvxvuyxwwz|А{wvxwrg]`lruxy}{{zxyy|{z{wwЙЙЙДА{yuokhs|zytontzywojgmty|АВБ}yuzБВДЖУл┼╘╥╟╡аРНУЩЭак╗╥хяэф╤╖ЫРККЛПЫ│═▐т╫┼йСЙЖЕГБА{{zzyАВВЙХС|z{zzzДОП█                                                                                                                                                                                                                                                                                                                                                                                                                   ║mpmmmnlolhhfellkoqmjpqlnurkr{ymoАЗИМРТПГyДПХФОГЕПЩавваЪОИТЦЩЬз╗▌■ √╫ЬЫЯдзп╡╗┼╚╧╨╙┘╫╨┐▒еЬЪХУЦЪТЗ|hgl~ЙНИЕКОМЛИ~ЖКЙД{|ВЗЖЕГГГЖЖДЗЕЕЗИИЙЙЕЗЕЗЙЗЕВГЙЛДВГДЙЙznr~ДИ}sv|АЕГeV^luxuoaXX^`^^nutmc_b`WS[eimuzwskieecbfljimsxz{|yuuuy{{{|||~~АААББА}{{}~}zywsqouxrorvz|ААzunnpstuvwxwwyxwwz|А}xvxvqi^_luwy{}zyyyxxyyyzzzzДЙЙЕА|{{wsnkoxyyvqlt|zsmliijqyАДГБ}yxz~БДЕТж└╥╫╠║зФУЫй▓╢╗┼╘фюЁш╫╜бНЗЕИМЦй┬╒▌╪╞нФКИЙЕГ{yxyx|~АКЦХБ|~|zzАКН┤                                                                                                                                                                                                                                                                                                                                                                                                                   Шekjnpnlommpmknhiptmjqsoprnjr|wpt}ЕЙПСПК~ЙРФСКГФЪаегЩЛЙНУЧЪЮи╗▌■ √╫вввжйо▓╖╗┐┼╔═╥╓╓╞╣лЬЩУФФЧХОАqmoКОЛААИМОМКВ~yВКЛЕ{{}ДИЗЕГДЕЙЙЖЖЕЕЗИЕЕЖВГВЖЛЙЕВГЖНКЕДЕЗЗwmp{АВ~xvzАДЕi\alwyuod\[]_][hsvndab_WU]b`eryztmgd`]^fnmorvx|}В|vuw{}{|{}}}|~}ААВВ{~АББ}{xvqpsywqruy|АБА{wpnrxyvwwxvuvvuuy|~}zyyzvi`ahswyy~}yutyzxxxwyy{{~ЕККЕА|yywuninsyzxrmsyzvpokjinzДЗДБ|{vyАБГЕСб╛╤╫╤├░ЪЩз╗─╩╚╦╓фюЁщ▄┼иСЙЖДКУа╣═╪╪╔пЧМЖЖДДА}zx}z~АЙШЪВ|ББxЖЛП                                                                                                                                                                                                                                                                                                                                                                                                                   Еmnjlmlnomljbfnjjormnqomrvnit|vnvБДКУРОЖ{АЛТФМЕБЙШЫЮаЭПДОУХШЪЯе╢р■ ·╪ойп│┤│╡╡╢╡╣╜╞╠╤╒╩╜лЮЩЦЧЦШЧПЕyyvДЛНИГВЕКМЛЛГБ|ВИЛК~~}ГИЙЕВГВЖИЗЗЕДДИИЗЗЖЖВЕЛНЙГЖЕЙЗЕЕЕДБvknwАЕАxv{БЕЖkddju{wrh^[_^XXertqifd^VT\`^_mz|vlg_\]`jnopsvw||}}yvv{~|~~АААААБВАВБА|{}БА}{{wsrsxwssuw{~ГВ|wrruwvvxyxvwwxxwz}~}zzyytk`^irwy|~{ztptwxwuvwy{{~ДЙЙЕБ|{zyxslhpw{xqjqxxtromkkpzИКЕБА|xzБВЖПЬ╕╤┘╒╔╕гг┤╔╪┘╓╘╫уюЁь▀╩кХЛЕБЗОЧо┼╪┘╠▒ШОЙИЖЕВ}wuvsxБЙЦЪЗАВz|ЕЛЛ                                                                                                                                                                                                                                                                                                                                                                                                                   ifjlmpkjmknpjnojkopikqqqsrkkwysqxАБЙМЙБy}ЛУОЗДЕОЩЬЯЭХЛЛРЦЩЫЯдз╡т¤ ·▄╝║┐┴┐╛╛╣╖┤┤╢┐╞═╨╦┬пвЧУФХХХТИ~{{ИМРМВАДКЛММЖАxЗЙЗГ~|ВЗЙИДЖГИИЙИЖЖДЖЖЕЗИЖВЖЛНЙДЗИНКЖЕЕГxnkw}ВДztwАГГqfdjqxxtk`\^]YWfvxqjfa]WZ^][[jwzukf\YY_knruuvw{{|{yuvy~Б}}~ААААБВБВГГА|{|БААА}yvxxwpptwy|ГГzvuvzyxzyzxwyyxxz~{zy{vlbbiqux|{ysqnrwwuuvyz|ДЙКЖГ{zxwuoijt|zskqxywspllorzГЙЙГ~{wx~БВЕПЫ╢═██╨┐мк╝╨су▐╪╪ръЁэф╬░ХКДЕЙПХж┐╘┘╠╡ЪОКЗЖИГ}xutrw|ВЙУЪКВААzu{ЕИЙў                                                                                                                                                                                                                                                                                                                                                                                                                  onnmlojommmkdhljnrqinropvvomxysqz~|}БЖД|s}ЛХРВЗУЪЮЯЧМГМЧЪЫЬдз▒╝р√■∙с╩╩╨╤╤═╚├║▓░п┤╗┼╦╩─╡зЪЦЦХХЦХЛА}}КННЙЕА~ЖЙМЛКГ{~ДККЖГ|~ГЗЗГГБДЙКИЕЖЕЗЗЖЖЗДГЕЛМЗАВЕКНКЗДБ|xpqwВВ}ww|Бukehqzzyoe_]\WSftysmi`ZSW]^ZWiwzukd[WZcnrxwvvwy{||ytuz|А~~АВЕДГДДБ{z|}}Б~~}zzxxtuwxzАДВ}{vvwyxwyyzxxy{zxy~||zxvn^`iptx{|ytonnpyyvuyzz}ДЙКЗД{{zzwrmipz|uorxwwtrprstxГЙЙЗГ~xy~ВВДКХп╩█▐╘╞┤░┐╘фчх▄┘▐цЁюх╥╡ЩЛЕЖЙНТЭ╢╧╓╬╕аУККЗЖГxroqw|БДНЪОБxzБЕИт                                                                                                                                                                                                                                                                                                                                                                                                                 №ggjjlnilkknpjmnfkrpglrqtwvhmywqu}|uwАДАvo{ЛТК}АЛХЩЮЫПЗИФЪЮбзкп╛├▄ї№Ўу┌█▄▐▐▄╫╧┼╗▓п▒╢┐┼╚┬║мЫЦФУОММЛДАВКПТОИДБЕИМОНДx}ВЗИКД}~ГИКИЗГЖКЛКЗЗГДДДИИДВЕКМЗАВЕКЛЛКИГ}zpmwГЗ~vu{ВВzlghqyzyqg]]XSPfu{uni`ZW[^\WXhx{xkcXX[eotwuwxz{|~zuwz~А~|||}|АБДГДЖЖГ}|{АББДАА}}}yxqsvxДИГ~zxyy|zxwwxuwwwuuwz}{z{zxmbajrwwy||ytojlovxwwxxy~ГЙЛИД{yxz{xljowxvorvwwwsrtxvvzЕЗЖГ}yz}ВГГЙУй├╫▀┘╠║▓└╒чышс┌█уьюц╫╜аПЛКЛОСЫ▒═╪╤╜дТИКЛИДБzqoqwzАВКЪСГ}~zw{ВДЖ─                                                                                                                                                                                                                                                                                                                                                                                                                 їnnmkklhomkihbkkhlsphprnsyxlnxupqxxuu|А|ww~ОТЕ|ГНЦЫЮХЙЗОШЫдим│╖┴─╙чюючхцчшчхр┘╬┴┤оло╢║└┬╝нЬШХЦРИЖЗЙДВЛРСМЛВ}ВИЛНПИ|{ЖЙИД~БГЖИЗЕГИККЖЗЙЖЖЖЖЗИЗДЕЙМЗААИННЗЕВ}}upu~БЕxu{А~|nghpyz{th`]WQQcv~wng_XVW\[W[ky{vke`[_hpwywwxzz{А{tt{|~||~}ББЕГГЖЕГ{|{|}}ВДВААА}wwx~ЕЕБА{yzz{zxwxwuxvwrrtw~}|z{|wm^bjswyz{|zuqlmprvwvxxv|ВИКЙЕБ~{yy{zrlotuspqtxyvrswyywyЕЖЖБ|z~АБВЗТг╗╤▀▄╨╛┤┬╘хыъу▌┘сыющ█─иУКИМНРШо╞╫╙├кФККОНЗБysqoty~АИЧСГ{~|uvАГЖЫ                                                                                                                                                                                                                                                                                                                                                                                                                 шgghhnminmlmmjrkgnspfmopuxuhryuqt|uoyЕГ|xzГОПГ~ЗПЧЭЬМАЗХЮел│╣┐┬├╩╥▐чщщъыьюэъцр╪╦╛▓мл▒│╣╜║оШТСПКЕДЖЙЖЖКПУПОД}АДЛМОЗА|~ГИЙДББВЖЗЖЖЖКЛМЖЗЗЕЖЖЗЗИЖВДЕЛИБ}АДИЛЙИДzuu}ГЗАyv{А|qiflz}wla]WPRew|wqh]VTZ]WQ[kw~wmkfggjquwuxzy|АБ|vtz}Б~}|}}|ДВГЕЕЖ|}АБАЕЕД}АБ~wwz|xw~БА|{{{zxwxwussspopst{|}~ui`akuwwz{zyvsoonqttvxzxzАЗЛЙЖВА{wy{ytqpqstnlqwywtsv|}yy{ГЕЖА|z|БИОЪ│╧▌▌╘┼╗┼╘цюьц▀┌▐ъюыр╠пЦООРРСЦз┬╘╘╞░ЦЛЙНРЛГ{tooqv~АБНПГzxzxxyБДЖ                                                                                                                                                                                                                                                                                                                                                                                                                 ╨jkkimmknmlkhekiioumjpnktwtnwzurswqpБДБВЖЙОКДГКСЫЪШЙВНЭдж▒╕╜┬╟╟╔╧┘счыьэяяЁяыч▀╘┼╖окмм│┤│мЪРОРПИЗИКДЕЗНООЛЕБГЛНТКВ}~ВЗКЕВБАГЗЗГЕЖЗИЖЖЙЗЖГЕЖНЛЕГЕЗЖВ}|БГИККГАВspxАЗГxs{ААuedkv||wnf]XSVdt|yvk\TSWYWU]jv{wqnlmmpttvvyzz{{~zvuz}~~~АА~ББГГГДЕГ{{{}АДЕЖГББДДwpnkjoА{yzxzwvvuqmlkjgcfow}|{zysk`bltwyyzyxwvrsppqruwwvzБИЛКИГА{wyyyusrqrtqlpxzwsrvzzyyГЗЕБ||{ББДЙОФе╟█▀╫═├┼╥фюящс█▌шюэф╨┤ЪОЛРТТУа╗╨╒╩│ЪПЛОТОЖ|vomouyz~КОЗ}|zwv|АЕИ¤                                                                                                                                                                                                                                                                                                                                                                                                                ╢cghknmjmllonjpihnpjfnjluwpjwztswynsГИДВИОУТЙДПФЧШРЕЗСЮл▒╕╝┴┼─╟╞╚╘▌цыыыяЁёёюъх▄╧├╕омйллкгЪТИЙЛКД~ВДДЖКНПСЛВВГЙМОЙД|y~ДЗЕГББЕИЙЗЗЙКЛЗДИЙЗВДДИЖГГЖИЙВ{|БЕИЕ|{ГАwntГywzАБВyhcit~~ypf\UPUesyzwj[UU[[SR]iryxroqonosuwwy{{{~АВxty|~~}}~~БДГГЕЕГ~{|~АБДЕЕДГВА~wndckuАА{{{zyusrqjd_]^]]afuzzz{|unhhntwyzyywvuvtqpnqwvxxyЖЛМКЖАzwywwtsnnnppmrxzyvtwy||yw}КЙБ|{zГДЗКНФи└┘▀▄╥┼┼╤фюЁэф▄▄хюэц╘║бООРУТСЮ│╟╨╠╖ЪНИПХТИ|vqoot||{ИРЖzxzysw~ВЖЇ                                                                                                                                                                                                                                                                                                                                                                                                                ЩhjjlmkiljllhgkhinmikrmmrspnxxqrtrjtЗЙВГОХУОЕАЙФЧЪТЗГИЧбмп╖╝└└╗╝│╜╪щыыщъьяЁЁяющт╒╦╛▒кгбаваЬФМКККЖ~zАГЕЗЙМОНИ~ИМСЛЗБ}~ГИЗГАБДЗИДЕЖЗКЙЖИЙЙЗИИМЙЗДГЖКДyzАВ}zuu}ГВ{ot}ГВ{xzАВД|lefsБzqg]QLTdpy{wj[TSWWTT\fovyuqrurptwxwz|z{zБГ}uuz|АВАБА}~АВВГДЕВ}{||АГЕЕДДГБАxlegoxВА|zxuvqkhhgdcdcbegity}|zyvrnpsvxyzy|ywuvwtroprvxxzАЕЛНКДА|zyxwvunjjlkhoxzxwuvy|}zxzЙКВ}zzДЗЙКПЯ║╓▀▀╒╩╞╬▀ьёюч▄▄уьющ┌┐дПРХШФУЩк├╨╦╢ЭНЕОЦХМxqonqwz{ГЙВ|{z|xvzВс                                                                                                                                                                                                                                                                                                                                                                                                                В_ehjnlilhjmllnfglnjlokpvumlwwqrxriwИКЗЙХЭЧМГДЛХЧЩЙДДОЫз▒┤╗║╛╕нбб┐цЄьщурхшыяяюэш▀╘╞╣пвЮЪЪЭЭШКЙКЕynvВДГЗЛНСОЛВ~ДЛОКЙВ}БЕКДВВГЗКЗЗЙККИЙЙИЗДЖДИЗЖДВЕКЖxzКП|rtyВД{ip|БГА|yВГ~oeco{yrh\TKQanw|xm^RU\ZPS]eluxuroqqrsuuu{{{y|АГБyvyББА~~~ББВВЕГ}y|АББДЕЕВГГБАzrjmt{}ББ|{wwsiebcddefhijkpu{||yxwxwywwxyzxzzwuswvsonoovxy~ЕЛМЗГyxxxxvupkhhhiotwwwtwz}}yvzЖИА}zzБИКЛПЬ╡╨ст┌╨╟╧█чююш▌█рыяы▌├кЧЦЭЯЫШЬг╗╔╩╗аРДМЧЩОБzrqprvy{ЕА{xzysuzАВ┼                                                                                                                                                                                                                                                                                                                                                                                                                kdfhjmkknmmlffifjnnioojnrqmqwtquxoi{ИЗЖНЩЮЪЕВИРШШУВАЙФвйп┤╕╖▓дЪвн╨°¤ўх▄╪▐ушщыююыф┌╬└▓дЬШШЩЫЫНЙЕ{mcpВЖВБЗЛПОЛГВИОЛКГ}|~ЕИЗДГДЖИГДЖЙЙЗИИЙЗЗИДЗЖГВВЗМНsvГА|ssyВД|kq~ДЖВ{x|АА{sgbkz}xqfYSNS_jw{{m^UTYWUY^agryxrqsrutvvx|{|y{~Аzwv}ББВББББВДДББВГБ~|z{}АВГВВГВГБ}zwwz||АА{zvtlcbbcgjkptrstty|~|xvw|~|xxz{yx||yvsuwuqnjjrwy~ДКМЗГyxwyzwxspkfeejsyyxtwz}~zxzДЛИБ|zБЙКООЦ▒╠▐у▀╙╦╦╫цэюш▀┌▐шэь▐╞пЫЫйплбаг╢─╞╗гУКЛШЬТГ{tpmowzzyБД|xy}xsw}Бб                                                                                                                                                                                                                                                                                                                                                                                                                d[bfimkklkmnlnldjnmhijfnwsimurqwxqo{ИЗКСЩЮУБГМУЧЧЛ|БЛШдоп╡┤лаШЬй╖█¤■їт╤╟╥█рфчъььъф╫╔╣лЯЩЧЦЦХРМ~sd^l~ЕГГЕКУПЛГ~АДЛККД~}|ЗИИДГЖЗМЙЗИЗЙЗЙЗИДГГВЕИЕВГЗМПtvДВxmqyДЖnuВЕЖГzu{АБujciy}yrhVPKS]hs|xm`YZ\UPW^`blzyqopruvvwyz}~{}АЕВ|xvББАБББВГГББГЕГБ}}АББББВБАА~~}z{|ВБ{xuphggghkqtttuwvy{|~{zusty|АГАywz|ytswwutqmlnu|ВКОМД~wtxwxxxuqlhegiryzwtvy|}{y{ИМЖ~}ЖОТСТЧн╟▄фр╪╩╦╒уэяър█▌хэьт╦┤гд╡╛╗░кз┤├╔╛зХКНЩЭХДurnpvxzv~ГАywxssvyАЗ                                                                                                                                                                                                                                                                                                                                                                                                               №e^cfikiklkmmhihdlpmimminsqlpuopwvjjЗКТЦХЩМ{АМЦЧУИБЙТЪим▒░иЪЦШак╝т ■Ўс├╕─╧╒█▀учъъц▌╨└одЩШЧЦЧФПДue[jzВВБДЗМНМДВЛМРЙВ~ЖЙКЖГДЕИЖЖЗИЖЕЙЗИЗЖДДГЖЕГДЗКНwxБxlkyВЖБyzБЕЗГ{u{ББwjbfx{|vjYNNU]fq{znc[WVTQYZ[\hzyspprvvzxzz|}|~~АА|wu~АБДЕДДГДГБВБВВБ||||~}АБВЕДЕГББА|{}|zuqnhhlmnrwxuvyyxz{|}{ytsjcgoy}~{x{|zxvxywvuqnnpv|ВКННЗ~wrqwxwxusngefipuzwrsx|{{ywКМЙВ|АЗУЬЮЦШм─█цф█╬╩╤рьяыу▄▌фьэф╤╝кп└╔╟║▒лп┐╔┬нЦМНЩЯЧЕАsomorwxtВИАywzxttx~Б                                                                                                                                                                                                                                                                                                                                                                                                               ї_[bfhlikkijllupioplhlhhosnikqnqwvlp}ДКСЦЦХДxГПЦЧР~НЦвйониаШХЫдл║у  Ў▀╗ж▓┐╚╧╒█уцщчт╒╞┤зЬЧФУЧЦУК}i]jzГЖБЕНРПЗ~ВЗЙЛЙД|{ДИИЖДГДЗЖЕЗКИЗИЖЗЖДЕЕЗЙЖГГЗЙМ|ААxqozАГАz}БДЖД|ryВxjaew~~wkYPMTZdozypf^][SKY]Z_izzrpqsutxux{z}}АА}{y~}АААВБВБАБАВВГВА|~~Б~АББГБГББББ}}}БА{vspllmptuwyyyxyyzz{}|{vrideiptupty{yvvwwywwusqnqxВКПНЗАwspsvxwuupkecenxxtppwz~}|y|ЛХТЖ~~ИЧгидбп┴╪цч▐╤═╠▄щюьч▌█тыэц╓├░▓─╧╬╟╕йп╜┼┬┤ЪМОШЮЧЗ~tolnrx|x~ЖГytxywtv~Б°                                                                                                                                                                                                                                                                                                                                                                                                              цbaegjkgllkllhlegopkkplloqmjpqmsxthqАЖЙМТТС}wДТЩФЙ}ГСЫбйлжЮЦОФЭеи╡у  ∙т│Ыз░╕└╚╥┌рфцф▌═║нЯШХФЦЧЦОЕobkzДИЕГМООИВ|АИКЛЙД~{ГИЙЖГГГЗИЖЖИЖЖЖЖИИЖЕЖЗЛЛЗЕЖЖИДГВВ}vpxАЗЖ~{АЕЖЖ|nuААxj^fw{{wkYPMRYajy}rha]ZSRZZX]iy}uqpswxxvy{z{{~~ББ|u{{АВГВДГГВВВВВВА|{{|ББББДЕЕЖГДГГБ}}}А|yurlnsuxyxy{|zxxyz{}{tpc_fmqrnjpw{}zyxxywwutmkotИНОЙАwrnqswxxxphc`gnuxwppw}А|{}ИЦШМАЗЩ▓║╡о▓┐╒хчр╓═╩╫хюэчр┌▀цыч┌┼▓╢┼╥╓═╗пн╣┼╚╖ЭНОХЭЩКВvnlnrv{x}БВ|xyxvvx~Аф                                                                                                                                                                                                                                                                                                                                                                                                              ╧ZZ`fikgkjimnmsjhmojlnhiqsngonkryuov~}АЗММЛvtДРФПЕКХЪвикЬТНПЦЮдж░р■ √фпХажо┤╜╟╨┘▀ст▀╙└▒гЩУТФЦФРЗvknzЗКИВБИМНЛЖ~}ЖКМКЗ|ВИЛЗЖЕЗЙЗЖИЙИЖЖГЖИЗЖЖИИИЕДЕИКЕВБАА}mwАДЕГААВГГ{rs{Бyk`ityzvhXNJRV^hw|tjb_\QPY[WYi{{urpsvvxuxz{{z|АГГГ~xwzААВВГАВБАВБВА||}АБВББГДДБГВББ}{А}yusptvyyyywyzzzwxy|~}zupa\cmrsrlow}|zywxwwwvvsposyДППМГyqjkpwxywog_]bmwzxqpu}А|{{|ЕФХОГКЭ╗╟─╛║└╥счф╫╩╚╥сэюыс┌▄ущч▄╚╣║┼╙╪╤┐░л▓└╔╗ЭОНОЦШОГxpnpuvxt{ГЖ|txxusv|╠                                                                                                                                                                                                                                                                                                                                                                                                              │]^cghhgljlmkhkbimnjkphkoomitnlsxrhzАА{АЙЛЕsuЕУШМ}БОЦЫаддРКРУЦЪве│▌№ №хмШвекн┤║├╠╒█▀▌╓╔╡зЫХФХЧШСИzpr|ИНИ||ДЙНЛЗ~|ВКРНКА|ВЗКИЖГДДДДЕЗЗЗЙЗЖЗЗЕЗИЛЛЖГВГДЖЕГВБВ}nwБДЗГ~БЕЗЕ~rqwzkahnxzvk[MMRUZgv}wnb]WQV\ZUZj||upqvyxzwy{{{{~АББА}xwzАБДЕДЗДДВАБВББ}|}}АБВВБДДДДЕДВБАА{|~zwutwxxyxyz{{{{z{z{}~{tn_]djswurqu|}{xwxwwxvwrpknyБМПМД|tmiluwwund[Zakw{xpotz~|{|ГРЪФЖБЙг╝╠╧╔╛┐╠▌цц█═╟╧▐ыяьф┌┘▐чч▀╩║╣┬╙█╘└░зй╗┼╗ЭОМЛРФСЕzqmnruvuyГЕ}xxywrrxм                                                                                                                                                                                                                                                                                                                                                                                                              ШU]dfhhflikmlmtiimmjllbjsrmiojjquqp~~zzДИАswЗСНВВЗОХЩааЫЙЙСШЭвзй╖▄√ ■ш▓жмонйо▓║┬╦╘┌▄╪╬╛лЮЧЧФХЦХН~ws~ЙОК~yБЙПОК~z~ЕЛЛЙВАБГЗИЖЕЕЕЖЖИЙЖЖИЗИИИЖЖДЖКЙЖДГДЙЙДГВЖ~qwАЖИЗБ~БВГАslsА{nehjtywk[NOSUWbr{zpe`YSU\]\`o}}vsrux{yx{{||{}~АБДvvy~БББВБА||АГЕВДАБЖВВББВДДВДВВБ~А||АА~zywwxzyxywzyxzz{z{~|tl\[cmrwwsuz|||xvwwxxzyuonqwАКМКЕ|uokjpvwrkcZY^guz|soty|||КЩЪЛГКв┐╙╫╧╞├╔╪фър╧╟╦┘щёюш▌╪█фчр═╝║┬╧┌╓╞▒де┤┬╣ЮПИЗУШСЕ{uompsutyГЕ{uxyuprx~Й                                                                                                                                                                                                                                                                                                                                                                                                              ДU^ceggflkmomhmejmnkmoglomhlpkmsvnmАzyz}ДЖ|uyИУР~КУЦЩЬШПДОЦЬбемо╜▄∙■¤ъ╜╕╝╜╕▒ом░╡┴╔╥╪╓╨┼╡жЩШХХХУОВ{БЛРК}}~ЕЛЛКБ{{ДМОПГБВДЗИЗЕЕДДИИЙИИИЖЖЙКЗЗЗЙЛЙЖДДЕЗБzz}В}y{ГЗИГВДДГАtjp}В~ofabqzxn\PPSQS]rzzqf^TNV\]^eszurtxzzxy|{{|}}ААА~xvy~БББВЕВБ~}БВДБВА}|}ЕГГВГДЖКДЕЕДВА~ВГВ}yzxxxxzyzxzyyyz{z{~{um\Zdnuyyuuz||yvwwwxzzwuprwКОМИvpijnrwsjaTS[drzzurv}ВГА}|}ДУШМЖМб╛╥▄╓╦┼╚╓фщу╫╦╠┘цЁёщ▀╫┌рчс╨└║┐╧┘╫╩╡гЭл╝╕аРЗДМХУЗ~unmmquvyВ{vwzxssx}                                                                                                                                                                                                                                                                                                                                                                                                              qU^cdfgfihmnnqtilomlokclrolklhnuumoВzt{ЖКЖwu~КСЛyБОХШЫЩМДЙФЪгко│╖┴█∙¤¤ш╔╔╦╦┼╝╡лл▒╣─╠╥╙╤╔╣лЫХТСРПНЕГАДКПНА}~ГИЛКВА{ВЙЛКЕГАВЕЖЗИЙЖИЙЙКИЗИЙЗИИДДВЗОМЖВВЗЗ~wx}ГГ}~АДЙЛБДЖЖГveo{Аrg_bn{}pdVPRTU\m~}sh^SKRZ^bku~А{uqtwxxvy{}{|}~АААzxz~АБААББА~ААВДГГБ}{ГДЕГГДГЖГДДДГБАВЖДГ{{xwyyzyywyyyyzzy{~~um]]gptwzuv{|АА{wwwwxzyyzwuw~ЙОМИАwplfkrspg^SNUdpyzvtx~ГЖБ~|{БОЩТЙОЮ╣╨┌┌╤╚╔╘уыц█╧╩╓фяёыс╪╓▐хт╘├║╜╦╪┌╠║дЪв╖╢бРЗГЙТФЙxqmmosvx}zxyzuorwz~·                                                                                                                                                                                                                                                                                                                                                                                                             iW^`adfgikoniikekqmlnmhpqmjmninwtlpywzАЗЙВ}ВЗПСИyЖТШШЪУВЗПЧай░╢╝┐╚╓ё∙єч╓╪┌┌╥╞╝▒мип╕─╦╠╨╩└мЬЦТТССНЗЕАЕЛМЛДzБЖКЛЖГ|ВИЛНЗЕГГДЗИЖЗГЕЙЙИЙЗИЙЙКМЙЖДЗЛНИВГЛМ}ot}ГЙГ~~ГЗКЖГДЖЖДzjmzА|rh\\ky}sj\VSSP[lz{sh]OHU_cipu~Б}ysux{zxy{{z{|}АВБ{w{ББДГБВДБААБББАА~}||ГЕЕДДЕЖИЕЖЖЕГБАВВБА{{ywyzzyxwxwwyvvv{~А}wn`ahqvwxvx{}А{wtuwxwyxxvvx|ЙННЗБysojhlpkf\QRXdq{{vutzВВБА}|ЙЩШЙМЩ┤╬▐▀╓╬╩╘уьър╙╧╘сэЁьу┘╒▄уу╪╔║╗╟╒┌═╜зЫЭ░┤бУЙГЙФФЙАwronprtx~ЖБyy}xpqsxzэ                                                                                                                                                                                                                                                                                                                                                                                                            ■hW\`cdffiimnnprhkmiinhcpqmjnkhnuqmt}rwГОКВЗРУУОГyМФШЩЧМ|ЖУЯк│╗┴╞╚═╒┌уыфстфт▄╤╞╣▓кк┤╝├╚╦╦┴▓ШФТСИЖМЛИВЖЛОРЛИБДИЛЙЕ{~ЖЛКИЖВВГЗЙИЙЗИЗЕДЗЙИЙЗЗЙИЗДЕЛПЙВГЗН~qs{АЖЖБАВЖЙЕДЕЗЗЖ~kq{Б~tj]Yfy~xm\UTSSXkz}wk]OHWcjpux{~}vqsuxzyxxzz~}}БГА}yz|ААВВБААБВВБГББ~}ГЖЖГБВГГВЕЕДГБ}АБГВБ|zz{yyywtttsttstuw{~xna_grwzyvy|}БВ{trruxxxyyyxx~КОНИБzspkilmjdVNT[eo|yttt|ВГА||ЕЧЫМНШ░╔▄р┌╥╨╓тыьу╪╬╧▄шюьу╪╘┘рф┘╩╝╕┬╤╪╨┐зЧЫи░бФКГИРУЙГ|tqorstw}ДЖ~yxwrssw{┌                                                                                                                                                                                                                                                                                                                                                                                                            ўh^a_cdaejlnnmlhekmjkmhkqnjjophourptslvЖМЙГЙЦЩФМЕЕОХШЧТЖБПШдм╖┐╞╩╔╠╨╒█сухъщшф┌╧─╣омп┤╝┬╟╚└пЭФПОИГЖЛЛВЕМООМЙ|АВЖНКЖ}~ГЛМКЙДЕДЕИЖЗЗИИЖЕЖИЗЙЙЙМЛЙДГЛРЛАГГЗzlqyАЗЖ}ВДПЙГВЖЗЗБknzА|vk\Vdv~xo`[XRPWj|Бxk]NNZfptwx}ААysuwyzzyyyx{{|~ББА}wzАБВГГДДВАБВББВАz|ДЕЖГБВЕЕЕЗИЗЕГА|АББ}zxyyyxttqpnppomorw|}xpaafnvyywz|АБВ~uqprvxxwzzyy|КПОКГ}vsnjijg^SJR]jqz}zwrqxГЕБ}|ДУЩОЛРи─┘▀▐╫╥╓сыэч█╧╩╫уьыф╪╤╘▐с█╬╗╢╝╦╓╥┴йЪЧапвУЙАГНСЛЕ|tqorruv|ЖДzwwuqqsyz├                                                                                                                                                                                                                                                                                                                                                                                                            юbW^^acbdgilonrohklhlmgglmjknlgnqoq{wkvЗПЛЕОЪЩУЙБЖФЧШХМЕЙУЪи▓║┴─╔╔╔╔╠╫▌схщыыщф╫╧├╣┤┤╢╗╝┬├╜пЪТМКЗЕДЗИГЖЙООМЙ~~ЖМЛЕ{~ГЖЙЗИВГГЕЙИЗЗИЙКККЛЗЗЕЕКМИВЕЛПЙВВГАwmnxИЙАz~ВЙКЕВГЗЗБqqz{unYSbuzzqaYVQQVjzwl^SR_lswwz~БАwqruywxyyyy|{}АББ{ww}ААБГБВВВВБВГГДДА{|ВЕГГВБГВДЕДЖДГАААГБА|xxyxwroniec`ccdipzА{nb^envyxvx{|АБyqmprvyzz{|z}ЙРРМД}wupjhfdYNJTajpx{{vrqxВБ||АКШФМПв╝╘р▀┘╘╘▀ъэш▀╨╔╧▌ъыф╫╨╨┌т▌╠╗▒╖├╥╙┬иШХЪмеЦЙАБКЦРЗ}yupprwwyАЗ}rtsropxzк                                                                                                                                                                                                                                                                                                                                                                                                            ▀aZ^^]``dginmknhekmjkmglqljnrmlopqrvnjyЗМИИРШШПЗБМШЫЩОЕБОШЮк▒╕┐┴├└┬╜╦▌щчтцъьыщу╪╧─║║╢╡╢║╣╣нЫРЛИЙКЙИЗВЕЗЛМКЗ}~ЕММИБ~АЕККЙЕГВЕЙИЗЖИЙЙЙИЛККИЗКМЗГЖМПМГГА}xtrvБЙКy{БКЙДВГЗИВkq{А{wpXRat}zrc[TPOVgzwj_OVeovyxyБАzrrv|zzyxxv{z|ББББ}vy|АГБЕЕЕЕГДБВБВГГБ{|ВДДДДДЕДЗЙЗЗДЖДБААБДБ{vvuvpkjhfdca``afnz}neafowxzwwz|АДГ|skmnrsxyyzy|ЗРТОЗАyusoic^WKIUemow||vqqs}БВБ||}ЖХХНПЪ┤═▐т▄╓╘█чэър╤╟╩┘шых╪╬╦╥▀▄═║м▒╛╧╘├мЧУШйжШЙББИФУК|vsnppvvx}Г~wwwsppvwЗ                                                                                                                                                                                                                                                                                                                                                                                                            ╬`Y]]_bbffhnnpvnilljnkegjkkorjknmmszsoyЗЛЛРХЧТЗГДТЫЬЧКГЖХЭео│╣╕║╢пби╥ъщ▐▌схъыыъу█╤╔┬╝╢┤││ожЭТЙКЙГxyЗДДЖЛППМВ}~ДМПЙ}ВЖИИДДДЗЙЙЗКМЛКЙКМЙИЕЖЛНИБЖИММЖДБ|ysqwБЙЛАx{АЙНЕВВДЕБrrzБwpVRaq}}wf\UOOTf{xn`X\kqxzzy}БАyvssxwyyxyy~}ААББАww|ААБГДДДДЕГДБЕЕДГ~|ГГГДДЕВДДДДГЖЖДВБЕЕЕ{wtspgdedddeccdhjqzskhkswwwwx{|ГД}tkkmosxyywy|ЖПСПКxtrnjc^TKMV^enx}yrqs|ДЕБ}||ГХЧПНФк╟▄с▐╓╙╫фььт╙╞─╥хьх┘╬╟═██╠║км╢╩╙┼нШТХгжШИ~}ЕУТК}xwqppstw||stssqqxyz                                                                                                                                                                                                                                                                                                                                                                                                            ╡[\_^_a`dgjonopefilkmjglmfgqvnmpmmtuhjyЖМТЦХЧСВ}ЖФЪЭФЖЖРЪЮдн│┤▓лЭЧЩ╢ф°√ч╤╙▄хшъъчс┘╥╔┴╖░нкйбЬХПЛБxrr~ГГДЗЙМЛЖ~|ГКОЛГААГЙЛЛЗГГДЙКЙЙКИИИКНМИЖЗЙОЛЖИККЙЖВА~{vrvБЕИБxwЖЛЗВВЖЗВxuy}wnUT`p~xg_UMLTfz~xpe[cpuwyyy}АГ{usvyxyy{{w}z}|АААyy|БВБДЗЗЖЖЖГГБГГВБ|}АГГДЕДЖЕЖДЗЗДЕЕЕБАДЖГztoliedefhhknonnnpy}vqnorvxuwwz{ВВАwnljmrvxyyz}ДМСРКБxuuqmg^SKMZ`gkxВБ|urrzЖЗДА~}АТЯЦМСв┴┘ус┘╙╒▀ыыу╓╚─╧тъш█╩─╚╓┘╧╗иж▒┼╤─оЩПРЭаШИ~|АОФК~xtqpoqutvz{ttuurqvyz■                                                                                                                                                                                                                                                                                                                                                                                                           ЫZ[^^_a`fegkopvkmljjnldhhfjrtlmpnlvxnlyГЗПЧУУЙ}КЧЮЮОБЖФЭвйо┤▒вЦСЧд┬ю ¤ч╟├╥┌рфхцф▀┌╨╔╜▓йгЮЫЭТЗВwm`jzДГГЖЙЛЛЙВ}~ЖМКЕ~|ВИЛКИГВЕЗЛЙЛММЛЙЗММИЕЗЛНЙДДЕИКЗБА{xuwЕЙВyyЙПКБВЖИДztw~wkWS]m|Аyj`VNLTew~yunkkuxyzyz~АБ{xuuxxz{}}z~ААВВАwx}БААГЕЕДДДГГДДДДБ||ЕЕДЕДЕДЕДЕДГЖЖЖГГЗДГyrnkidgfilpqsusrsty~}zxvuxxxwuvxy|АГzsmkmmsvxyz|ГМРРМВ{tusnh_SMT]cgkvББ|tqqvИМЕБ||~ЛЦФМПЯ╗╫фу▄╓╘▄шьх╪╚├╩▐щч▌═─┼╤┘╧╛нжм└╠├▒ШОКШаЧЗ|КПКАzwrpmqrruvvqssrrqvx{ў                                                                                                                                                                                                                                                                                                                                                                                                           ЕY\^Z[_bffilllmfjljkmihplditulopopuseixГВГНРРВx~КЪЬЧКДЛЩгдй░оеУОРЫз┼Ї ■ф└╕╞╬╒┘▄▀сс▄╫╬└┤жЮЪШЪЧРЖwh^dzЕГВГДКМЛВ{}ДМЛЗБВЕЛЛИЖГЖИЙЖЖЙЛЙЗЗЛЛИЖЖКРНЗЖГГЗКЙГАА{tv~ДКДvsАЙОЛГБЕЖВ}yyy|wj[X_kzАzmbTJLTds|{xplrwyzzzz}АГwuwzxz||{{}|АВГyx{АББЖЖЕЕЕЖДЕГДДГА{~ЕЖЕЕДЕЕЗЕЕЖДЖЖЖГВЕЕГxsponinsutuwvvtrsuzБ~{wtu}А|ywwwz|АБ}ztollkoswww{ВЛРРМГzvurne\QLR^fhitГД|tpptЖТОД~|ЗОККНЧ▓╘фц▀╪╘┘хщч█╦┬╟┌чш▐╤─└╬╓╧┐обд╕╟┬▓ЫПЖРЭШЙБ{}КУНБ{trnnqvuvyzurrtrpuxzъ                                                                                                                                                                                                                                                                                                                                                                                                           uXY[[]adgegjkorhmmjkmhhjgdjwviopmmtofmv~ВКК}t}ЛЩЫФИЖТбзйммзЭТРФаи─Є ■у╝й╡└╚╠╧╓┌▐▌▄╓╚╣лЮЩХЦХУЛ|l\euГЗДГГЛММЕ{|ВЙКЙГ|~ГЙЛЙЖДЖИЙИЗКЛЛЗЖКОКИЖЕЛЙЗЖГГИНИБАВД{ДЗЕzr{КОЙББЕЖДАyx{|wk\X_k|ГznbRLMT`mz|ysrx{~|{zz|~А~{vuxxz{{{{~АБББДЕВzy|ААЕЕЕДДЖЕЖГЕДДГ~АВДЕЕЖГДВЕЕЕЕВЕЕЗЕЕЗЖЕztpoonttuuwxxxttsu{~А{vrprzywwttwy}А|yuqokjnpwyx{БИНПКД{utsne[ONT^hkmuАЕvqmsЗРНЗБ}~ЖЙЗЛФм╨фшф█╙╒тщц█═╛┬╙тчт╙┼╛╚╘╤├░аЬ░╛╛▓ЬПЖЛФФНГ|}ЙФРД|wsoorvvrvywwvtqpuxz╓                                                                                                                                                                                                                                                                                                                                                                                                           nY\\Y\^bggkllkjbilklnhkngdkwumqolqwnbnz}yuГЙЗys~ЛШЧНДЗЩгиймдЮУЛУЧги┴Ё ¤р╢гн┤╖┐┬╦╤┘▐▀┌╦╛паЩХЧХЦМБs_ctБЖДБГИММЖ~|}ЙЛНЕГНЛЛИЖЗЗЗДЕИЛЛЗЗКНКИИКСПЙЖДЖЙН}w|БГААБДИЗ{t}ЖОМГГДДБytx}ym`\_jzБzpbSHJT_gs{zssx|}}|yz|ББ{xxyyzz{{z}}~ББДЕВ|z{ББЕЕЗЕЕЕДДБДДДГА~ЕДЗЗЕЕЕИЗИИЕЗЖЗЕДЕГГ{vqqsvyyyyxzzywwtuy{{uqnoqsrrrtyyА{uuqnijmrwx{БИОРНЕ{wtqlbWPNWbikluАГ}vqorАОСИААzzБГЙОй╩сшц▌╒╙▄фу┌╩║╕╩▌цт╓─╗┬═╧╞▓ЮЪз╗┐╡бСИЗУЧОЕ}|ЙСОД|vroosuusz~yvvvrquy|┐                                                                                                                                                                                                                                                                                                                                                                                                          ■kY[ZZ]a`dfijkooimliknijjeckvpjomlouojqz{wuДЙГxuКСОИДПЫжллкЮТНПЩЬжз┼Є ¤с┤Ьбзк▓╡┐╔╘▌ср╥├┤вШФФЦФПЕvcfrГКЖААЙМПЙВ~|ДКНД~ААИККЖЖЗЗЙИЗИЛЙЗЗЛОИЖЖЕЛПЛЕЖЙОМxv|ВЙЖГГГЗИrzЕИЗГБВДГАzw{}ypc]_lzАzqdTLLSWbqzztsx~АА|z{|}АА{ttwxz{|{||АААГДДБ||z}АБГДЕДДЕЕЕГДЕДГАБВЕЕЖЕДДГДДЗИЖИЖЗЖЖЖЗЗ|ywuxxzyzxxzzzyywvw}Г{vrqssohhknsw~{vvwvskhhmrx}БЙОУПИ~vtri_RNOZfmnorВ~wrntzЖОЛГ~}z|~БЕМв┬▄чш▀╓╨╘█▌╘┼▒▒┐╓тт╓┼╗╜╦╧┼▒ЫЧа▓╜╕дТКДСЪУЖ~}ГНМЕ}xvqpssrorzzurtrrrw}Ь                                                                                                                                                                                                                                                                                                                                                                                                          °kZ^\Z[_`dfikmnidklilkgiofdlqmknlmsuljw{w{ЗИВ||ВПЧМЕЕТЭзйзвУЛРУШЫжл╚Ї ¤с╢дЮважл╢┴╧┌▀▐╫╔╡дЪУТФЩУК}igtДЛЙВzИКМЙД~yБЗКИДВГИЛКЖГЕЖЗЖЗЛМКЗЗИОМЙЙИЛНЛЗДЙЛКusxАЙИЖГГЗЙВw}ГККГБВВАyuzА{rg_`kyВ}rdSIMUX_q}{tsx|АА{||БА}wtuyz{}|}~ААААГДД~{zАББДЖЗЖЗЖЖДВВВВВБАДДЖЖЖЖЕЕДЖЖЖЕЖЖЖЖЕЕД|yy{yxxzyxzzzyxuuvz}xpswxsmggkou{|yttwxsnjgkpw{БЙОТСЛБztqh\POR_inopt}АzrptyАЙЛЙВАzz{~АКЯ║╓чщс╘╩╟╤╫╠╕жл╖╤сф┘╚╜╖┼╬╟▓ЪФЧм║╕еУКВРЩФЖ~~ЕКЕАyvootvrqsxywwxrpovzВ                                                                                                                                                                                                                                                                                                                                                                                                          яgX]\]]^`deiknrpjmjhkkhiicblqljkinsrln|}wu~НЙГГЗННЖЖКХаддаЪСОСФЫЭел╩° ¤у╝ЬЩЭЭбе│╝╦╫▌р╪═╝йЩУУФЧУМБssyЖЛМЖ~ГКНЛЗАw~ЕЗЖДБ~ЕЙКИЖЗЖЗЕЖКННЙКИНЙИЗЕЙПЛИЕЕДГrqwАИИВГЕЗЛДt}ГИЗДБАБВА{wz}ztlfclw}{vfWOOSU_o{{wwyzАВВ~||~}zuttwy{}}ААБААБГДГБ|x{АБГДДДЕЗЗЗЖЕЕЕДББ~БВЕЕЕДВДДЕДЕЗЗИЖЕЗЙИБ|}{zywxwwyzyvyxsu|Б~yttxzwrlhhkpy{wstvwwsnkgkry~ДМУТМВytmdXNOZflqrppzАА{tnqvАМРКГАyyz{}ЕУ▒╤фшт╙╟╝┬╔┬пЪЭм╩▐у┘╔╛╡└╦┼┤ЪХУж╕║йТЙ~НШФИ~~{ЖКЖА{vqrsvtnrzzvtvuppw||                                                                                                                                                                                                                                                                                                                                                                                                          цgZa]Z\]_dekmlnjgkkiljimldaiomlnkovsknwyxvАКЗЕЙРФХНВЕОЪадбЫПЗОХЧЬвл▒╦∙ ¤х─░ззабвн┤├╨┘▄╪╤└пЪЦХЦШЦПДyz|ИООДzГЙЛЛИВz~ГЗИЖДБДЗКЙЕЖЖЖЕЗКМЛЗИЗНОЛИЗИННКИЕГАqrxБИКДВЕЗЛЖy~ДИЗВАААВАzvz}|vpdbku}}vhWLNTV[ozztuxzБГБ}||ААА}xrtsvz}~~~~АБВЕДА~}}БВБВВВГЕЖЕЕДГЕББ~БВЖЕЕДГДЖЗЕДЖЗИЖЗЕЗЕБ~~}{zyyyxyzwvvxyy{ААyqswyxvrnjjpwyuqruuuspkggmu|ГЛУХОГysmdWJPalqrssrwБ|tprxАЙТПЖБz{z{}ГПж╦счу╫┼│▓╡пбТФз┼█т█═╛│╛╩╚╡ЪФФб┤║мФМВЛЧЩО|~xГКЙВzvopsvtpovxwtvurrwz}№                                                                                                                                                                                                                                                                                                                                                                                                         ┌dX\^^__cbehkltpnplkmjhmibdnqllmlpsljs}xsvГКИЛТХЦХЙ~ЕСЪбеЭНЗКЦЫЯжк░┤═√ ¤ш╧╕░окиил│╛╚╥┘╓╤─▓аХФФФУСИ~|}ЙПОЖ|БЖЛМКВz}АЕЙЗВАДИКИЗЖЖИЕЗМПОЙЙЗМНКИЕКННКИДusxАЕКЙГДИЛЙ}АЖИЙД~|Бzyz~xqgbhrz|vgZPNVW`s|zvsy}БББ}|{}А{wttuv{}|ААААБДГЕГВ}z}~БББВГЕЗГЕЕЖЗЕЕВБДДЕДДДДДДГДЖИЙКИКИГА~||zyzvxxyvvvxxx|АА|ttwzyutsojksurpqtvtuqnigipzВЛУУПЕyqlaSIRepuuuurx~А}uosvИРТМД}|{y|ВОЮ├▄цх┌─кееаЧЛНЫ╝╒р▐╧└╢║╟╔╣вЩСЬ▓╣нЧНВЙЦЩН}}yГЗЙГ~xqrtvpoqrtrrstsqvz}Ї                                                                                                                                                                                                                                                                                                                                                                                                         ╬_[^^^^^ccfjiilghiijmiinmggopmnnlosonuxvtxДКЙМФЪЩХЗКХЪбдЧЖИПХЫгм▒╖╣╤¤ ¤ь╫─└╝╡▒лмн╢┐╩╤╨╧╞╢вЦФУТТТЛА|ЛРРЙАВЕКЗВ{z}ИКЙЕВДИЛЙИЗИИГЖЗККИИИНПМИИКОСНИД{{xu{АИЛКДИКИ~ДИИГ{АААzvy}}yridfmx{sh\RRZ[iw}{tuy}ААВ~{}~xtuxz{|z|БААБВДЕГВА{|~ВВГЕДЕДЖБВГДГБВ}~~БДЗИЖЖЕДЖДЕДЗЖЖЗЖИЗДАББА|}{zyyyvvuuutyАА{utwzwuuvtplpuuqruwvurpjcenwАЛУХУЗ{rj_RIUiosvvuosАВ~vrux|ЖТЦРЖ||ywyЖФ║╓фц▌┼йЪЦЧТКНЦ┤╨▌▐╥├▓║─╚║еЧРЩй╡пШПГЖФЦК}zwЖЗГ~xrrrstpqrvtuxvupsxzф                                                                                                                                                                                                                                                                                                                                                                                                         └`Z^^^`__adggjoknmiimkjmfagrokommopin||sozЙКЛПХЩЩУБМЧЮгбОЕЛХЪай▓╣╜└╘√ №ёс╤╧╠╞└╕╡░▓╣└╚╩╦╞╣вТТСОЛМКД}БЛППЛДАЕИИГ}z|ЖЛЙДВДЕКЙЗЗЙЙЖЗЙММЙЖЖКОПЙЙЛНЛИДГ}|zvxЗННГДЗИЗДВЖИЙД}zАzss{zrkeehs~wk^UU_dpzwtxАББВБ{}{vsrwz{|||АГВГВГВБВ}x{~АБДДДДДЙДЖДДДЕИАБЖЗИДВБВДГЕЕИЗЗЙЙЛЙЕВ~БВ~|yxwvvusvvuw}ББ}zwxyxvwutppqusqsvxwwvqnfcjtИСХЦК}tk_OKXhnqwxrpuАДБvpvzyРЭЧЙ~|xvx~ЗТ▒╤сш▀╦нЧППКИЛТн╟┘▀╘┴┤┤╛┼╜зФНФвмйЬПГГОТК~{y}ГЗДАzrrqrrpqorqswvsprxz╙                                                                                                                                                                                                                                                                                                                                                                                                         н^]_]\__bbfiilndhkkkmjkrnikomkommpoltzumo}ЙККПФЩЦМДЕПЧЮбЫИЕПХЬжп╗┴┬─╤ю¤ўэх▐┌┘╘╬╟╜│░│╢╗┴┼┴╖аУСПОНМЛИДГЙНПОК~{ДЗИЕБ{}ДЙЛИГДЙККЙЗЗЗЖЕЖЙЛКЖЕЙОРМКЙЙЙЕГБА{w~ИКЗВГЗКЙЕБЖЙЙЗ~tz|{zuvy~|unfafpzxm_WZdlxА{xx}АБББА|~Бxtuxz||{АБААББВГДА{y|БВГДДДВЕДЕЕДДВДББГЗИЛЖЕДЕЕДДЕИЗЖЖЕЙКИВ}~АЕВ|xxxvwrruurs{ДВ}zyxyvxyywtrtwvutuuttusojgfnyЕСШЧЛ~tj^QKYcekrywnq~ЕДzrrtv|ИЦШЙ|yuszВОл╩▀щф╤┤ЪОКИЗИРж╝╘▐╫┴▓░╢║║кФОРЬимЭПБ~ИРЙ~zx{АДДАyssrvwtsrrqqtvrnrwy╛                                                                                                                                                                                                                                                                                                                                                                                                         Ъ^]]\]__acfgiotlonjjmhlnfbmsoonlmrpitАwloАКЕМРТХСЕ~ИТЩЬЭУЙМЦЫел╢┐─╞─╩╪▄фцфффт▀┘╘╩╛╖╡╡╡╢║╝│ЯТНЛЙЖКЛЙГДИНТТНДАВЗКЙЕ|yВКЛЕДЕИЙКИЙККЖЕЗЙММЙЗЛССЛИЕДЕДГАБГА~БЗЛЙВВЖИЛИДДЗИД|rz~}yvuy~wmea`oynb]_lszАБА{xxВГБА}}~zusy{|}АААББАББДГЕА|y{АВГВБДГЕДИЗЗКЕЗБ}~ВЕДЕВГГВГВДЕЙИЗЖЖИЙЙВ|}~БГАwtrpokkmnpq|БВА{zzxuvyzxuvwz|{xuuvwutqmifjsБРЩЩЛАui[MNT\`eovzrqzДЕztstu{ЖЧЪЛДzutzВМв├▄шц╪╛ЯМЗВДЖМЫ┤╬▌╪┼▓лп╖╣лФМЛФбйЭНБ}ЙИБ}yxАИИВztutvvrrnoorsurprwzв                                                                                                                                                                                                                                                                                                                                                                                                         Р\^_\Z^Z_bdfimmeiihkogjmhflnkonklomlv~uinАЗБОФХФЛ|}ЙФЪЬЦИДОЦвзо╣╜┬┴┬┬┴╦╒сцщьыъц▀╙╔┐╖╡ппопнЬУМКЛЛЛЛМЕВЗКОМОГ~ВЖЙКИА{~ЙНИЖЕЗЙЙЙИЙИЗЕЖКМНЛИЙОСРЛИЕДГ}{~ДИГ}ЖЙЙДГЖИЛИДДЗИЗ{rw~}yutx~Аyoe]\j|ypjdgqx}БАА{wszАБА}А}~АГБ}ywy}~~А}}}~АБВЕА|{|ГДЖЕЕЕЕЕГДЕЕЕГЖВ~|АЕЖЗЕЕДГДДЖЕЙЗЕЕЕЙЙИВ}}~БГАumkgddcbchn|ББ|zxxvvyywvwz}АzuuvwxwsnjfiqАНЦЧЛВxi\NMUZ\amwypo{ГД{uqtuzВХЮТЖ~zuqxБЛЫ╝┘щш▌╞зТИГДЕИСм╔█╫╟│ий▓╕йУЙЖМЪбЬМВ}ИЙДzz}ГИГzvsrwwvuppqrutropsvЕ                                                                                                                                                                                                                                                                                                                                                                                                         Ж\]]^]`[_bdfhorlonilojlkefnsnnnlmpjhy~ofnАДДЕКНЙВ}АНЦЬШИГИУЬео╡╣╝╜╝╣╕│└╬╪ущэяяэч▀╒╦┴╣▒лижЯЪХККОЛЕГВВГЙНОПД}~ДЛМК~yАЕЙИЗЕЖИЙЛКМЛКИИЙНПКИИМОМЙДДИЕ|w{ГЙКЕДЗЛКВВГИККЕВГДБyru|}zxtx||ypfYWhzxrninv{АББyv{АГА~А}}}АА{usxz~АВАВААААБВГБ}yzВДДГДЕДЖДЕЗЕЖЗЙЕА|АДЖЖЕЕГВГДЖЕЙИЖЗЙЛККД}~БЕАqheab```aco|БЖБ}zxzvxxywuwy|БА|xvvwxwupmgiq}ЛЦЧЙВyk[NNZ_bgpwxonzГГ{wqquyВТЩФЛzusxАИШ╕╒шьт╨пТЕББЕНж┬╫┘╔╕игм▓жХЙБЕФвЬЛГ|{ЙНЖАzz}ДЗБzwsruttrooooqsrpptwy                                                                                                                                                                                                                                                                                                                                                                                                         sZ]^[\^[^`dhknkfllkmminojlrpnnolnohl||ldoАВ{ГКПЙ{w}МЦЪУГОЦЮи░┤╕╢╡ллм▓┐уяхфъэяяэц▄╒╔╛░йдаЭШФНМКЕ~~ВАВВИММЛЕБ}БЛКЙА|}ДЛКИЕЖЗИКЗИЛЙИЗЙММЙЗЗКРОЛЖДЕЖuyВИИЖЗИККДБДИЙЛЗЕЖЕГzqsz{zuouzqgXSdw|vqot{АААБАwrz~БАБАБААГГwtvwz{~||~АДД|}БДЖГДДЕДВЕЕЖДДИЖБ{АДЕЗЖЗЖЕЕДЖЕЖЕЕЕЕИЗЗДА||БВtlfefddcdgp|ГЕВ~zwyxwyzyvv{АВБ~wswwxxvsnijp|ЛЦЦНГxl\MP]dehq}zpryАВ}vrruzАЛЪЧНГ{vrwЖТ▒╨цьх╫╣ЧЗАБЕНа╜╒┘╦║еЬепзФИББКЬЪМВ|~ЖЛИАyvwИГ{ytrvvuqqomnorpopsww                                                                                                                                                                                                                                                                                                                                                                                                         o\\\Z]]]_^bfjnolqlijkionehssnnnlqqin}zieq~p{ЕМЕsw|МЦЦЛyГТЫжо┤┤│мжЮЮЮпсЎЁ▀▄хщюяЁьц▐╘╟╢ндЮЪШЦЙЖАwmk|ВВЕЛНРЗВАБЗКК{|ВЗЙИЖЗЗИЛККЙКЙИИНРКИЗИМНКЕДЙЙ{qxВЙМЙКЙЙЙЖДГЖИЙВВДЕВzqqy|{wsu~Б{siXQbpxxutw}АБАБДБyuyБААА}|АГАxsvy||ААБДААА~~ВГА{yБГДВДДЕЖЕИИИЗЙЛЖБ|~ВЕДГЕЕЕДЕЕЕИЖЗИИКЙЙЕА}}ББАysmilmnljjpzБИДА{wwvwwvwux{АДДvqqxyyyuqllq{ЛЦФОДyl\NT_hllq{|pmuБГБxrsuz~ЖЫЭСЕ~ytw}ГПж╦уэщ█╛ЫИ|}АБИЧ╣╨╫╠╗еЪалйФИ~|ЗЫЪМД}~ЖНКВxx}ДЖ}ysrsuurpnlmpqpomrxx·                                                                                                                                                                                                                                                                                                                                                                                                        m_^^\]Z\``cfknjgkiijggonhjpojonmpngoxgds~wozИОБprКУТЖzЙЦЬжн│░нвЪЧШм▄№№Ё┘╧┌тщьяюьу┘╧╜░еЭШЦЧСЛАrfgtВДВВККЛЙЖ~~ЕКМД}{ВКЛНКЙИЗЙИИИЙЙКЙМРЛКИКРОЛЖЕДГzpuБЗЙЙКИИЗЕББЕИНЗЖЖДВ{qpwzywrtБysiYSanxxuuy}БААБГВuszАААА~БГБzuuz}}~~Б|~~АБДДБ}|ГГГЕЕЕЕЕЗЕЖГДЙЕБ|~ГЖЗЖЙИЖДЕЖЕЕДЕДЕЗЗЙЕВ|БГЕ|zwvtsrpoqyГДБxsssuutuuyz|ВГ~vrnswxuttrqq{ЛЦШТЕzn_OWdinqtwvrpuЕБwtsvz~ГЦЬЧНГzqwГКа─▐ыы▀┼аЙ~{~ВЕУ░╔╥╠╗гХЪииТЙ~zЕЦЫНЖА}ДРНБ}wu{ДД}xuttvxusqmmorronruwя                                                                                                                                                                                                                                                                                                                                                                                                       ■l_^]]`^\__afiqpnokijhinjdiqonpnmqndqwgfs|tp~ЛК~s|ГМРМБАПЦдйп▒пжЦФЧв┬ы■ ё╥├╬╓рчьюэщр╙┼╖кЬЧХХТОГsc`qАГВГИКЛЛИБ~ГКНЕБ~БЗИЛЗЗЗЗКЙЗЙКККЛОТОЙЕЗНТНЕДВ~wmt}ЖККЙИИЗЖББДЗЗБВДЕВ}pkw~{xsr{zrgXT_oxyvsx{АБАГДБvqx~ББВББ~}АГГxsv{}~БГББАБААВЕЖГ||~ВВДДЕЗЖЗЗЗЙЖЖЙЙГ||ВЖДЕЖЗЖГДЖЖЕЕЗЕЗЙКЛИГ~БВББ}zwvvtsqu~АЕДБ|{wrttuvvwy|БВБypmrsuutusstzИХЧУЙ|pcS\gooqruvqpsЕДzqswy|ВХгЭСЖ~st|ДИШ╗╓щьс╔зМ{z}ГПй┬╥═╜дФЦгиФИ|zВСХПИ~|БММА}xu{ЕЗ}zusuuusqmklmrrpnqvwт                                                                                                                                                                                                                                                                                                                                                                                                       ∙kb`^[]]^`abfinjiljjmginkhnslinnmoieurchw|rsБККxЖОНД}ДХЧвзммеЭПФЯ░╚ё  Ї═│╝╩╓▀чъыъц┌╩╝обЩЦЩЧУЙyhcnАЖА~ГЗЛЛК}ГЙНЖВБГЕИКЗИИИКЙЙЗЙИЖИИРПКЗЖМРПИДАukr{ДИКЙИИИЖББЕИЛДАГДВ|tnv}~ysuz{xshXUapzzwv{}АБАБЕГutx{ААВВБ~ВБzvx|А}АБ~АБАВЕЖД|ВЕЕДЕЖДДГГЕГЕЙЙДБВИЗЖИЙИЕЗЖЖДДДЕЗЗЗКИДААВГГЕЗБ{yvuvtqs|ГЕГ||~xttvvvy{|АВБ|oimpsvwxwvv{ИХЪЦК}seY`kpqspprqnrЗЕ|vvuw|ВУидЦМВuxzАЕУ░╨цьу╧░ТБ|}|АЛв╖╠═║ЯТСЪЯУИ}zАНЫРЙА~БКЛБ|tt{ГГ}zutsrsssommmrrrppuw╨                                                                                                                                                                                                                                                                                                                                                                                                       Ўlb_^^^^__`behqooplnnilohfnsolonoqihv{rhjtxpsЕПЛББЕЙЛЙГАЛФЩбжквЩСПЪж│╟Ї  ї╦ел╝╦╒схщъщт╥─╡йЬЦЧЧЦРАi`oИДИСНК}ЕЙЖД~ВГЗЖИИЙЛККЙКККЙИОПМЙЗНФПЗД~|tmr|ДКЛЛИКЙЗВАВЖИЖГГДВ{vox~А}trx|{shY[dr{{urx{~~БВВxsw{}АВБ}}АДБywy}А~ББДБАББББДЗЗД|}~БЕЕЕЖЗЕЕДЕЕДЕИЙЕВБВЗДЕИЙИЖИЕЖДДЖЖЙЙЙЛЙЕА~АГББГГАzwwxvsw|}АГЕ|stusqtqsxz|АВГ|rlmnruwzzxw|ЗУЩЧМАuhbgptuurqqrrtАЖЕ~utuy|ВТгигФИ|y}ДПз╩уьц╘│ФА{{|АИШо╟╔╕ЭРМФЬФЙ}yЕССЙБ~БЖКБxvzВД~{vrrpsrqmlmmqrrptwx║                                                                                                                                                                                                                                                                                                                                                                                                       Єmfe_]]\^aacehlfiiilmgjoihnoiiiilnfiyndlvvlwЕЛКЖТЩЧРЕ~ДНУШЯддЪСРЦай┤┼Ї  ї╦вап╜═╪▐хшшф┌╦╗мбЩШЦЧТИrcoИЕВАДОНИВ}}ГКЗЕВБГЗКИИИИЙКЙЕЙМКЗЗПТОИЗМТСКЗБ~xqs|ГЙМИЗИЗЗВАБЕЗЕВГДГypyАБ{ussz{vj^Zfs{|ysuy{{}~Аxvvy||Б~~~}АГЖ{vy{}|ААБББАББАЕИКЗ~}ЕЖИКЙКЖЕЕГГВЕЗЗЖВБАИИЗИЙМЙМИЖДДЕДИЗЙКЛЕАВВБГЕЖА{zzzsuy{АГВ|uqmlmoqtwx|ГЕsnkknrvyzyy~ЗУЩЧНВzqorrwwwsstvrs~ИИАwuu{~ВСд│┤дОВzy}БМг├▌ъч┘╝ЪЖ~~ЕПе╜╟╖ЭНЙПЬЧК}{|ДСПКВАБАГzvvy~А}zwtrrtrrommmrrropvyЪ                                                                                                                                                                                                                                                                                                                                                                                                       щnhe`^`_a``cfgnlnokkkhongflpkkjjnqhkwyohmtrmyЖМЛМЧЭЪСВАЖПФЪбвЯРЗНЧак┤─Ї  ї╦ЯЧг▓┴═╓▀хчх▀╘─│жЩШЧФСЙxnuГМКДБГЛОНГ~~ВКЙЕБАГГККЙИЙКККЙЛММИЗОУПЙЗЛМКГГА~|ut{ВИМЛЙКИЗБ~БДЗЖВБВГyt{ВБuptyzvh__it}~wruy{}|}БГ{uvz}~~А}}ААБ}zx{~|А~БББВБВБДЗЗД~~|ВДЗКЙЛИЗЖЖЖЕЙЙКЗВА~ДДЖЖЖИЙКИИЖЖЗЖКЙИИЛКАБВББДЖЖВ~{yystxzБВ~yqmiehmpvyyГЕБvpmijnswyzx~ЕТЪЪРЕ|suvwxxwuussts{КЛБyvuy~ДПж╛┬▒ЦЖ|{ГЛЬ╗┌щш▄┬вЙz}~ВЙЩ▓└┤ЯОЗЛЦЧЛ}xyПУКВ|~ДВ}yvw~А~|yurqsqqnlnoruvrswyЖ                                                                                                                                                                                                                                                                                                                                                                                                       цtoi_]]\ba`adfgfjiijkgnmijqphhhloofm}yjfnvrq}ЙКНПЭаЭО}АКФФШЫЭЦГЕПЩЮз│┐є  ї═жЫбо╕┐╦╓▐ффф┘╦╗иЫШЦЧСИ{sxВЛЛИ}~ИМКЕВ}БИКЙЕВБЕЙЛМЛКККИЕКОЛИИОСОЙИЙНОИЕ~}zx}ГИКЗЖЗЖЕВ~~ВЖЗДВДДzu}ГВ}wqox{xm__jt|~xtvy{}|}Б}wuy||АБАБГ~{y{|А|~ААААББГЖИИА|ДЕЗКЙКЕДДВДГЖИКЙГББЙИЛЙИККМИЗЕДЕЕЗЗЙЙКЙВББВВГЕЗИГzxuqtxy{АБА{usokhhlqwy~ГЖВyrliilnuxwz|ЕСШЩУЗ}uvx|~~zxupnpqyИЛГ{vuy|ДПй┐╟╜вЛ|ВИУп╙хч▀╦кОАzy{~ДРи╣▒ЮРЖКХЧЛА{z{ИОКД~yzАБ|xvsw}~}{wrsusroonmpuvpprvy                                                                                                                                                                                                                                                                                                                                                                                                       ▐smfa__^da_`bfjhnlkkjionffoojlklpqkryskltsnqАКОСХЯбЭК{АМЦЦЩЪХОЖМТЪЭж░╝Ё  ї╙наеп▓╕┬╠╓▐сс█╧╛кЫЦФУТМ~yxГМНКВ~ЕМНЙЕ~ДЙЙДБГКМККЛКМЛИКНМИИОТРЗЖДИМКЕ~ВА}АЖКНКИЖЖЗБ|{АДЕБ|АГАyyГДАxqnrxxocemw~wrvz{}||АД}wtx}}БА|{АБ~{v{}ББААБГДАГБГЕЗЖБА}ББЕЖЗКЖЕДДЖЖЙИЛИЕВБДДЖЙЙКЙКИЖЕЕЖЗЛЙИКЛЙАБДБВДДЗЕБ|xursvtwАДБ{xvsnjfjptx{ГЖВ{upmjhjrwyy~ЕПЩЫФЙ~vuuz~~{yvqmmnuИНЖ}wty|ДОж├╠┼░УЕАААДНз╚▀чс╧нПВ}yy|БКЫппаРЗДУЪСВ{xzКСКГ}zyАА}xvuy}}}|ysqstsppmnrvxropux■                                                                                                                                                                                                                                                                                                                                                                                                      █|{l`^^\ba^^bdgfiihkigomhlpnehglpmgq{shhoqnsБКРЦЩЮЭЧДzГОТТЧХПЙВМУЩЫвп╝э ■Ї╫╣пп░▓│╖┴╔╓▄▌█╥└лЭЦФФУПВ~}ДЛРЛ~~ГКМКЗАДККЗГБВИММЛМККИИМОМЗЗМТРЙИИКОГz{ДЙЕДЖЗИЖЕЕЕЗДzu}ДВБ~АВБ{x{ГДА{neoyxpiiqyБАzstz~}|}АБ~vquz}~~А~АВЕА{xy{}}}ААББВБГЖИЙГА~БВЖЙЗЗДЕГГГДЗЗКИЕВБДЕЙЙЙИИИЙЙЕДЕДЗЕИЙЙЙГВБЖДЕЕИЙЖД~yurtxvv|ВГ|wwvtojjosw{ГЗЕ|wrmhcgpwxz|ГОЧЪЦМБvpnrwz{xvqmjjtЗНЙwuxИСй╟╙═╣ЯКББББЛЯ└┘цф╙│СГzyy|~ДХбиЮРГВСЪСВ{y|ИСЛГ~yyАГ~ytrwz|~}zursvurpnpsuvrqqtx°                                                                                                                                                                                                                                                                                                                                                                                                      ╩}ylb`^_aa__aeliolijhipmefmmhjilpnirvokmrpnzЕИМУЦЩЪР~|ЗСФШЫПГАЖРХЩЬвп┐ъ ■Є█╟╜╛╗╕╡╡╕┴═╒┘┘╙┼нЭХТРОНЗВ~ЕЛОНБ}АИМЛЗА~БЖИДВАДЗЛЛЛНММКЙЛОНЙИМТПЙЗЕИНВwzАЗКЗЗИЙЛКЖДДДД{u|ДГ|}ВБ~z|ВДА{lcjwzsqsvzБ{uty||}~АВyux{~}}АБДВ{wx{~}ААГББГВДДЕЖД~|АБЕЖЗЗЖЗЗЖЗИЙЙМКЖВБГГЗЖЗЖЕЖИЗЖДЕДИЖИЛЛЙГВВДДДЗЙЙЖЕА|xrsurszБВ|xwyvqllknszБЖД~|wrkcaksvx|ГНЧЩЦПВvnipv~{xqokirЖНЙyx|ВКСн╟╓╒╞лРВ}АБИЪ╣╒фц╫╡УГzyy{~БНазаПГНШСГ}wyГККГ~yx~ГАzvtuy~|xppuwutqnprwvspovxю                                                                                                                                                                                                                                                                                                                                                                                                      ├yvja_^_aaabbdggihhhhhonknqliggmnjhtwnhjnpq|ДЕКРУЦХЗ}АКРУШЧЖ~ГНСЦЭбз░╛ч■¤я▐╓╤╧╩┬╕▒▓╢┬╩╙╘╨─оЮФСРММЙВБЗММЛДА~ЕККЗБ~}ЕЙИДДЗКНККЛКЛККМНМЖЗЙРСЛЙЙПН~vyАЗЛЗЕЖЖИКИДДЗД~w~ДЕА|БГ~{|ВДА}k`grxwuuw{~~{vuxz{}|ВБztvz}АББГДГxw|~~А~ААВДГДДЕЖГА~БГЕЕЖЕДЖЕЕЕЕЗЗЛЛЙДВЖЖЙКККЙКЙЖВБББЕДИЙЛКДВВЖЗЗИИЖИЖБ|uqtwspyГЖ|wyzxtpmlnqwАЙЖ}|ztmfcgntw|ГНЧЪЪСЕxpgku{{xysqnlrГТНБ}~ВИЛУм╟╪┘═│УЖБАВЗХ╡╙ух┘╝ЪЖ|zzz{БГШдбПВКСОДzwЛКЗБyyА|yvstx|~}xrswwvvspoquutqmrw▀                                                                                                                                                                                                                                                                                                                                                                                                      │togccabbaabbehimiiihjrmfhkiijjlnkktsljosnsВ}|ЖМОЛyБМРФШУВ~ИСХШЭдо╖┐▀¤∙щ▀▌┌▌╫═┬╢│┤╝├╚╠═┬кЩТОККНЛЗВЖЛОПЗВАДКЛКГА}ГИИЕВДЖЙИИЛМЛЙИЙОРЛЙЛООМИЕЕИ}svАЖЛЙЖЕЖИКЗЕЕЗЗ~u|ДВ}zАДД}|}ВЖБ~m_cqwxxvx|А~{wuvyz|}АВБ|uvy{~АААААВГВ}xxyААААБГЕДГВВЖИЗА|АВЕДЕЕЖЙЗЕДЗКЙЛЛКГ~ВЕИЙЗЙЙКИЗЕЕДДЗЖЗЙЛЛЖББДДЕЕДДВЖДАvrvvsqxБЖАxxzxwsqpnouАИИВ~{wrhdfjqw|ВНЦЪЬХЕxrons{{{{wtojqНОЖАДОУУЫ░╚╫▐╘╕ЫКГВГЙЫ╕╥фч┌╛вКА}zzy}АФЭЬПАДКЙГzy|ЗИИВz{{А~zwsqt}А|uqrvvuqrmoquttrotw╦                                                                                                                                                                                                                                                                                                                                                                                                      зuqgdcabeaaa`adegehihjojiongffhljfjwunmnoktВД{{ГЙОЕyuБМУЩЧМ}ОХЦЧЭж░╣├╠▄ъцухххс╪╩╝│░▓╕┐├├║зХННЛНОККГЕКМНИГ{~ЕККЕГ}ВЗЙЙДЖИКИЗКНМЙЙИЙНЙЛКОПНЙЗЖБ|uxЕМКИЗЖЙМИДЕЖЕx|ББ|{БДАБВБ~nehpxyxux|АА{wuwy{}}АГД{uvy{z}АДДБГДywz~А~}ББГВВГГИКЙВБГЕДЖДЕЗИЖДЖЗЙККИДББЖКЛМКИИЗЗЕЕГЕЕДЕЗЙЛИГГЖЖЕЖЕГВЕГ~tnrupltДЗАzzyxwwvrpqtЗД|zvslfbhotzГКЦЯвЦЗ{urquyyzzwqnlpСРКЗНЧгни┤╚╫▐╫┴ЯОЕДЗПб╛╓фч▌├дРЕ~}zy||НЮЮО|~ИКЕА{wyИЛЙАy{z{zyvrrqyБ}xrvvxwtrmprrtspkpvп                                                                                                                                                                                                                                                                                                                                                                                                      ХiifgfdeeaabaeeimhjihlqjfjlhghhlkfmwrlouogsГsvЕЗ~vuБПХЩСЕВКФЦЩЭби▒╡╝╞╦╓▀чшъышр╘╚╗▓оп╡╣╖▒аТЗККИЕДЕВДЙЛЛКЕ~ГКНИЕ|БЗКЖВЕЕИИИЛМНКЛММРННКНПОМЙЖВ}ut|ВОНЛЙЙЛММЗИЗЕ~q{ГБ||~БГВВБДГВqdfpxywuz}АА|wtwyz~АБГДvvy}}}|~ВДГ}yxy~ААААБГЕВГГЕИККБ}ВДЕЖЕЖЙЙЙЗЛЛЙККЙЕВГЙЙЙИЖЗИЗЖЗЗЗЗДЕЗИККГБГДДЕЕГГДГ}tmpurptАИАxzzyxwxtpnt}ЖЙВ}{yunibdmqzАЙЧжиЭНГ{vsvz~}xsnlo}СХНКФл║╣┤╣╞╪▌┘┼жСЙИНФн╞┘фц▌╔░УЙДА|{}АКЧЬР}}|БЕЕБ|yyГНКАxyxzy{ztpqx~}yrsvwtspmppuvvqnqvХ                                                                                                                                                                                                                                                                                                                                                                                                      Йhiihfbbdba`acbcghiihkonmrnhfefjkgmsqprrlgvД}qtГПК{twГПЧХЙАГМЦЫЭЮеймп╢╜╔╘▀шщюяюч┌╨├╕░млкйиЪПКЗБ|ЖЗАВЕЙКЙЕ~БЖМЙД}БИМКДДЖЖЕЗИМКЗИЗКНООЛПТСПЙЖВzw{ГЛЛКЖЗЛМЙГЕЕДАwzВВ}{|АЗГВАДДАskgqy|yx{~АБ}xuvx{}|БДВ~yvx}~АА}ААВДЕАzwz}ААБАДАВЕДЖИКГАБГЖЕЗЕЕЖЖЖДИЙЙЛЛЙЗВАЕКККЙЛЛКЗЕЗЕЖЕДДЗКЛЛЕГГДЕДЕГДЕЕАsmqsoksБЗzzzywxyytps|ЕИД~{yvsjfcfnx~ИЧзмдТЖ~zwsw|~zuromp}РЧУРЬ╖╔╧╠╚╬┘▐┘═лТЙЙОЯ╣╤▄фх▄╩╡ЫПИВААБЕОЦЧН}~АГЕЕВ}yyАЖЖАxytxyyzuroyА~ztrvzwtroopswvrmrxВ                                                                                                                                                                                                                                                                                                                                                                                                      БgjnlkgfdccbaggijihidnmjhnnihfhlhepvmlwwiizД{ryКУЗzwzДСЬФГАИСШадздггазм╛┌шщшыяёэц█╧┬╕мзбЮЮЫУИГvomwЖБВГИЛНК~{~ДККД}БЖКЗДЖЖИИИЗМОЛЛЛМНОНМСФУНКЕ~{wx}ДНПЙЖЖЛОЛЖЖЕГw{ЕГ~|{АДЕГБВЕЕviks~|zwz~АБАyrsvx|~БДЖА}yy~~}||~ВДДА|xw}~ААБГГДБВГЕЗИЗБ~~ВГДИЕЕЕИИЖЙКИЙКЛЖГВИЙЙЗМККЙЗЙИЛКЖЗИММЛЕДВГДДДГДДДБzqrrrosБИВzyyyuyyyvstyЗЛЕ|ywvohfeku}ЖЦй▒йЦКАzwuxzzqlllp|СЫЦСЯ╝╥█р▀рст▀╥╕аТОСе┐╓▌р▀╫╩╢гФМЖГЕПУХФТНГДЕЙКИЕБzxДБyxyz|~Аzsqu|~yuwvvsrrooruvvuppuw                                                                                                                                                                                                                                                                                                                                                                                                      qgixЕvifc`bd_dcdffghglkhkrnifdglhfnppsxvgi{Гys{МСКДВАЕСЫМ~ГНТЧЯеиеЬЪЧХ╛шЄЁъфчюёЁъф╪╩╜огЪЩЩШУНДtean~БВВИЙЛЕА||ГКЛЖБАГКЛЖЖЖЗИЙЛННИЙИЛПСМНПРСРОЙГБ|y}ДМСМЙИКМЙГЖЕДА{}ВБ{|ГЕДБДЕАwrou~}yy{~АБАzuvxx{|~ВДБ}xuАА~}~АГДЗБ|yy}~ААББВГБВВДЗКНВ~~БЕДЖГЕЕЖЗЕЙЙИИЙМЗВАДИЙЙИИИИЖЗЖЖЙЖЕДЕЙМЛЕДЕЕЖДЕДЕЖЕГАzvtrsyГИБzwwxxzzxvuvxЕЛЖ{zyvqlhejs{ГХз│оЫМБ|wtsy|xqigin{РЫЧУа┬╓тфцчшчу╫─кЦССв║╩╥╓╤╔╛▓еЮУКДГКФФУОКЗИИСУПКГ|y{yurtyАВБ}uqx|zzwww}ytspnpvxwrpptv■                                                                                                                                                                                                                                                                                                                                                                                                     khmryyfea``c`heigffgfnnjhlihffhlhftrlpwvklztn{НТЕГЖЙМФЩД|ГОЦЪЭвжаФРПЪтў·°щ┌сщюяюьт╒─▓вЩШЧЧСНЕvh^hzБАЕЙНКВ||ВЗМЕБАБДИЖЕЕЖЗИЙОСЛКЙЛНСОНОРУУПЕБВББДМОНЛЛМПЛЗЗЕГ~{АДБА{x{ВДЕВАВДАzuuzАБ{x{~АДГ|tuxz}|}ВЕВ}vx~АБ|}~ВГДГzyАБАБББВГБВВВЖИЙДБ}АГЕЕДЗИИЙИМЙКЙЛКЙДВЕЗЗЖИЖЗЗЗИИКЗЕЖЖЙМОГБДЕДВЖДЕЕЕЕГ~xwuyБДЕБzwuxuwyxwwy{ЕЙЖБ|ywwtqjeepxБТж╡▓аОГ}yutwА{ogioszНЬШУЯ┼▐юєЄЁюьшр╥╣ЯЦФУд░╡╕│леаЭЫШТЙГБА|}yy{ЖУЩЧПЖywtrmkoxДКЛЙАxsx}}yxxxzzxronnvxxtopux·                                                                                                                                                                                                                                                                                                                                                                                                     lfjpvsbca``^[`\`ccfggokglrnhedfihhpmnsyrbm{zqqЛПМСТОМУХБЗОФХЬааХЛНУоъ¤■√щ═╪фъээыц▄╔│дЩШХЧХУИzkabuВВВЗЛЙЕz~ЕКЗВБВЗЙЙЖЗЙЙЙЗКМККЙЛОПНЛНОХСЗДВДГВВЖНСОКЙКЛЛЖИЖДА}}ГДА{y}ГЕЕВБГЕВ~yw|АА}x{~БДГ~utwz|}БВГГ~vt}Б~|АГДЗГА{v|АББ~БАВДДЖКОЖА~БДЕЗГЖЖИЖДИИЙЗКМКЖВДЗЙКЖЖЗЙИЗЕЕЗГДДЕИКЛДБВДЖДЙЗЕДДЖЕГ{wpszГГ|vuwuuy{yy{|ДЙИБ|ywxwtmgbiq}Од╡╢зФЗ~{xwwzysoqwzyЛЪЪУЧ║э°··∙°їф┌╙╛гШФОНСХХТММОРТХЦЛГ|pmlifjqРЧЩСИvsomgekwЖООНЕzwy{zxxz||ysrpptyyuqtvwє                                                                                                                                                                                                                                                                                                                                                                                                     ighilkhfdb___e_adegghpnjknggffkmhixlirwtiozwnpБМНМХЧЦРТОБВЙОХШЮЩТИИТЪпя  ■ъ└╩█фщьъщс╨╖еЪШУФФТЛВs]`tАВБДКЛЙВ|~ДИЖГЕКЙДДЖЗЙИЛОНМЛНОУПММОМЗБАВЗЙЗДЗНССММММЛКИЗДБВВБ|v|ДЖЙЗГГЗЖА|z}БА{u{АВГГАutvy}|БДЖЕАzty|||}||АБДД{w{АГВАББВБГЕЕДЖКЗВ|}ГЕЗЕЗИККЗМЙЙИЙЛЛЖБЖИЕДЗЕЙЗЗЙИЙДЖЖЖЙЛМЖГВГДДЗДЕДДДГЕБxpmozЖД}ytuswyxxy{~БЙИБ|wuxxvqjgfmxКв╡╕кШЛА{wxxywommqtsКЧЪУФк╩тццфр┌╨─пбЩЧТЙВytrplmqwАИРОДvh^\ZYYcp~ЙЛЛКungd__kyИТХСЗz|{yvw{}БА|tpnouz|xtsuuс                                                                                                                                                                                                                                                                                                                                                                                                    ■jfefggghcb`^]^Z_aefgiokjnqggebhjhjqgjswqerytmsДЛМТЧЪЫШТИzГЛРФЩЬМЗЗОЧЯ░ъ  ■ч╢╛╧█рхчцс╤╝иЩШФФЦФПЗ{cewДД~БЗЛЛВ{~ГИИЖВГЕЙЛИЖЗЙЙИЙНОММННСНМЛНРЙ}{АЗММККНПМИЙЙЛЙЙИИЕА{~ВДВАyzАЕИИЖДЕДБ}z}БА{yz}ВЕЗАtrty{|}БЖЗВzu{|{|АА|~ГЕДАzx{АББВББББВДДЖЙЛЙГБАГЕЖДЗЗЖЕДИЗЗЖКММИБГЕИЙЖЙЗЗЗЗЙИЗГЕДЖИЛНЙГГДЗЕИЖЗЖДЕГДГ|kckzЗГxtssuxxyyz}ГЛКВ|yxxvwsnhegxМд╖║пЭНГ|uursrohdffmЙЪЭЦЛККСПЛЙИЙНМНИГЙЛЖzmhgdfikkp{ДЛВqd[RQMQW_djxЙМqf]UVZhxЗТТРЙ~}{{{АДДДАysnotz{vstts╤                                                                                                                                                                                                                                                                                                                                                                                                    ¤iebbhijlda_^`c_dddfgkqmklkfgeeihgmthkqtphvztlxИНСХЪЮЭЧЛААЙОУЧЦУДДИПШг╕ы  ■уй│├╨╫▄▐р▌╧╛йЪХУХЧЦТЛknzДИВ{|ЙМНГ{{БЗИЖВГЖИЕЕЖЗЙИЙММММНОТПННЛЛЗ~{ЗННКЛНОНКЛКЛЛЗЕЗЖА~~БА}wwЕЙИГДЖЕБ||~БА{yz|БЖЕАxtvz{|~ДЗЗД|x|}}{{}|БДЕВ{z~ВГДЕДГВАВГДЕИЛЛД~ДЖЖЕЕЖЙЗЕИИЗЖКМЛЕ}БЕЕЕЕЗЖЖИИЙИЗЕЕЖИКЙЛЙЕДДЗЕЙЕЗЕЖЗЖЖД}kbgwГД}vqopssuxwz{ВЙЛГztwyywsohcfwМе╖║┤гПД}zxurqqld``lЖШЮЫКА}yxxy{БЕЙКД}}ЕЗwnkhkmtywouБДuia[XUXY[[^qЙЛ{rbTPNS[kw}ВЗК~y{~~ГЙЛКИВzuppv{zvvwv╗                                                                                                                                                                                                                                                                                                                                                                                                    °ifa_dpunhc`^]][__dfhkojkqpifefihimmejsulgxytp{ЙНЦЧЩЭЭФВ{~МРУЦФИ~ДЛТЧв╗ъ   сЬе┤╛╟╠╙╒╙╠╜йХУТФФЦФОВrt|ЗЙЖА{ЗООЖ~}~ЗЙЗДГДЖМИЙИИЙЖИОПМЛМКОННЛЛКДww|ЖООКЛЛНМЙИЗККЗИИЕАБ~ВЕЕБyv|ГКЛЗВДГБ|{}БА|z{~ГДИАzvvy{~ВЕЗЕ{vz}~}~БГЗКД{x~АБВВВБВБВВДЕЗКЛЖББГЕДДДДЖЕДЖЕЖЗКМЛЖ~ГЖЖЖЗЕЕЗИИЖЖДДГЕИЙЛКЖДЖИКЛЗЖЕЖЕЖЗЖodjtВЖАvplntsvxxyyЙЙВxqpvwwtqkgdrЙг║┐╖жСЖ|xxuuvsrleelАЪЯШЙА{ДИЗВАЖвЫОЗГЕЖ{vstu~ЫЧН}v|ВГxpihikikieemЙ~th[SPQUW[duДЗ{tst~КОУЦСЙВ{upov~Аywtuuг                                                                                                                                                                                                                                                                                                                                                                                                    Ўhe``hqА{jdda`a_acfihmokkljgeefjjjopehqqmp|wosИИПШЪЭЫР|}ЕОУЧФЙАКСУХб└ъ  ¤▀Шакп╢╜─╞╚┬╕жХТТУССТПИzz~ИЛЙГ~ЕЛНИААДЙИДВВГЙИИИИИИЙНСПНОНТПЛЙЖДАzu|ЖНМЙМЛНПКЙЙЛКЙИЗЕА{~ГЕД~yzАИЛЙЕЗЕДБ|}БГ|x|~БДЕБ{xvy{АААДЖЕ{uwz}|||~ГИКЗ{y|БГВВГДВВВБДГЕЙКЕ~АВДДДЕЗЙИЙЙИЗЗЙЛЛЕ~БДЕГДЗДЖЖЙКЙЙЖИЕЕЖКННЙБВЖИЙДЖЖИЗЕЗЖВrghtВИГxpjhlosxxyz~КМЕxnlrvxxslhflИЯ╢╜╜йУЖ~zywwwА~wpln}ХЫУЖАБТЫдЧНЙУи░зСИЕИА}}ЗТейЩЗ|zАВ|xvsrxДywpnpvy|vmeb^]^`_ck}ДzojipЕМЦЦСЙГ{unpvАzsswtК                                                                                                                                                                                                                                                                                                                                                                                                    Ёhda`fu}xnfb^^\Y^_dhhlmikrnfedgjjknkfmurkmwtnuДГЕМТЧЦЗwЙТЦЧОББЖМУУЦд┐щ  ¤┌ЧЧбеел░┤╢╡лЯФПОУРРРСМ~АГМЛКБwБИЙИВ||ДЗИЕВВЖЛИЙЙКККЛНОМККИРТНКИЕАyw~ЖНОЙЛКММЛЙИЙЖДДДЖДБ~АГЕЕАvvАИМЙБДГВА}БДЖА||~ГГЖД|ywyyА~АЕЗД{vw|А}АББВЕЙЗ|z|~ББДБВВГДДИЛМЙБ~БЖЕДДДЗЗИЗЗЗЖЙЛНИББДЗЖЗИИЖЖЗЗИЗЖЖЗЕЖЛПНИЕЖЗККЙЙИЗЖЕЕДАuleqБЙЕ|smjjnuxxwzАЗКИ{lhnvxwtohdkЕЬ┤└╜мХЙ{xxuvВИВwqr}ПЧСЗБЕЧемжФОЩ│╜╖гПИЙДГГВИУй▓аМБ{|В}zyyy~ЙВ~wpqty{vqnnpsqohhlt|ynb_cjy{y|БВ{upry~{vtvvx                                                                                                                                                                                                                                                                                                                                                                                                    яiheehqwpjfd_d`_`cefgkmmnmihebijilrmgnrpmqwpnw}|ДЗОУПsБЛУЧЧЗyКСУФЧб╕х  ¤┘ЦУЩЫЭабжйзвЪХПКМННЛЛКЕГДЛНЛГz~ЕЙЗГ~{ГЕИЕДВГККЙКЛКЙМНСПМНЙНРОКЗДВr}ДЙММЛЛММКЗЙНИЖДЗИГБ|}ВЕДБvsЖККДИЕВБ}АДЕА|z|БДЕД|wvz|БББДЗД|xx{}|~~БВЕЗД}||АААГЕЗГДГГДГЗКМЕВ~БЖЕЕЖЖИИЖЗКЙИЙКМЗДВВЕЕЗЖЖЖЖЙЙЙИЗЙЗИЖЛППКГГЕИИИИЗЖЕЖЖЕБzpjqБЙД|vlihjqtvwxЗПК}lchrtusogbfЪ│┴┐мЦМВ}zzxw~ЖЖ|tt{НШХКБЙШ│╛╢жЩе╣╟┼│ЧОМЖЕДЖИУл║иТБ}}З{zyz~ЙЗАwrsqzzsqwz~}zspot~{shba\_chqwzywtvx~Б|vxyxw                                                                                                                                                                                                                                                                                                                                                                                                    уlifeeekjgea_^[\_adegkkimplhecfjkotkfqtpinuonyГ|rwВИОК|uГНХЧС~yДМТТХЫд╡ш  ¤╪ЬХЪШЧЧЧЩЫЪЫЪХОЛНМЛЛЛЛЙЙЗЛМЛД{~БЕЖД{БДЛКЖЖЖКЙККККЙКИНОЛКЛНПНЛИЖДГ{|ЕКНЛЙККНМЙЗЙГЕДИЙЖД|zБЖЖГ|vАИЗЖ~ГДВБ}АГЕА|{{}ВЗЕyuy{~|БДЖГ}yy||}БДАГЖКЗzz~}ААБВВДДДЕЕЙМНЙА~АДДДИИЙИИЕЗЖЖЙМНКГБДЖИКИЗЖЖЗЖЗЖИИИИЖЛПРЛЖДЖЙКЙИЕЕДЕЖЕДtlqВЙЗАyrljjoprux}ЕМНnefjqsqnf]d|Цо┐└оЩОБ|}yuuЙКxsxЙХЧМГИЪ╖─└░вм╛╨╥─жСОЙИИЗЛХк║кФДА~АА|{{zМКВywtu{Аxtw|~}zspptБxrojebb_hsz~|xy|А~zxz{z¤                                                                                                                                                                                                                                                                                                                                                                                                   уmiffechhihb`e_cdefeflnjklheccgijntljpsmjqrmq{~sqt~ЙМДtvДОФСЙАЙПУУШаз╖ш■ №╫жЩЯЫЩЩЩЩЩЦШЩШПИККИГЕКЛИЕКМЛЖ~|АЗЙИВ~ГИИЕДГЗЙКИЙКЛМЛСРОМЛНУТНЙЖВАx~ЖКНЛИИЙКЛККМЖИЖЖЖЖВ|}ВЖЙЙ~sАИЙЙЕДЕЖВББГДБ~zz~БЖИАyuy|А~АГКЙzyyz{~Б~ВЕИЗА{|ААГББВДВВДЕИММЗА~~ДДЖЗЙКЗЙЗЖЕЕЙЛОЗДДГЕЕЗЙЙИЗИЙЛКККЙИЗИМПКГДЖИИЗЖЕДДЖЙЗГБ|vuАЙЗВ|vpkjlmpvx{ЖРОБndfgkppkbX[vУл┴┴▓ЭПГА}yut|МРЕ{swЖЦЧНЕЗЧ╣╩╟╖мп└╙╪╦┤ЮТМЙЙИИПд▓йУД~ЕГ{zx~ККЕ|vst{Г}xvvy}yuqrv}А}uqpnlhcblz|zuuv{А{|~~z°                                                                                                                                                                                                                                                                                                                                                                                                   ╫kfedbbgikjg`_Y[^_ccajlimojgdefginpffqupmrokq}БqlxИНКАrtЖРУОГwВНСФЦЭз▓╖ф·■°╫мелибЬЦЧУТХЦЧУМЖИЙИЖЗНКДИЛЛИВz|ЕИИВ~~ВЙИЕГЕЗЛМЛЛЛККИПУРНЛПФХНЙЗИИВБЖЛМЛЙЗКЛЙИИЙЕЕГЕЗЖГА}АЕИИАt~ЖЙИГЖЗЖВББВЕВ~||АВЗЙГ{xz|}}~ГЗЙБzvy{}БББВЖККД||||}ББВВДГДЕДЙЛПКГВБДЖЗИЗЗГЗЖЖДЖЙЛРЛЕГЖКЕЗЙКИЕИЗИЖЖЗИИЗИНРМДВДЗЗИЖЖЖЕЖИИЕА}y|АЗЙД{vtrmjknux{ЕООГpeadjpoi_TYqСк╜┬┤бСГ~}ytt|ЛРЛ~wvДФШПЖЖФ╢╠╠└▓▒╛╘▌╘╝еЧПОНКЗКЩлеФЕ|~ЖЖА|zv{КМЕ}yuv|А~zwwz|zzuqrvГvrrw}vnlpyzslefmz|z~|э                                                                                                                                                                                                                                                                                                                                                                                                   ╙lgdccbfmxulde]``acc_mmjllffbdghgmofjppllvnit~}llАКЛИvyЖРРЖ}{ЗРУЧЩвм╕╛╥юїы╥└╝╛╗░иаЩЦХЦШЩФМЕДИЗЖГГДВЕЙОКГ~~ГЙКЕ}~ВЕИЗГЕЗЙЙЗЛНМЙЙОТТОМРФРЗГГЖЖЖЖИМНЛИИКЛКККМЙИГГЖЖЕВББЕКМБt~ЕЛЛЗЕЙЙЕГГДИД{{}АЕЙД{x}}А}АГККВzvx{{}~АВЕИЛД|z}~ББВЕГДГГДГЖЙКИЕГГЖЕЖЗЙЙЗЙЗИЖЖКМПМЗВВЕЕИЙЛЙЗЙИЛЙИИЙИЗКНПЛЗГГЕДЗЕЗИЗЙЙЙЖГА|{ВЗКЗyuuqhekpsyВМОДrea`fnme\MRmМж╝┬╖жТИВ}}wt{ЛХРЗxsДУХРЕГОп╟═─╕┤╛╥▌╪─иЮФТУПИЖХЯЯФЗ~ЖД}z{ИЛЗ~yww}Аyutwz}|uqqwВДursyyyrms~zpe]^gsy{А~▀                                                                                                                                                                                                                                                                                                                                                                                                   ╔jfaaabfqnbcZ]]^bbdkijntjmfeffhqoaipnmlrkgs~zhlВУПЗА~АКСКББДЛПФЦЩе┤╝─╠╘┌█┘╪╒╤╦├╖маЧХФФШФМЖЗГ{tyДДВГЖККЙ~{ВИКЗВ~ВЖЙКИИКЛЛЙЛНМИКРХУМЛМСНА}ВИКЙЙЛНОНИИИЗЗЕЕИИЕГГЕЗЖДБГИНРЕt~ЗЛЙЗЗЙЗЕГВЕИЕ|y|АЕИДyuy}~}АГЗКЕ{vw{{~ББАЕЗЛЛЕ~z|}~ББВБДДГГВЕЗИЙЕБВГДЖЗЖЗДИГЖЕЖЙКТОЗДЕЗЖИИЙЗИЙЙЙЖЗЖЖЗЖИНТПЗЕДИЕЗЖЗЗЕИЙИЖДЕВАВЙМЗ~yvutnijlrxАЛРЗxke`cficVLQkИг╜┬║иУЙГ}}yw{ЗШШМ|uВСШТЙГЙж├═╚╛▓╗╨▄┌╟│дШЧЦУКДНЬЯЦЙ|{ЕЗyxx{ЖМИ}zw|ГБ{vsrx|zwrpvАЖxsrxzttx~tgc]apzxx||y╬                                                                                                                                                                                                                                                                                                                                                                                                   └lgfdccht{xnfi`_^]`ackkjnmeg`defgrnemomjnwiiu~xeoЗОЛЙКММНЦИ{~ЖНСХЧЭй┤╣╛┴╩╨┘▌уфт┌╥╔╣обЫШХЦФУЙД{qlk{ГВДКММА{~ЖЛЙГ~~ДЙИЕЗЗЙЙИМОМККОФФРННТКzxЗКМККМООКЙИИЙЖДЕЗЕГГЕЗИИДГЗЛТЙzАЙММЙЗЙЙЕДГЕЙЕА{y{}ЕИЕyuy|~}~ГИКЗ}vxz{}~~ВЕЙЛЖ~{|}}ББББГГДББДЗКМЗАВГЖЗЖЖЖЗЖЗЖЗЗЙОРЛДБДЖИИИЗЗКЛЛЙЙЙЛЛЗКМПОКЕДЕДДЕЕЖЖИИЗИЖЖДЖЕКМЛВwwvuqojhpw~ЙОЗzqhb`ba]TFNhЗб║─╜мЦОЛДА{yzДФЩР|xГНФСЙВЖб╜═╬├╣╗═┌┌╬╣кабаЪОЗЖЦвЬЛ~|АДА}|yzЕНЗ{xy{Б|wrrx{{xsptГАyusx}{uszБАxnjfep{|{}}z╕                                                                                                                                                                                                                                                                                                                                                                                                   ╕jfedaahotqia_[\]\_admhjrsgieeefjrobmrpmptgjxserКСПНТЦЧУРВxВКОПУШЮек┤╡╢╠█рфшъъц▐╘╞╕йЮЩЦЦХФОК{l_cr}БАВЕКНА{~ГИКЗ}ГЗЙЗКККИЗКНОММСФУНМЛПЗzw}ЗМОМКЛОСМЙИЗЕВВДЕЕГЕДИЙЙИЖИМУМАГЙЛНЛЗДЖЖДВЖЙИД|x{АЕКЗ|xy{~АВИКЙ}vvy|~ГДАБЕЙКИАxz{|АБББГГЕГБДЙМНЙГГДВДЕЕЕЕЗЗЗЖЖЙЛНРОЗГДИЛЙИЗИЙЙИЕИЖЗИЖКМУУКЕДЕДЗЕЕЗЕЗИИИЗЕЕЗДКНМД{zyyvrnjmq|ЛСЙ|ukf_^_ZMGMhЗб║╞└▒ЪРЛИАzz{БТЫФzГРЪЦЙБЕЪ║═╤╟╣║╞╘┘╙╜мзклдХКЕХЯЫН||ГЕ{zx{ВКЗБ{xxxАГ~ysuzzzxsor|В{tsz{xvzВ{upknrxvwx{zа                                                                                                                                                                                                                                                                                                                                                                                                   мmheccdijjihfc^`]]_agnkmnmgfaeeejqngnojituej|~sgxОСРХЫЯЫЧОБЕМУУЧЩЬЮЯжЧ╡╫цшыыыььш▀╥┼│жЫЧХЧХОЛzh_]l}Б~БГИНВ}}ВИЛЛ}ГЗЙЗЙИЙЙЙЛОПЛМОУХРНКЛВxw|ЕМНКИЙНОЛЙЙИЙЕДДЗЖГДЖИЙИЙЗИЛСОИЕИКЛНЙККЖЕГЖЙКД|yy~ЕЙЖ}yx|АААГЙЛЙАwzz}~АА~БВЗККА{}}ББВВВДГДБГЕЙМОЛГВДЕЕЖИИЗИЗИЕЕЙЛОПМДВДЖЙЗИИЙЙЙИИКЙКИЕИМРТНЕВЕДЕЕЖЖЖИИЙЙКЙЗИЕЙНМДz{{{xtqlklzЛСЛ~wni`\[VIBIiИа║─┬╖ЭТЛЗБ|zzБНЭЪГ~ГНЩШКАДЦ╢═╘╦╗┤└╨┘╒├╖▒▓╢▓ЭТЖОЫЫР}ГЗДБx{АЗЖВ~xyv|А{suy||xtppzА{uqw|zxtzАzyxvsu{xqqvxД                                                                                                                                                                                                                                                                                                                                                                                                   пmfbbabeefhiic\^\]_cgkikqqjiedefiplbhjkkpqfl{~ql{ПУХЫгзбЧЙ}БЛНТФЦЧШХХЩд─ю∙ўэщщэюьч█═╣йЩЦХФЦХПm`^h}ГА}АДЙГА|АЗККА~ВИМЙЙКЛКЛНРСМОПСРМЛКЖАysyГКМЛКММНЙЗЖЕЕГГГЕЖЕГГЗКЛЙКЛНССККЙНОМЗЗИЗДВЕИКЖ~zz~ЕЙЗ~xw{~А~БИЛЛА{z~БВВБАВЕИЛОx}~БББВВДГГГДЗИЙММДБГЕЖЖЗЕЕЖЗЖЕДЗКППМЕГЕЙКЙИИИККИЕИИКЙЗИКТСНЙДЖЕЕДЕЖЗЙИЙИИИЗИИМПОГyxz{zxsljiuЗРКАyqkb[VQECHhЕЭ╣╟┼╢бРМЙД||y}КЫЭЗ~~КШЩМАГФ▒╦╫╧╜┤╣╠┘┌╩╗╕╖┐╜мФМНШЬТГВДЖГА|z{}ДЗГА{yvГБzsty~|ysmoy}{wsw|{ywxАБ{xwxwtwuohlvw                                                                                                                                                                                                                                                                                                                                                                                                   Фlgdecbbaejrwmac_^_`ejkllhbdceefkokinhdksnbl{ylhПУЫазйдУДБЙОСУЧЩУНКСбп╙·■·юцхыююыф╓┼╡вШХТФФРВtbXg|ВА~}ВНЕГ~ЕККВБВДЗЗИММЛЛМОРОПТУЦПНИГА{wvВЙКЗЗКЙМКИИЙЗГВГИЙИЖДЗКЛКЙМНУТНККМНПККЙЗЖВДЗКЖА{{~ДЗЗАxtАААГКММБyx|АБААБЕИЛПБz{}ААГБГГГДБДГЕКНОДБГЕЖИИЕЕЕЖЕЕДЖЙНПКЖГЗЙЙИКИЙКНЛЙЙКЛКИЙКТХРЖБДГЕЕЖЖЗЙЙМЛЛКЙИКПУТЗ|{zyywwqjjrГОЛВ{tnc[WND@MeАЪ╕╟╚║вСЙИЗБ|y|ЙЩаМА|ЙЩЮМБГПн╔╓╨┴╕╖╚╫┘╬└╗╝└└╡ЬОКЦЫФЖББЙЖБ|zz}ГЕВ}yzw~ДГ|ssx~}zxqpw~|wru||xvyА{xuuwu{yniipv                                                                                                                                                                                                                                                                                                                                                                                                   Фjecdcbdfcl{ЖnZ]]^`_ehilnkhgeedekphehjipwnao{xlmАМПЧЯдзаМАБКПРЧШФЗЕПЭл┤█■ √яс╪хыээч▄╩╣жЩЦТУФСЗ}l\h~Д{~БЗЙГ||ДЙЛГВВЕИЗЗКМЛЛООСМННПСРНЙДА~yvБЖНМЙИЙЛЙИИЗЕВГГИЙИЖЕИЛНМЛКОСУПЛКМЛЛЙЙЗЖЕБДЗЛИА||}ГЙЙВ|uy{}~ДЗКПВ{y|ВГЕГВГЖИМНА{{|ААБББДГДДЕЕЗЛОНИГГЕЕЕЕГГДДДЖЖЕИМСОИДЕЗЙККИЙИЙКЙИИККЙИКТЦСЗБГДЕЕЖЖЗЙКЙЙКЙЙИЙПУУИzwzzyywvpjrБКЛГ{vqd^ULDESi~Ч╖╞╩╛жТЛЖИГ|y|ДФбФБ{ЗЦЬПБГНж┼╪╙┼║╢─╫▌╙┼┐╛┼╞╝гОЙУЫЦИГАДДА|{z{ДЖГБ|zx~ГД|squxzzvprv~}wrtz~zxzВ{yrlknuzqfiou√                                                                                                                                                                                                                                                                                                                                                                                                  Йmfdedceedn|Иp^`^`_`eijlmeecbdbdlmginifpwogq{vgnВКНХЫабЧД~ВЛТФШХЛЕЙЦжо╕с  ¤Ё┘╧▌цыэъф╙└мЫЦТУХТЛ~pcmЕД}{АЗЙЗАВИЛЕВВГЗЙКЛКЙКНОУОООРСОЛЙЖГГ{rБЕККЙИЙМЛЙЗЖДГДДИЙКЙДИЛМНМЛМСХПКЛМОМЛМКИЕГЕИИДА|y~ВЙЙД|x{z|~ГИКОГ{||БВГАБВДЗЙЙГ~|~БАГАВГГВБГГЖЙЛЛИДДЕИЗИЕЕЕЗЗЖЗЕИМПМКЖВЖЙЙИИИЙММКЙККЙИЖЙТЧУЗВБГДДЗЗЙЛЛЛЙИЙЛЙЙМУФИ~zyzwxwwrmrАОПЖ}xsh`SKDESkБШ┤╔╦└кУКЙРЕБ||АОЭЩЗ|ДШЯПВБКа┐╙╒╚╛╖├╫▀╫┬╜╗┬╟└зРКРЧХКВАЗЕГ~{z}БДДБ{ys~ЕДtrrxzzyvtw~{wsw{{zyy~Вzskikwxumjqvї                                                                                                                                                                                                                                                                                                                                                                                                  ЕmecdcefedmzАj`__``_dggmplieeeefmmbfiijqrhitytmwАВБЖПЩЭП}ЖМРУЦПЕДПЩйп╗у   є╨┐╥▐цыых┘╞░ЫХУСУФНГtgpБЖЖВ|{ЖЛИ~ВЕКЕГГДИЙМЛМЛМНООООННПНОНИГД~zЗММКЙЙКЛИЗЖЕГГВЗЙКЛЗИЛННККМРФУМЙЛМНМКЛЙЖЕЗЙЛИГ{}БЙЙД|wyz}}БЖЙЛЕ~{~ВВДАБВВДИКЕ|{АББАВГГБВЖЕДКОРЙГДЗИЗЖДДЕЖЕЕЗЗИЙРСМЗЕЙИЙИИЙИЛИИИИИЗИЖКРЧФИЕДВГДЖЕЕИКЙИЙКЛИИМРФМxxwwxxwsps~МПИ}xtmaSHCGUmБЧ▒╚╬┬оЧККФОВ{{{ЙЫЫМБДЦЮРГБИЩ╢╠╙═└║┬╘▌╪╚┐╛└┬┐кУНПЧЦОД~ДЖГ}{z{АЕЖДБ|x~ДДttrvxzyvtsz{vsxz}zxx~Вzqjeivxvlkquш                                                                                                                                                                                                                                                                                                                                                                                                  ykdedffgdejptfcdba^[afglkfeabedhnldmpiiqujkvzrhwБ|{}ДСШВt{ДМТШУГДСЭзм╖ф   Ў╞п┼╘▐хщх▄╦│ЭХТРОПМЖyswБИЙЕ|{ДЛКВ}ДЙЗЕДДЗЙИЗЙКЛМОССРНМРУФРЙЕЖzВЖЛЛМККККИЖЗЗДВВИЙККЖКМОСОКМСУТММНННКККИЗЕЗЙЛКГ|y~БЕЙЕ~vy{}ААДЛМЗ|{АБВАББВДИОЖ{ГВДАДДГВАВБДЗМПКДДЗЙЙЙЖЗЖЗЖЕЗЖИЙНРНИВИИЙЙЙЛКЛКЛККЙИЙИЙСХХЛЗГДГДЕЕЕЗККИЙКИЖЖЙПСНБwvuuwzyurr}ЛПЙАyumaRFAEZrВФ░╟╬┬пШММТПЕ~{zВЦЯРАЕЦЯТДАДУн╩╓╨─╗┐╨▄╪╦┬║╜─┬пЦОНЦЫСГАЖЖВ|{{}БДА}wsЖЖ~vtsvy|{xtv}}vsvzzxwwxxneahtwunnqv┌                                                                                                                                                                                                                                                                                                                                                                                                  rkfcefgiedghlcda`a_^befkmhkffeehpkejkgiwwgkwwpj{БxsxАОТzq{ЕОУЧЗ}ЙУЩвд▒у   ї╛е┤╟╙┌рр┘╔░ЭФТООНКИ}xzГККДzxВЙИВ~|АЗЙЗДДЖЛНООМККМРТСНОПУПГДДЖИДГИЛММККККИЖЖЕВА~ЕЙЛЙИЙЛОРРМНСХУМЙКММКККЙИЕЗЙНЛЕ}{БГЖЙЙtvz{{АГЙМИ~y{АББААББЖЙМЗВ||АБББГГГДБЕВДИНСНЗДЕЕИЖЕЗЕЕЕЕЖЖЙКРТНЗЕКЙЙККЙИКИЙЙЙЙЙКККРЦЧНИЕЕЕДЕЕЗЙИИЗЙККЖЗЙНФРГywtsuyyvvwАОФМ~zsl_QC>I^qБУп╔═┼▒ЫИЖСУКБ{y}ТаХЖЗЧЯЦЕАВПд┬╒╙─╕║╩╒╫═├╗╣╜└│ЧОКУЩСБ{ЕЙД|{{z|БГБ}xw~ЕЗ~wtrwz{zxrt~Г~vrtx|ywwx}{vja_fsxtppqt└                                                                                                                                                                                                                                                                                                                                                                                                  skffefeeeeegmnnhaa_]ffgiiffadeegnidpmfjsrilwxok~~tnwЕПМvr|ЗРУФ{ГЛТЦЭЭл▐■  Ў╗Ям╣┼╨╫╪╙─░ЫУТНМКИЕБ~~ДЛМЖzw~ЕЙГ~{АЕЙЖДЕЖКККНОММНСТСННРТИ{~ВЕЕДЖЙМПНЗЙМКИИЙИГБВЕЙЙЙИЛМПУСЛЛТХХНЛММПКЙЛЛЙДДЗКМЖ~yВЖККВuty}~АГИМЙБzz|~А|ББГЕИОКВ||АВДАГВДДБГВДИМСПЙВДЗИЙЗЛИЙЗЗИИКЙНУРЗВЖЙЙИИКЙЛЗЗЙЙЙЙКЙКОУФПЗДЕДДДДЖЗЙЙЙКМОКЙИМУТЖuqortyyxxzБЛТМАxqi[OFAJ^sГУо╔═┼╡ЭЛДЛУНВ}x|СбЪМЙЩвЧЙВВЙЬ╜╨╤╞┤╢┴╤╒═├╗╕╣╜┤аОЙПЩРБАЕЗГ~|{zz{АА}xwЗИwtsvz{zxss{Аwruwxwvsw~sg[Xcrwuqmnvл                                                                                                                                                                                                                                                                                                                                                                                                  rlfdcedddacajnjfcc`^begnqjieefeinifiedlvpenwtnp{qo{ЛНЗww}ЗТФКu}ЖНУХЩЪ░▄№  є╣Югн╢┐╟╚─║мЪОНМЛЖЖИЖЕГЗЛЛИ|y{БЕЖ{БЖИИЗЙЙНМНННМММСУРНОСТД{}ВЗЙКИИЛОМИЙЛКЗЗЗИДВВЗККЛЛКЛОУУПЛОФУНМЛКНМЛЙЙИДГЖММЗ|АБЕККВxwyz}АГЕММВ{y|ББАВВГЕКННЕ}|БВББДГЕЕДЕГИКНРПЙВДЕЗЖЕЙЙЙЖЗИИЛЛРУСКДДЙЛКЗИИЙЕЖИЗЗЖЙКЛНФШРДГЖЖЕЕДЖДЗИИЙКНКЙИНФТЗumlptxxxz{ГМЦРАxqgVJDCM_uДУн╚╬╚║бЛДКОЛЕ}~ПавХОЪдЭНГ~ЖХ╡╧╙╟╖│╕╬╘╠├║╡▒╗┤ЯРИМФСВ|ЖЛЕ~|{zyz~А}yxЗЙАyusux{zxrs{Аwsswyxvvx|~reZWarytqnovС                                                                                                                                                                                                                                                                                                                                                                                                  pifedeed`_`cm|Иtdd_\behijee_defjohgnlhmspgqxvpt{usuАОНЖ|{АЙСНВАДКРТХЩЩл█√  ї╜еден▒╢╢╖▓жЪНМИЗБ~ДЖЕАДЛЛКАywБЗЗГГЙЗЗЗЗКНОООНННПФФРППТБuzАЗММИЙЛМКЗИЗЗЗЗЙЙЗДГЖЛМННККПСТМКОУФРМММННЛМЛКЖВГЛОК~{~ВЕИЙВzux|~АГИМОДxy~А~~БАВДКНМИБ~БГГБДДДДДЕВЕЕМССЙБДИЗИЖЙЙКЙЙЙИККРЧТЙГЕЖЛЛККЛМЙИЙЙКЙКЙМПФЧТЖАЕЖЗЗЕЗЖИИИЙКМКККМУУЙsmhlquwwx{ВМЧУВzpaQEEEPbwГУн╚╧╩╛жОГВППЗ|~ОЭджЮЯвбРЕАДРн╦╙╔║п│─╨╦┴╣▒ннпвПЕЗСТЖДЖККВ~zyy{А~yx~ЖЗБ{vsvx|{{wvzААwsrrwxxuw{{rcWQ_oxwrorv{                                                                                                                                                                                                                                                                                                                                                                                                 ¤ohedcddd_``aqДДqddb`ecflmhjegegkohhhdepwkhswrmtБqmvЖСНЙДЕЗЙЛЗЕЛОУХЪЭ░╫√  Є├пидггегжзбЧМЙЖЕБААДЕБГЗККГxАЗИГ}АГЙЛЙЗЗКЛМНННОПРУСНЛИО~uv~ЖМЛИЛННМИЙИЖЕДИЙИГДЖКНОСМММТФЛЙОСУРННМОНККМКЗГЕЙМЛАz~ВИККД|yx{~ББЕМОЕzz~БББББГДИНПЖ||БВВБВДДГДИЕЖИМУУЛГЕЙЗЕЕЙЙКЙЙИИККРФУЛЕЗИЛЙЙЙИКЖИЕЗИЙКЙНПХЩФКДЖЗЗЕЕЖЕЗЖЖЙЙККЛЙПХУИwmilpuwux{БЛХФГwi]OECIVgxДУн╚╧═└иРД|ЙСЛБ|БЛб░оаалжУЕ~БОе╩╤╔╣лл╝╠╦─╕ндооаНДЕСХЕВЗЛЛБ~{zxy~Аzx{ЖИВzusuxzzzvw{}wtstwxyxx{}rcXP\kstsqntu                                                                                                                                                                                                                                                                                                                                                                                                 ¤qiffcddcadceowyndb`bedfigfeaddfjmhknigmpgfwwqqtunoyВМОРУФУХСvБКМРУФЬЬ▒╫·  ю╚╣░заЮЬЩЫЭЭШЗЖГБ~~ААВ|ВЕЙЙГБ|БЖЙЙ~АГЙЛЙИЗКЛМНМОНРОФУПМИИ}st{ЗННИЛЛЛКЖИИИЕЖЙЙИДГЕЛПРУНМНСТЛЛОРФСМЛМННММПЛИГГЙМЛБ}~БЕЙКЕ~y{~АДГЕЛОЕzy}АБББАВГИМПЗ|БВДДГВДБВДДЕЗМХЧОДЕИИЕЖИККЙЙЙИЙИСЧФЙВЖИКИИККЛЙИИИЙЙККЛОФЫЦКБДЕЕДЕЗЗЙИЗЙМНЛЛЙЛХШЛ{qhintvux{ВКХФЕugYLCDN\lzГТо╞╨╨─нУЕ}ИНЛГВКЮ│╖лвкйХЖ}~ЛЪ╛═╔╖ии╡╔╔┬╡кЯзпЯОГЕРУЙАДЛЛ|yyxy|}yyzАДБ{wttx||zxxz}zttpquvvvxy}tfWT\mvvtpnrs■                                                                                                                                                                                                                                                                                                                                                                                                ·rjedcddb`a_cjjiigcb`cdfmmkkfiffinhjhdfqqdgstpnwzjkzИПТШЭЫЧХЛy~ЕЛОТХЫдн╖╘ў■·ы╬─╗нгЧХУХХЦФЛИБwrryЗz}ГЙКЕГz|ВЕЕВГГЙЛЛКИКЛМНСТПОНПРНЙДД|vryЖЛЛИЛММЛЗЗЗЖГГЖЙИЕЕЗКПСФНООУЧПМНСФТПКНППНЛНЛИВГИККА}~ДЗЛКЗАyy{}АЕКОЕ|{ГГГГВДГИПСЕ||~ББДДДДГДЖЖЗЙНХЩНДДЖЗВДЗИЗЗЙЙККЙРЦЧМДЖИЛЙЙИЙЙИЖЖЖИКЛЛЛНФЪЧМДЕЕЕЖЕЖЖЖЖЖИКНМККМФЧО}ulhkpqpuzАЙУТЗvfUHABManyГСн╞╥╙╟│ЦК}ДРСИАЗЫн▓ндииЧЗББЖХ▒└┬╡ба░┼╟┴┤лЮЮгЩЛАЕОСИДЖИЖ}{xxx|~}{yzВЗВxvtvy~zwyz}zxvrrsxyusw}wgYR`pttsoprv∙                                                                                                                                                                                                                                                                                                                                                                                                ∙qiedbb`^^_bgjjjkjgbacceeffbbeffmmilnhhnleiusprwqhl{ЗОХЯдгбЩЗxАЙМРХЫбн▒╜═уєєх╥╨╞╣наЦУХЧШЦНИwmfhn{z}ВЗЛИЖ|}БЕЗДДГЖЙЛКЗКЛМЛОТПСПТТМЙЖЕ{uyДКЛГИИЙКЙИЙЖДГЕИКИИЙЛПССМЛНРХФОМРХТНЛНОУПМЛЛЙВВИЙЗААГЕЙМЛВzy|{|БДЙПЗ~}БАББВВВЙМСИ~~~ББДЕДЕБВДДДЕМХЫОДДЖИЖЖЗЙКЙИИЛЙЙПЦФНЗЙКККККЛЛЙККЙЙККККМФЪЪМГГДЕЕЕЖЗЗЖЖИИЙКЙЙОХШОxojiknnrx~ЗФХИtbTE>CM_kxГРк┬╤╓╦║ЭОГДСЦЛАЖХк▒бФзкЩИАБНв║╗░ЫЦж║┴╝░дТЦаЧЙАБИРЙДДММГ}{xtx|}zxx}ЕГyvsxyzzwxz~~vtqruusqqvywk^[fuxvsppstю                                                                                                                                                                                                                                                                                                                                                                                                Їokhfdbdb]]^bbchjhgbaaadfghfhifflllmgbgpohkusqs}vgnМРЫдйивЦБuВЙМОХЬй┤╜╟╬╘▄ус▄╪╨├╡зЩТХФХЧСЛВvf\\j|||ЕЙИЙz{АДЖЖВАЗЛМЛКННООСУПРНППНЛИЗГ~wzГЛОКЙКЙЙЗЖЗЖГГЖЙКИЗИМОРТРНМСХФННРФТНЙНППЛКМНКДГЖЛНГ~БГЕИММЖyx|}~}ЕЛНЕ~|ГБВВВВВЗНСИ~||А~АГГДГДГЕЕЗМЦЬПДГДЕДЕЗЗЗЖИЙЛЛКПЦШОДЕЙЙЙККЙЗИИЙЙЙККЛМНФЪЫНДЖЕЖЗЗЖДЕЕЖЙЙЗЗЗЙНФШТГzrnjdgkov}ЕПУЙu`QF>AN]hsНз┴╨╘╬╜дС~ВТЧСВАГПаиЯСдйЩИ~|{ЖФк╢иХРЩл╢┤мбПОЪШЙААВЖКЖДЗЙДБ|zxuv|А{wxАДДyvrsw{ywxx}~ytruurqkiswvndbp{{wtoorsс                                                                                                                                                                                                                                                                                                                                                                                                ёrkgddadb_^]aaekxАsebd``ebeaaebgnkinmghlkgptqnvueoВЛТЬелйаТВБДКНПФЮо║┴╔══╨┌уфт█╨├▓еШХТТХЦТЗ}gZXbxБ}}ГККИ}{~ДИЖВАЗЛНЛИЛЛММОУСРПРТХСЕЖЕБ||ДЛКИЙЙЙЙЗЖИИЖЖЗЙЛКККМООУСОНРЦЧНКРФФПИНОСНКЛМЙББДКЛЗБ}ВДИНЛЙ}{}~ААЖЛОИБ}ВАБББВВИНСЙА{|ГБДГВВБВАВГЗЛФЧОЕВЕЗЕЖЗИИЖЖИКИКПХХРЙЗЗЗЗККЛККЛЛЛЙЙЛЛКЛТЫЭНЕЕЖЗЖИЙЖЕЖЙЙЛИЙЙЙМФЦРЕztpkd`fls{ЕТЦЛvaPD=DNZfo{Лг╜╨╓╥└кФГВПЩЦЗАИХЭШСЯйЪКyy}ЙЫвЬРМСЫзлзЬСПХХЙБАИЗДЕЙКЕБ}zxvxzz{xw~ЖЖ{vrtxzywvz}~yvsrqokhfnvxrkoКД}wrnoqr╧                                                                                                                                                                                                                                                                                                                                                                                                ёqkhedcc`_^_b_co}В{cbd`befheiiehnkkmfahnlintlltБqesГИНЪвдаШК{|ЗКЛПЦво╡╝╟╩╔╤сщъщх▄╨╛░бЩУТУХТПЕm[U]tВВ~ВЗИЗБ}|БИЗВБЖКММЛННПНПТССПСФХКДЗИЕ~~ЖМОККККЗЗИЛКЗЖИИКИККМНПФУНМРХЦОЛРХЧПЕЛНПНЛМНЙБ~ВКОИА~БЕЙМОЗwx|}АБЕЛПКВ}~ЕБВВВВВЙПРЙВ~|ААГГВГДДВЕЕИМФШРИГЕЖГЕЗЗЖЕЗЙЛИКОЦЩУНЙКЙЗЙЙЙЖЗИЙЙИЙЛЛЛЛРЪЮПЖДЕЗЕЖЗЙЖЕИЗКЙКЛКМТЪХЗ}vtokcbhoyГПШПzcQCAKgР╕╦╓█▄▌ртур▀ррс▀стууууууфухццфцчшчхцшчччшшчхфццфс▀▌▄╪╙╥═╟║т                                                                                                                                                                                                                                                        у~urolkjgffggececd`_``dklhgifhggghghgmlmqyЙРyjgb`eh_bdbaind_iwГМХг░┤огаЫЪг║╧рц▌╫╩╡бУСТСЙypies}ГЙМЛЛЙИЙМЛЗГДАxnmyДДГГЗКЖЖЙМОННСФШШФТЦЭЪЩЮимлзиооеШШз│наво┤лдзпозд▒┤нЭЯ░║▓ди╡╣оЮд│▓жЪд┤┐▒вн╜╦└ЫТн╧╘┤МЙИЦ╗╩╝ЦИААВИХ╢╦╕ЦЕГБВВГДЗСк╟═░РЖЕГЕВЕЕГДВЕЙРЫ╝╘╪╗УОЛМНККЙМКЙННСФ▒╥█╩жХРНМКНЛНМММНСПУХа╢╠┌╪─еЦТПОЛЙКНЛЛММППУЬ┤╨ф▀└жХНКЛКЙНУи═ъш╨╗└──┼╗м│└┼┬╖╡щ■ №э╦░░пЮЛБЗХЧНД~М│ъ¤№ц║Рr\V\dhoБПЯ╗▌°¤ў┌║ЫРЛТгжХФ╧Ў·хкЦЮногЧЧв▒╧шь▐┴╔┼╣нлп╢║о└▄┌┼елйлп┤╣╣╝╬╩┐│кЮШУХОЕГНЫм└╨╫┘┌┌┘┌█▄▌▌▄┌▄▄█┌┘┌█┌┘┘┌█┌┘┘█▄█┌█┌▄▄▄▄▌▌█┌┘╫╥╩╚╞╦╧╙╙╙╓╓╘╥╧┬з^J?=ETwв┴╥┌▄▄рср▀рсстстуххуфуфутууцуццчцхчшчччщшщцчшшцфуус▌╪╫╙╧╞└┐Є                                                                                                                                                                                                                                                      ┘xqqnmklfgfegfdfdec`bafolfccbfehighhdgimszИТvljffhg[^caaite_kw~АИСЫм│наШЙМХ▓┌ёЇш▀╓┴лШФТПИtjlyА~ВИЛММЙЛОНОНКИВ|nixАА~ВККЗЗКМРППСХЫЪШЦЧЬЬЫЬз░оежн▒зЩЪи▒мабо┤мгкпмдг░╖обЯп║▓зй╢╕▒Яа┤┤иЪз▓║╖жл╜╬╔аТо╤╒╕ПЙКЦ╣╩╜ЪИ}||ВИХ╡╧╜ШЖГББВДЕКУе┼╬│УЖДБДБДЕЕДВЕЖРЫ║╒┌╝УРЛККИЙЖЙЗЙКЛСХ░╤█╠зЦСОМКЛКЛЙККЛМЙСУЮ▓╔█┌┼жЧУПМЛЛЛМЙЙЛКНОТЬ▒╧чр─йЦОКЙЛЙНУж╦ыъ╥├┴┬┼╟╝о│┐├┬╝┤ц№ ■Ё╬┤▒мЮОЕГХЪТЖВЙпщ¤¤ъ─Хugcj}ЗВ~ЙЪ╕▄Ў¤√ф╛вТМТджХХ╨Ў·ш┤ШЭмодЩЩап╧шяу┼╞─╕оо▒┤╖░┬▄▌╦йжло▒╢╗╕┬╧╠├│иЧФССРЙГЛЫм└╨╫█┘┌┌┌┌┘█▌▄┌███╪╫┘┘┘╫╪┌▄█┌█▌▄▌┌█┌█┌┌██▄┌█┌╪╒╧╠╔═╤╙╘╘╓╫╪╓╘╩╗ТhRA;?HeР┤═┌▄▌рсрррсссртуухтфхфуфцччхцччхфцшшччщшщчшшшчххццс▌█┘╘═╔─╜╘                                                                                                                                                                                                                                                     █yrpnmkkkhhhhfdecd``bahomhfhcfeijiikhhjmrx}Еsrofafd_bb_ajk__lwwv|ЖТайеЦЙГИТ▒у№·щс┌╔▒ЦСРМЙВynp{ЖЗВВЗЛМНЙЗЙММОМЗБsmyБББГЗКЙИКМНСССХЫЯЬЦШагЮЯионжжн▓кЩШзойгдн▓никпозв░║▒дЯп╝┤ин╢╖│кн▓┤кЬЯ┤├╗йл╜╥╬дРн╥╫╝СИЖФ╡├╜вКА~~ВЗУ╡╥┐ШИВБВАГДКРг╞╤╖ФИЗДДВДЗЕВВДДПЪ╣╓▌╜ХРЛКЙИМЙИИКЛНРУ▓╥▄═мЧПНЛКМЛМККЛММЛПТЫ░╔┌▌┼жШУПМЛЛЛМММНМПОУШп╧шу╟нЦМККЙЙНРг╩ъы╒╛┐┬╞╞╛ен╝├└╜║ф√  Ї╥░лйЮРГБСШУЖВЛкц■■я═ЯzmoОРМВБУ▓╪є№¤щ─зУМТгжШШ╨Ї√ю┐еблнжЩЩЭо╤ъЄц╔╚┼╣▓▒▓╖╕▓─█р╤░пл░│╖╝╣╞╘╥╔╖лаЪХЧТЖБКЫм╛╧╓╪┘┌┘┌┌╪┘▌▌▄▄▄┌┌┘┌┘╪╫╪┌█┌╪┌███┌█┌██┌█▌▄┘██┌╫╙╬─╔╧╙╒╓╫╓╪╫╘╧├з|]F;<@WАе╚╓█▌▀рссрстусфчхфтхцфуфццчууцчцхцчцчшщшчшшчшшцччцусс▀┌╒╨╠╚┬╛°                                                                                                                                                                                                                                                   ┌wqoonlnkhijijikegcaa_iqoebc`efjjgihhhilqvwqrsoihje\`_]^jp^_lxvpr|ЗФЯЫИАzДТ│ц■№щс┘╦┤ЪРНЛКЕ~orАЖЕГДЕЙМММЛНМЛКЖГБ~vt|ВААВИКЙЙМНПСТУШЮевЩШгеЯЯи▓▒жео▓йЫЭжпндгз░нзж░░жд▒║│жап║╡нп╖╜╢йз│╢▒зео┬┐лз┐╫╥иРй╤╫└ЦИЕТ│┬╛еК}||БЕР╖╙┴ЩЗВБДВДЕЙПа─╘╝ЦЙЗБДБГДДГВДЖОХ╢╥┌╛ЦРЛКИЖЙЗЗЕЖЙЛНУ▓╤▌╨▒ХСРМКМКМИЙИИМКПТЫо╟┌▀┼еЩФРНЛККМККНННМТЦн╤щх╦░ШПМКЙИНРЯ╩ыя╪┐╗╝├┼┐км╖┴┬└╛с√  ї╒╖гдаСЖОШТЗДЛжх■■є╥д~БКШЮЦДВР░╥є■ э╞лЦОУджЦФ╬Ї√є╔жбл░йЬЩЮ▒╤ыЇъ╦╚╞╝┤▓н╡╣┤╞█у╒│нн▓╡╕╛╗╦╪╫╠╗иЯЦУХУЙ~ИЩк╜╠╙╫┘┌█┘┌┘█▄█▄▄▄▄┘┌┌┌╪╪┘┌█┌┌█▄▄█┌██┌┌┌┌▄█╪┌▌██╪╙╬╚═╥╓╒╪╫╪╪╓╙╦╖МjK=8:HkФ╜╥┌▐▀сссстттстутууфцхффччшццччххцчччшшшшчччшщччшчхфуур┌╪╙╨╦┴╣▐                                                                                                                                                                                                                                                  ╒xrrpommigghhfcd`c`_cahpmgedafffffhhgljikkmutvqhdgf`d^\bil\`nupdpwДПФОzrxЖТ┤ъ №ч▌╘╞│ХНКЙЙИsxАИЙЖЗЖКМНМИКЛКИГГГ~ywИЕБВЖОМННОРУХТЧвиеЫЮзжвби▓│ли░▓мЪЯй░лижилмйеп▓йж▒║╡иао╕╕▒п│╕╖░в│╝╢мв▒┬┐пм╛╒╙йПз╬╪┼ЪЗЕС░┼─йК~}АВДО╣╙─ЬЙВАА~ББЕОЫ─╒└ЪКЗЕЖДГДЕДВДДЛТ│╓▌┴ЦРМЛЙИЙКЛЗЗЙКМСн╤▌╙┤ЦРПМККМРММЛМММПТЫл─▄с╔еЩУПНМККНММННПНСХм╥ыщ╦░ЦНЛКЙЙНПа╩ыЄ█┴╣║┐┬┐мз╢╜┐┐┬р√  °┌╕кидЧЙВМЪФИДЙат ■Ў╪мВДМРЩаЪИЖП░╤я■ є╦оХНТвжЧЧ╩Є№°╥дЮн▒йЧЧЭп╧шЁь╨╟╟╝╣╢│╕╗▓─▐ч█╝но│╢╝└╛╦╪┘╬╗кгЪЦЦТКВЕЧй╜╦╥╓┘██┌┘┌█▄▌▌┌██┌┌█┌╪╪╪┌┌┌┘▄▄▄▄┌█████▄▌█┌▄▌▄▄┘╓╥═╩╧╘╫╪╓┘┌┌╓╧─ЯxT=67@VВ▒╦╒█▀ссрсттутфуутухцхффцфчуцццчфцчччцфшшшшшшщшшщшчцхфт▀▄┘╫╤╦╟┐┬№                                                                                                                                                                                                                                                ╩wpqoomnihjjlhddcda_``hqnfbc_efeffffdghiihiwwuplkle]c_]akg^cqunepyЖММАpr{ИФ╖ю №ф╬─║мФМЖБДЕ~uzБИИЗЖЖКМММЙЗКЙЕББГВ}}ГЕДБГЕЛКММНТФШХЪглйЭбкнгай▒▒дз░│оЭвз░░кджн░лкн▒мм┤╖┤лио╣╝┤л┤╜╝пв▓╜║нЬ▒╞─░з╛┘╒кСе╠╪╩вККСн─╚нЛ}ААБГН╣╤┼вМДАА~БВДКЩ┼╫┬ЮМЕВВВВГДВГДЖМТ▓╓с├ЩСНКИЖЗИИГЕККМТл╤▐╓║ЫСПНМЛКМЙЛККЛМРТЪж┬█с╠жШФРПЛКЙЙКЛЛЛНЛРЦй╘юэ╤▒ЦНЛКЛКМПЬ╬ьїр┴о│┐┴╝пд░║╜└╞▌√  ∙┌╗ЭейЬЙАМШФЗВИбр ■ў┌нДАРЦЬеЬЛЛПм╨Ё■ ї╧┤ХНТгзШЧ╩Ё¤√╪бЪн░кЪЫЮм╬шЎЄ╙╔╟╛┤┤п╖╜╣╞┌ф▐└▓▓╖╗┐┴╜╦┌█╨╝мгЩЦШЦМБДЦй╗╩╥╪┌▄█┌╪┌┌▄▌█┌┌▄┌█┌┌┘█┌┌██┌▌▌▄┌┌██▄┌▄▌▌█┌█▌▄█▄┘╒╤═╧╘╓╪╒╪┘┘╫╘╬║Й_G<9:MqЭ├╙┌▐стссттттуууууцчцфцшчччшшччхчццццшщщшщшшщшшщшшшчцфур▀█╓╨╠╟└╢ю                                                                                                                                                                                                                                               ╦yusqqppkgghfcbeccbbcbhopife`eefhijjgjihhflx~Вxjhgc^`^\ckfWesrhbrАЙМЗzov|ИТ║Ё №т┼╡йаЦЛБ|yy|yzБКЛКЖГЗКМММККЗ~}ГАГЙЖГДЖЛКНЛОТУЦУЫжййгемоеаи▒│жи░┤оЭбйоомжем│оил▒░н▓║╢пин╣┐╣н┤╜┐│б▒└╛оЩ┤╟─│л╛▄╪лУг╚╙╧░КЕПк├╠┤МАББВДЛ╕╤╞иОГА}|БАВЗХ├╒─бОИДЕЕЕДДВГГДЙРп╓с╟бСЛЛИИЛЛКЗККЛКРм═┘╘┴ЭПНЛМОНМММММЛМОСЦд┴рц╬иЧТННМКЛНММОНРЛПХй╫Ёё╪│ЦОЛКМИЛПЯ╩э∙ц╞нл╣┐╗▒лп╢╣┐╞▄√  √▄╗едзЪЛВКЪХИБИЯр  ∙┌░Е}БНШгЮПППн╬Ё  ·╙╕ЧНТЮдЯа╞э¤■┘еЩк▒лЪЫЧн╔ш∙Ў╫╔╟└╣╖╡╖╝╝╔█шт╟▓▒╖╗┐─┼╦╪▌╙╛▓жЫХХФОВЖЧз╗╦╥╪┌██┌┌▄█▄▌██┌▄┌███┌┘┘┘┌██▌▄▄┘┌▄▄█▄▌▌▐▐▄▄▌▌┌┌┌╪╨┼╬╘╒╫╪┘┌┌┘╓╘┼ШoPA9:BaМ╡═┘▌ссссуухухццффччцфцшшчучшшчцщчшчцшшшчшщщщшшщщшшччхффур▄╫╥╬╔├║у                                                                                                                                                                                                                                              ╩wrrppnojghhjffeccabddjpmdbcbdghhihgdhhjkijwБВwnlj_]_][bkd^gqqhduЕЛМЖ|pw|ЖС╢ё √с║зЬЮХМ}uqpu||АЗЛКЖГЖЙКЛМКЙЙ|wz|АААВЕЕВГГКЛННРУХЩЧЭзмйжипнжвй░▒йк▒┤▒аЯгл▒нжеп│▒лл▓▓оп╡╣│жн╜─╝о│╛┴╡й│┐┐░ап╬╩│е┐▌█▓Хг╔┌╫│МЕНж└╬╖НБ}~ВЛ┤╩├лТЕГББББВЗУ┴╒─еРЖГАБГГДГЕЕИЙРм╓т╩еСЛЙЖЙЛЛЙИЙЙККРл═▌▄┼аРОННННМКММКЙКНРХг┬рч╤мЧТПОККЙКЙЙКМЛЛОУи╪ёЇ▐║ЩПОЙЙЗЙОЪ╚ю√э╩ез│║╣▒дж▒║┐─▌√  √р┐ЪдлбОВЙЧФГyЪ▀  √с╡КБ{ЖХЮЭРПОн═Ё  №╘╝ЩОУЭжШШ╛ъ¤ ▀мбй▒лЧЮЩн╔ш∙∙┘╬╦└╖╣╖╗┴┼╔▄яъ╩┤│▓╡║└╟╔┌с╪─▒зЭЩШЦПБЖЦи║╚╙┌█▄▄██▄▄▄▄▄███┌┌┌█┌┌██▄▄▄▌▌▄┌▄▄▄██▄█▌▌▌▄▌█┌█┌╫╙╧╠╨╘╓╪┌┌┌╪╪╒╠к]E:9=S{в╞╓▐рсрсуфутууфухчшццчшщчццшшчцчшчфццчцчцшщшчшъъщшшшчццчфр▄┘╒╙═╟╛╪                                                                                                                                                                                                                                             ├yutpopsliggfccbac_acchnnfedcdefhikjikhghgjs}Гwjjiabd_[ch^XhsnccyКОНЙД}z~ЕС╢Є №с▓ЦХЩШО~qilv|{БЙНМИГЖКММЛИЕБxuw{~~БКЙЖЖЗМНРППСУЦУЬгкликноией▒╡клп┤пвавл▓певп┤│лп╢╡он╣╜╢лм╛╟╛░▓┐─╢Яо┬┬▓в▒═╦┤ж┐▌▀╢ЧЯ╞┌┌╕МЖМв└╨╣ПДБ~~БКп╟─▒ФДВ}~АБВЕС┬╒╟лСИЕГДЕДЕГДГЕИПн╪у═лСКЙЖМНКИИЗИККРе╩▐▀╩вСПННННОММММЛМНПФа┬тъ╙пЪТОМЛКЙКЙЛЛМЛМОУж╫яЄф└ЫРНКЙИИЛЦ┼я№ї╨бЩн╖╖│ебз│╛─█·  ¤ш─ЯвлвРВЙСМ|uАФс  №ш╝НД~ВСадУНОм╦Ё  ¤╫╝ЫПУЩеЫЧ╗ъ■ у░жн░пШЫЪм╔ш№¤р╠╩┬╛║║╗╛┼╔▀Єя═йл▒│║└╟╟▀ч▐╞│иЮШХХНАЕХз║╚╥┌█▌▌██▌▌▐▄▄██┌┌┌┌█┌┌█▄▌▄▌▐▐▄┌▌▌▌▄▌▌▌▐▌▌▄▄▄┌█▄╪╘╨╧╬╙╒┘┌▄█┘┌┌╙║МiK>:BFZД╣╧┌стуфутуфцтчшшшшшшшшшщщшчшшщшшшшшщшшчщшщщшшчшщшччщщщшщщщшшцфт▐█╪╘═╞┐▐                                                                                                                                                                                                                                     Чtwvvtpoikkkhhihffededjpka__`fghhiihfiiiidffhmuyxrlme_cf[Ybgfditz}ЖУалодбж│┼╪схр╧╕бУТРНДyqjpАДГЕИКММКЙКЗА}{}|ВЖИЕДЕЙМНРННТХХРХЯЮЪЪй┤╢йл│╢▒жп╗║┤п│╣▓ЧЧй│▒жж┤║│п▓╜┴░н╜╟┴нб┐═├╡▓╦╒┬▓╕╟╦┬░░╦╒╧║┤╙ыт╜Ъ╗ь∙┘бМЙЩ╦▀╦гКА{y{ЕШ├┌═ЮЗА{||}АГНз╦╫╔бЛКББВВГБДГДЕПд╠шш╚ЪНКЙКИКЗЗЙЛМКПЧ╛ю№ы╝ЯТОНМОННННМЛММПТЭ─ь¤¤с░ШХРПНПНММЛНККНРЯ┼Ї ■▄иХПОКЛЙНФ░ч  Ї╚вЙОЬвдЪМИЬ╢╤√   ■ф╢ФДsc[RQR\oОз╥∙  ■▐╕ЬФНПЮ░кСНШ╖у   ¤р╗аСШеиЯз▀  ·┌╡гн╕╢ло│└ч  Ў╫╦╚┬└┼─┼╟╔у■■ё╔║╜╟╦╦╩═ь√ў█┐╕│нвЮЫСКТд│─╨╫▌р▐▌▌▌▀рр▀▀▀▌▐рр▐▌ррр▐▌▐▀▐▐▐▐▐▌▌▐▀р▀▐▀с▀▀▀рр▐▌▌▄╫═╩╘▌рфуфццфт┘┬ОaL?>BNxк╚┘ртучуфццццшшшччшшшчшшшшшъщщщщшщщщщщщщчщчщччшщчцшщщщчщщщшшччфс▀█╪╙═╔└Ї                                                                                                                                                                                                                                    Лttstsrpmnmlkhhhfeedefhkifdccgghhhiihklliegghjqwysqre`aaZYeecclvtv~ЛХЪЪЪЦСЩ╖╪щЁш█╚▓ЫШСМЕ{riuБДВГЗЙМНМЛЛИ}xxАААГЖЗДЖЖЙЛООЙПТЦШЦЦагаЮк┤╢зк╡╣▒го╝╛▓п┤║│ЪШл╢╢иж│╗│░│╛╝▒п╝╔─пб┴╦├╕┤╦╒╞▒┤╞╩─╢п╟╫╥┐┤╥юч┐Э╝ь∙▐лОКЪ╠у╤нО{x{ГФ─▄╧аКБ}|~ААБЛг╦▐╬еНЗААВБВГГДЖПа╠хц╦бПКЗЗЖЗЕЕИКЛЛОЧ╜ё№я┴бТНММЛКЛКМЛКНОПФа─э■ ф╡ЫФРПЛЛКЙКЙКЙЛМРЪ╜ё ■умХПОЛККНУнш  ї╬жЛЛХвзЬМКХ╡╙·   ■ч╜Т}jYUOSZcrЛ┤╙·  ■т╝аФОПЯ▒йТРЦ┤р¤  ¤у╛зФЪдкдм▐  №▀╣зл║┤н│╣╟ц  °▄╨╩─╜┬┴─╟╦у■■Ї╤║║╟╩╩╔╦я№·р╞╕│ндвбФИУд┤┴╬╓▌▀▀▄▀▀ссср▐▀▄▐рр▀▀стс▀▐▐▐▐▀▀▀▐▌▌▐▐▀ррссс▀▐ср▀▀▐▌╫╨╠╙▄рттфххфф▀╨ЬlTE?AGgЫ└╫▀тухфцчхццччшщчшщщшщщщщшщъъччшшщчшщщщщщщшччшшчцчшщшчщщщшшччхтс▀┘╓╤╬╔┐■                                                                                                                                                                                                                                   Пtqpsrppkknmihjkigdeedjnhd__afgihgigbghiifhgefimrrrse`cbXYadcelrlowГНТФНЖВТ┤┌Є∙Ёт╥╝ЯЧТПЙsoyГЗЗЖИЙМННККЕyvrzАБГДЗЖЕИКПСУНОТФЦУШЯбЬбл╡╢йл┤╕▓йп╗╝│п╖╝╢ЫЫм┤▒км╡╣╖▒┤╜└│п╝╔─▒б┴╔─╝╛╔╨╔╝╖╟╤╠│з╞╫╫─│╤ьч┬в╗ь∙т┤ПИЬ═р╫╢РБ|zzАТ┴▐╥гМВ{{}~АГКв╠▀╥зРЗАББАББВВДОЩ╠ыэ╨зСЛИЙЙКИИИЙЙЙОЧ╛Ї¤Є╟дСНМНМКЛМННЛММПТЭ┬ю■ ъ║ЬФСПНЛЙЙЛМКЙММРЧ╕Є ■ч▒ФНОМММНСкш  °╒нПНТЮкбМДТ▒╥ў    ъ─УxaSQP^kvzДг╥√   ч┐вЦПСб░мУТШ┤▄·  ■ч┬кЦЮдйк│р  ■ч╛кп╗╡м▓╣├ч  √с╨╠╚└┼┼╞╟╩у■■ї╒╗╕╞╟╩╔╬Ё№№т╔╛╝╡лдвШНЦе│└═╪▐р▀▀рсссссср▐▐рр▀▐ртс▀▀▐▐▀▀▀▀▀▀▐▀рр▀▀▀сс▀рсс▀▀рр▄╤═╥╪▌туфхффхф╫пxYF>=B\К┤╥▐учцшшщщшшшчщщщщщъшщщщщщщъъщщъъъщщщщщшщшщшчшччцчщщшчщщщшшщчцфтр▄╫╙╥╠─╚                                                                                                                                                                                                                                   Лvssrrqomklligghhgeffdgkidcbcgggghnmgilkkegihhjlpsvsf`baY^e_\bnqfgvБЗЛЗБ}АП░▌°√Їу╒─жХТСКБwqzВЖЗЖИКННМКЗГyqs{АБГДИЕИЖИННРМПУХЧЧЧЯебвн╢╕зл│╕▒д░╝╜▓о╖╜╢ЬЮл╡╢ол╢║╕╡╖╜╝┤░╛╚╞╡н└╠╔└╖╩╓═╝╡╟╘╧╣к╟┌┘╟п╥эш╚ж╣ь∙ш╛ХМЭ═у█┐СА|y|ВР┐┌╘кОВААБББГЙа╠т╓лФЗББВВГГЖНЧ╩Ёє╘лСИЖЖЗЖЕИИЙЙКНХ┴ї¤ї╥мСМНННМЛККЛЛМЛНТЫ╝Ё  ь╜аЦСОМКИЙММЙЙМОРХ┤Є ■щ╖ХМОЛНКМРгъ  ·▐╡ФЙЛЫзЮПВПо╥ї    я╚ФyaRTZmАКНДС╨√   ю╞еЧОСвонУУЩ┤┌ў  ■ш─иУЯбижпт■  ь┼░▓║╡о▒║╞ц■ ■х╨╬╚╡╟─┼╦╨ц¤ ∙┌┴╝┼╩╠╩╤ё№№ф╦╗╛╣▒миЫНЦи┤┴╬┘ррр▀сттссттр▀ртс▀▀тсрррр▀р▀рр▀▐▌▐ррр▀стс▀рттсстт▀╒═╨╫▄▀тфхффху┌╝Д`J>:=Szж╬▌хшчшъъыщъщыыыьььыыьюэыъъщъшшъъщчшшшчшшщчччшшчцчшчшшщщччшщчшццут▄╓╙╨╔┬▌                                                                                                                                                                                                                                  Дwssusrqmmnmkillihffeckpidc`cihhjjifcgijgehhgfdlsxyugbeb\``]^emkcdsГКНЕxw|Йм▀√ Ўу╓╟кЧПНКВyw{ДЗИИИМППНЙЕБ{rkyАВВГКЙКЙКНОРНОТХЦХЩЫбЯбн││ко▓╖░жо╝╝▒п╖┐╢ЭЬм│┤пп╡╗╣╢▓╛┴╢п╜╚╞╕░└╩╩─╛╞┘╥└┤╟╓╘╝и┼╪╪╔╝╨єэ╦з┐ыЇь╚ХНа╬юш╞УБ||БГР┴┌╒нР|}}ААГЗЫ╠у╪░ХКДДААВВГВЕМЦ╟ЄЇ┘нСЙИЗЗЗЖИИЙЙКМФ┴ў■°█оРОПРНННММЛЛЛЛНПЦ║ю  Ё┴бФППОМЛЛНОМККМПХ░Ї  ъ╛ЧОНЛМКМПЫщ  ¤ц╛ЬЛЖЧибПВНз╬Є    ї╨Ч|cT[g~НРЛКТ┼∙   Ї╟зЫТУан░ХСХ▒╒Ї  ■ь┼лФЯЮйо┤р■  Ё╚╖╝╝╕вм▓├ч■  ь╙╨╦┼╞╞╚╦╤щ¤ №у─╗╔╨╧╬╫ё№№ъ╠─┼┴╡нзЬНХй╕├╧┌сссссуттууутстусстуутстттсстссстуттстуфтсттсссфур╫╥╤╘█▀сфхуууу▄╞ФnN?8;HkЩ╞█хъщъьььыььээююююююяяяюэююэььъьышшщщшчщщччшцшццццццчшшщчшшччччху▀┌╪╘╨╦─Ї                                                                                                                                                                                                                                 ~ytsursqnonnlillkkiggfhkhfgdehginlmhgjkjhehiiijosБК{gef`Zbd][fri`ftГКЛАuvzЙе▄√ їр╙╚нЩЛГГzv|ДЗЙКЖИПРСРЛД~wryАВВВЗЙЙЗИМНСПРСЦШЩЦЯжгаи│┤лп│┤ми▒╝╣░п╕┐╢аЯл┤╖▓░╡╗┐║╣╗┐╣╣┐┼╞╛░╜═╨╔╝─┘╓╔╣╟╪╪├н┼▌▀╩╕╨їЁ╬к┴ь√Є╧ЧМЮ╬ёэ╦ЧГ}z~С─▌╫╡СГАБААДЗЩ╧х▌╡ШЗГББ~~ВДЕЕИНЦ├ї°▀▓ФИЖДЕЕЕЗЗЙЙКНХ┬ў■№у│УСНОККММЛЙКЙМНОХ║я  Ў╔бТММММКЛКМКККНРФоЎ  Ё┬ЦОЛККЛЛОЩэ   ы┼кОЖСевУЖМд╩я    °╒ЭaVdwЙСЪЩСУ├Ў   ∙╠иЯТТалоЯУФо╤є   ю╦оФЧЮззп█√  ї╬╗┬┐╗й▓╕─у№  ё╫╥═╗╟╟╩═╒ъ№  ш╦╞═╥╧╨┘ё¤■я╤─╞╞╝▒йЭОЧк╗├╧█сутттффуфххфухцхфххххуффхффууфуффхфуфххфффххфуфхт█╒╥╙┘ртффтттф▀╤йxUB87A]Н╛╫хщыыэюэьэяЁяяяЁяяяЁЁЁЁЁяЁюэыъышшшъъщчшщшшшшшццффцццшшчцшшчццчшцт▐█╫╘╧╦╟■                                                                                                                                                                                                                                zvuvrrqnnommknmmlifggkmhcbaegffhgieeghjjggggfekuДПgfha^_^[_hth\ctДЛНЙГ~Иг╒№ є┌╬┼оЧЗztyzx{ГИМНККПРСУРЕxqzГГБВЙЛМККЛНТТУХЩЫЬЭЯгджн┤╢оп│╢░и▒╝╗│▒╖└╖гжм╢╖╢▓┤╛┐║╕╝┼┐╗╛╟╔┬╡╗╬╙═╜├┌┌╦╣╟█▌╞╡╚рр╠п╥ўї╒м└ю№∙╫ЧМб╧ЇЄ╤ЫЕА{АТ╟р▌╜ФБ~}~~~ВЗЩ╨ч▀╖ЩИГГВВББДБДОЦ├°√т╕ЧЛКЗМКЗИЙКЙКМЧ┼Ў■¤ы╗ХТННЛКЛЛЛКЛКММРЩ╝э  ў╠жУОНППНКЛМЛКЛМПФм°  Ў╠ЩОНККМННЪы   я╦░ПБОввФЛПг─ь■   №▄бВndmБЛРЩЫЪЩ╛Ї   №╨нгЦЦЯн│еУТз╠Є   ю╨▓ХФЯл░н╥∙  ў╨║┴┐╝й▒╢─р·  Ї┘╥╨├╟╔╩╧╪ч√  ы╔├╨╫╨╨█ё¤■Ў╒╦╔╔┐░лЯЙЧо╗╞╨█тффффххфхццфххцхцццчцфхччцххххцххццххцццхцццххццф▐┘╒╒┘▌тфхууфур╫╕Г[C7995@VА╡▄хыэяЁяяёЁёЁёёЄЄЄёЄЄёёёЄЄёёёЁЁЁёЁЁяэъшщщщшчшццшшшшщшщццццчццччцфутр▄╪╙╓╒╨╚▀                                                                                                                                                                                                                             }yvtvvsroopojhnppnlihbkomeabadceifmffhihhgklkihjgfloqqmdde_[`hjZ^qАЖПЭжзЫОПа═■¤ш╕РДЖКЖseit{{ДЙЛМКИЗГ{xzЕ~ВИКЖЗКМНННЛПФЩЧЧЭдижжклзжп╖╖│░╡╣╡п╖╛╛║╖╛└╡иж╢┬┬▒▓╛┼┐┤╜═╬└╗╦┘╥║╣╙с┘┬╗▐ч╘╝┴ущ╧▒╞хэ┌╖╙ЄЎь╔║ц■ ълРЬ╨· ю▓ЛГ|АДУ╔ю√щйЕГБА|~Ив┘єўснЙЕВБББДГДВЖЛФ═№¤є═ЫКЛИЖЕЕИККЙНРЭ┴є  °╦ШУННККЛКМЛЛЛННРЧ┤ц   хоТФСПМЛМККЙКЛНПФны  ■рвЦОЛККЛОЬ╫√  °╚╣СЕГПЯвРИКЫ╧°    Ё╟лЧ░╢дСПШкзЫйэ   ■▐╗иЦРСз╕▒ЬХг╝▄   №ш╞звз▓╣││ю  √█┐║╛┐╜╜├╚╧є  √▀╘╪╥╙╒╒╓╫█ў  °┘╬сч▌╥╫ы¤  ш╧╓╪╙├╣мХХк╕└╦█уфххчцххцшццххццццщшццшчцффцццшшщшччшшшччъъщшххцфху▐█╫┘▀тхуфххфт╪╝И^B:5;Mtк╫фыьяяююЁяЁЁЁёёЄёЄёёёёЄєЄёёёЁЁЁёЄЁЁюэъъъщщшщцчшшчцшшщчцццчцчшшчфхфу▀┌╫╙╙╤╩├·                                                                                                                                                                                                                            |xuvuvsrppqroopponlikglomfeeceddeefbeihjihjkjgehigns{yngdcZXbleT_sВКЩЬдЪПРб╠¤№ц╖М}ЖМЗtjks|~ГЗЙЛМКЗЕАxvv|АГИЙИЙЙНСССНПТЩЧЧЭбжвеймив░╖╖▓▓╕╗╢п╖└└╗╡╛┴╖ид╢├─┤▒╛┼┴╢╛╦═┬┐╠▌╫╢▓╙т┘└╖сщ╪╛┬фь╥╖╩хю▐╛╙Є°Ё╤╕х  э│ФЭ═· ё╝ПДВС╚ё¤я░ЖБ~~||~Иб┌ў¤ъ▒КЗДГГВГВБАВЙУ╨∙¤°╒ЫЛНЛКЙЖЖККЗКПЪ┐Є  ∙╥ЭФППКЛМНМЛНЛЛНСЫ│ъ   ь▒УФСРНМНМНЛЛЛОПСпъ■ ■фгЦМЛКМНСЭ╒√  ∙╚┤ТЗВКЫвТДГТ┼ў    Є╦░бп╡жТПЬниЩмь   ■р╜нЦНУж╕░ЫРЮ║┌    ь╔еЭз│╕п▓э  №р╞╜╜└└┴┼╚╧Є  ¤х┘╓╧╘█┘╓╫┌Ў  ·┘╨уъс╫╪ы¤  ы╨╫┌╫─╝▒ЪЭз╕┴═▄туфцшцфхцчцхфхцхццчшццчччхххцццщщшчччшшххчччххххффф▀▌┌┌▐туууххфс█╟ФeE>9:DgЬ╧рщыэюээююяяяяЁяяяЁЁёЁёёёёёёЁёёёєЄЁяяьыщщшшшчцчщшщщщччччччхццццхцффт▀┌┘╫╥╬╚╚                                                                                                                                                                                                                            yssvusrrqttrqprpnligfnspgeebfffffkdcfhhhhljifghdbr{ГВqcec]]bhdU_s}~ЕНХЫШФФг╧°ї▌▓НАЕМЙxkko{ВГЖКЛКЗЕАwsuВАГЙЛЖИКМПОНЗОСЧЩЩЯажбгзлйе▓╣╕░п╖╝╣м╖└┬╜┤┴┼║ки╡┼╞│░┐╟┴▓╜╧╧┬╜═▀┘╣▓╥т█├╖ты█┴┴ця╘╝╦ушр╙╘є¤Ў╪║с  ё║ХЫ┼№ ё└СБ|{ВР╟Є є╡КГ~|~АИЮ┌∙■ё╡ЛЕВВГДДГДГДИУ╧∙■√▌аЛЛЙЗЕЕДЖЙЙЛПЩ╝Є  √╫аФНКЙКЛЛИИЛМННСЩ░ь   я╡ХЦСОМЙЛЛМЙЛНОПСмщ■  шеФМКЙКНРЭ╨·  ·╬│ТЖБИУЫУ}|М╜ї    Ї╧пЪм╡жУМЫмиапш   ■р╛░бУУз╕▒ЫСЯ╕┘    ь╔йЯж▓╣▒│щ  ¤х╦╛┐┴╗┐┼╟╬я  ¤ы▀┌╓┘▀█╙╓╪Ї  √▄╘хях┘┘ш¤  ь╙╫█┌╟┬┤аЭз╕├═█суфцчцфххчцхххффхххцххчччххчцххцшшчччччххччхфцццфхтс▐╪╪▌сссуффур▄═жqK?:9>YР─┌хщыььэюяяююэяяяяЁЁяЁЁёЁёёёЁёЄЄєЄЄёЁюьъщшщшчшшшшччцчшшчччццццчцццхфр▌┌╓╙╤╬╟с                                                                                                                                                                                                                           xsuwvuuusspnnmnmlijiiorohfeeffffefcfkljihljhcchhhr|ДБqbd`[[dg^Vcsw{АЗНЩШЦЧз╠ьт╬░ИzЕОК{pilyДЗИЛККЗДАzus{|БВЗМКККРТУТОСУШЩЧЩЭбагжкие▒╕╖░░╢╝║│║└┬╝╖┬╞║зг╡╞╟│п┴╔┬│╝╤╨┬╛╬р█╝┤╘у▌╞╕уь▌╟┼хё┌└╔хЄш╬╤Є¤·▌╝█  ё┐ЧЧ╛¤ Є╞ФЕААЕТ╚Є ∙╛ПЕ~|z~АЗЬ┘√ ї╜ОИДВАВВБАБДИУ╞ў ■фгОНКИИЙЗЖЖЗКОЧ╝ё  ¤┘еФОЛЛММЛКЙЛЛНОТЦкь   Є╗ЩЦТПММЛММКЛНННРиц■  ыжФМЛКЛОСЪ╦°  ·╙пХЙ~ГТШЙtvЗ╢ї    ў╘оФг╡зУРЬйеФлс■  ■у┬░ЮТХй╡░ЪУг┤╪■   Ё╔мЪдп╡▓ос  ¤ъ╤┴┼┼┬┐┬┼╩ы   ю┌╪╤█у▀╓╙╪ю  √т▀фцу▄┌ч√  ь╒╫▌р╬┼╢заи╣┴═┌руухццффччхфххххфхухцхчччххцххфцчцххцччххчцххцццхффур█╙▄▀▀рстус▀▐╒▓ySB:986BaТ╟▌цыьэюяЁяЁЄёёёЄЄЁЁяёЄєЄЄЄЄёЁЁяяЁяЁЁюэыъъщшщщщщчщщшччччшччшщщчччцуууус█╪╓╙╤═╟├¤                                                                                                                                                                                                                       ■}wsuvxvvsrqnpmnmmnklkhpurkjgffdecfdehihfgjlkkggieegeflnrpdX\de[^hkfbsГЙИГБВМв╝┼╟╖ТДЙЛЛЗtt{ДЙККЙЙКЖВАyxГГГЖЙНОННТЧХРПУЫввЫЭийежззй░╢╢│▓╣└╕н│─╚╜╡╞╠╛еЬ╢╔╚└└╞╠╩║╣╤╘╩┐╧тт╦└╫тт┌╤сЁъ╒╔рєъ╒╦ч√·█╔ё ■ц│▐  °╓ЯЧ╩  √▀ЭЕГ~ЖУ├Ї №╬ЫЙ}~АВМг┌№ ¤╤вПЖЕББГБВЖКУ┐ї  ЁпХНМКККИЗЕЙИПЧнц   ь╛ХТОНМММЛНМММЛПУд▀■  ∙╩дЦФТННЛМКМННОНРЪ╙√  Ў╔ЧНКККЛОС▓Ё   Є╢ЪЛzpid[Z_sЩц     э╜Эз▒кЪТЩвзбв╧°   Ў╒╣иЪХж┤╖кХЧп╧ё■  °╫║Чи░│▓и╪   °╥╗─┼├┬╟╔╟щ   ·у█┌сяяу█┌ь   я▄ш·ўу▄х√  ї▀╓▐ц▐┬─╢жп╚╒╫▄▐уухцхффццффхчччшшшцфхццхфхцхфффхццччшшчччццхцччцццхфр▄┘┘┌▄▄▄▄┌▄█╪╩ЭuN@96?YЙ┐┘цыыьяяЁЁЁЁёёёЁЁЁяЁёєЄЁёёЄЄЄЁЁЁЁяяяэьыщшщчъщщщшчщшччхччффчччццчшхууус▐┘╓╒╙╨╠╔╙                                                                                                                                                                                                                       ■~tquxwvwtssqvqqmpnikhjsxrggeffefffeacfefilljigee^becemqwsdWYa_\^gib_qЕКГ~}БП░╙р▌╞ЫНЛКЛЗАut}ЕКМКИИЙДАВy~ЕЖДЕЙМООПСФЦФСЦЮиеЬакнйиииз▒╗║┤┤╗┬║░│╞╚┐╢╞╧┐зЩ│╔╠┬╜─╦╔╝╛╤╤╦╦╥▌▐╤╟╫цъ┘╟рЁэ┌╔▌ЇЁ┌╩ц¤■т╚Ё ■щ┤р  √▐йЭ╠  ¤чбДВ~ЖУ└Ў ¤╒вК}}~ВМд█¤ ¤╓вНЕЖАВБЕВГЖКФ┐ї  ЄнХМЙЕЕЗЗЗИКНТШнт   Є┴ХТНМЛЛКЙМЛЛКЛПУе▄№  √╦дХТПНЛКЛИЙЛМООРЩ╩∙  ∙╬ШОМККЙНРмя   Ї╗ЧЙsjc_XV`uЫт■    є├жи░кЯФШжкбЬ╟ї   √▐╗мУФй┤╡лЧЩп╔э■  ў▄╗Ъи▒░лд╓№  ·╙╗┬├┼┼╩╩╟ч   ¤ч┌┌фЄЇщ▄╪ю   Ї█ч∙ўщ▐ц№  ∙т╫▀ъу╩╚║о│╚╒╪▄ртфцчхффхцхфцццхццчцфхцххфхцхфуфхцчшшшчшчччццчшщццххур▌╥╒┘█▄┌██▐▄┘═й~RB;8>O~╕╫хъъыюЁёёяяЁЄЁёёёЁЁЄЄЄЁёЄЄЄЁЁёёЁяяээыыъъъщщщщщццшшчччшшцхчччцччцхууут▐█╪╫╓╥╧╩╞ё                                                                                                                                                                                                                      ¤Аwtvxxvxtrqmqopnnmkmhjrxsljeggegfeedghfgjjlliggleffegnu~zeXZd_[_ed\[pВЖГАДЙХ╜▀Ёю╘еТЛЗДГ{z~ЕЛНЛЙИЕБ}|{БЖЖЕЖЙОПОПУШЩУСШгкжЬЯмойдзйй▒║║╢│╝─╗▓╕╟╩╛╡╞╨├кЬ│─╦┼┐─═╬├└╨╓╧╚╥▐с╓╠╫хь▀╚▌ёёт╔▌Ўє▌╩х·№ч╚я ■щ╡т  ■шйЬ╦¤  ывДББЗУ┬° ■█дИ~|~ВМв┘¤ ■┌жПЖДБББВВГЕЙФ╛Ї  ЄпХНМКИЗЙЙЖИЛПЦмт   Ў└ХХССОММЛНМЛКНРУж┘√  √╠иЦУРОМЛЛЙКККЙЛСЦ─°  √╘ЩПНМККМСлЁ   °╛ЦГqf\XQXe}Э▄■    Ї╚зипмаЧШвймв├є   ■ц╛пЮЪй▓╢нЫЬо┼щ■  °с╣Ыз│▓пг╤∙  №╫┴╟─┬┐╟╔╩х¤  ■щ██фї°ь▌╪я   °▌х·∙ъ▀ц№  №ф┘тъу╫═┐ж░╩╓╪█ртфццфуфццффцххфххчцххффффхххууххххцшчччшшццццччххцхут▌╫╒╪┌▄┌▄█▌█╪╧┤ГWE96;Hsм╥хъыъьяяяяЁяёяяЁЁЁяЄЄёЁЁёЄЄЁЁЁЁяээщщшшшщъшщъъщччшшшшшщщцццццфцуцууцфт▀▄╪╪╓╥═╩╚┬                                                                                                                                                                                                                      ·sqtuwuyvvuprrupnnjkgisxqhifggghgeeaefgikglljgff`cddhotБ|dW\c_\`ca][mВГАЕПЧ┐ы√є╪кШК~{||{}ЕЛНКЖЕВ}z}ВАВЖЗЕИКМПСРСЦЫШПЧжойЮеопижийл▓╣╣╢╕└├╣│╣╞╟╜╡┼╨─пб│╚╬╚└┼╠╧╔┼╬╫╙╧╤рц┌┼╥чях╚▐ЇЎц╩▌ЇЎр╩ч¤■ш╩ь ■ы╕▀   ъиЦ╧№  язЕДВЗТ┬·  уеЙАБДНа╪¤ ■▀мПЖДАВВЕГЕИКФ┐є  Є╢ЧЛКЖЕЗЗЙЖИЛСШйф   ∙─ХФПОМЛЛКМКККНТЦи╫√  ·╤иХСНКЛЙЙЙЙИИИИОФ└∙  ■╒ЪРМКЛКОТоє   √╗С|jbXQQcsЖг┘¤    ў╟йвнпгСФгмеЯ╝Ё    ы─пЧЪй│╕▒ЧШо├ц■  ·ч╣Ыз│▒пе╚ї  ¤┌╞╔┼──╟╟╬т√   ъ┘╪хЎ·я▄╫щ¤  ·ыь°°э▄у√   ъ┘хЇЁ▄╤┼к▒╦╪█▐ртфффусуффуухххуухххффуфуффхфуффххфцццхцххцхххццфххфт▀▄╥╥╓╪█┌▄▄▌▌┌╥║И\I<88Akб╔ршщъьюяюююэЁюяяяяюяяяяЁёёёёЁЁЁяюэьыщщщщшцчшшщччщшшшчшшцччччцццхцууцур▌┘╪╫╥═══╞х                                                                                                                                                                                                                     ·vuwvwturqompppnnmkkiksxrhigghfilhihiigdhgkmljhkccbchnrЕ}bW`e_Z_b`]_m~ГАЙУРШ┼ы√°┌лЪЗzopz~}АЙНМЛЖЕ~{wz~АВДЗЗЖИЕМПФФТХЬЪХШзпмЯд▓▒идилнп╖╜║╣┐╞╛┤╕╟╔└┤╚╥╟┤м╡╔╥╩╜─╬╥╟└╬╪╫╥╨рш▌╔╨чЇщ╚▄ї∙щ╚█Єёу╓щ¤■ъ╦ь ■ь╜┌■  эмШ╬√  єлЖДВЖС└√  ыпЛВ~АГЛЫ╙¤  ъ│РЖДБДВГВВДКХ╛Ї  Ў┴ЧНЛЗЕИЕИЕИКНФеу   ∙╞ЧФОТПООММКККНРУж╙·  №╪лФСООМЛКЙКИИЙЗОУ┴·   ╪ЩПМЙИЙОРоя   ¤╢Кve\QSTiРз╫√    ў╩░зноеСУвмлЯ╣э    э─░ХЦй▓╕▒ШЦл┐у¤  ■ъ║аи▒│▒г┴Є  ¤▄──┬╛╗┼╚╧█°   ъ█┘цєєю▄╓у√  №фщ№№я▄тЎ   ятшўЇр┘╠п░╠╫┘┘рсуфуссстфттууфууффхфуттссуффтуххфуфхутуффуууххфууутс▀▄╒╥╓╪█▌▐█▄█┘╙┬РaM=7:@bЩ┬▄цшшыээыьэьэъььээюэээюююяЁяЁЁЁяэюьыщшщшшшчшщщчщщшцццччуцфффууухфффуус▐▄█╪╘╧╤╬╔╛■                                                                                                                                                                                                                    ·~rpvwvuvrrqqtqqolkhiinvwpihhiigghggffgfdgfkllgde^dfehlpvvd[aa\[^`^[`t~ВЗПШЦЭ┬ы·ў╪жШИzmkvБВВЖЙКИВД~zx{ББВГЙЙКЙЗНТХУТЧбЬУЩинлбз░▓йзмо░о╖╜╝║╝┴╛║╜┼╔┼╝╔╤╩╖з░╔╒╠╜┬╧╓═╛╬┌┌╨╩сыр╠╤шўы╦▄єўь╥▄√√у╩ф  ъ╩ю ■я├┘¤  я░Ч╔∙  Ў▓ИЕВЕП└¤  є╢ЛГБ~БЗЩ╙■  ё╝СЕДВДГБАВЖМХ║ё  ў╩ЮМИВГЗЕИИЙМПУб▀   °╞ЧЧОМЛККККЙЛМНТУЮ╦°  ¤▀оФРОНМЛКИИЙИЙИНУ┴№   █ЬРКЗЗЗКПищ   №╖Дm`XRT_kАУл╙°    °╠╡во▒еСФбкжЯ╖ь    Ё┼│ФХи▒╖▓ЬШк╜▄√   ы╝бим▒▓в╗я  ■▀╟┐┬├├┼╚╔╙ў   ч┌╫ф°№є┌╫▌∙  ■фц¤¤ё▄рЄ■  ё▄ш·Ўт█╙╖▒╦┘▌▐▐ртууссссссстуссутуууууссстутрссттстутррсссстуффутсрр▌█╪╘╓╫┌▌▌▄▄▌█╫╚ЫiN>88>\О╣┌фцшшщъщъъъъыээээьыьэээььююяяяяэыьэъшчщшчщшщщчшчччхцччцчччшууцццхцухт▀▐┌╫╥╨╤╨╩┬█                                                                                                                                                                                                                    ·~vuvxwvuqqoopnqnmljjknvxrihhghijjghhihedfhllliigdgfegilrob^ee\Z^^\]hxИМЦЯЫг─ы∙ї╥ЮХК|iesАЖЖИККЙККБ|xxБГГЕЙЙКЛПФЧХЦЫвЭХЪиплЯж▓▒згл│░л║┐╛║║╞┬╕╣┼╠╟┬╦╧╔╝йк╚╫╨╝┐╤█╧╜╬▌▐╥╩сэу╬╬щ∙ю╩█Ў√ю╙▄·√ф╠т ■ы╠я  Є┘с№  є│Ш╟°  °╗КЕВГП└■  °╗МГ~}}ВЗШ╙   ∙┴СЙГБВББ}ВДЛС╡я  ·╓вМКЕЕЖЗИКЛЛОРЬт   ·╩ЩШСОНЛКЙМЙЛКНПСЬ┼Ў   ъ░ФСОННМЛЙИЙИЙИНУ┐№   раСМЗЗЕИМа▀■  ¤│Гj]TP^js}Мз╤ў    ·╙╗зк▒зФФЮлеЯ╡ь    є╔┤ХСе▒╖▓бЦн╝▄№   ь╛вгй░│в╖ё  ■р╥╛╗╝╝┼╩╨╤Ў   ш┌╫у∙■Ў█╪┘°  ¤у󤤯▐▌ь■  є┌ц·∙х▐╫╜▒╩╪▄┘▌рсссср▀▀ррсстсстрсссс▀▀▀срсссстус▀сст▀▀срр▀сртссс▀▀▀▀▄╪╥╒╪▄▐▄┌█▄▄╪╠гrS>87>SАп╘сфцфчщщщщъщшъъъъъщщыыыыэьээээээыъщшшъщчччщщъчшъъшчщщчцхцчусухчхццхцтр▀▄┘╓╫╥╨╠╟╜¤                                                                                                                                                                                                                   ·|tsvywuvtrqprtvqnllklpywpjkkhhiiifgfhhfffhlkifdc^effgfehihghd^\]][bit{ЙСЩбй▒├уяч╔ЦФЛi`nБЖЖЗКМНСПГzz~ВЕЕЙКММЛПУХРРЪдЯУЩймкби┤▓иин│░о╣┬┴╣╕╟╟└║╞╧╠─╟╥╨┴мз╟╫╥┴┴╨█╨╝╧ср╘╟рёч╬╬ъўя╪р°■Ё╠╥№¤ц╠т ■э╧Ё  Ў╨╫∙  ї║Ъ╞ў  ·╛ОДВВО┴¤  ·┬ОДАБАВЗЦ╨   ¤╠УКДВДДББЕЖКО│Ё  ¤▐дНИДВДЖИЙКЛРТЫ▀   №╤ЪХПНММККККЛМНПСЩ╛я   ё╡ЦСОМЛКЙЗИЗИЙКМС╗ў   фдТЛЖЕДЕЖХ╒·  ¤╖ГgZW[js{~ЖЩ═ї    √╒╖жм▒жФХЬзгб┤щ    Є╠╢ЬХг░╖▓вЩн╝▄¤   э╛везп▓н│э   т╓┼┬┬┐├╦╧╧ї   ш▄╓т√■°█┌╫°  ■ф▐¤¤ўу█ш¤  Ї┘х··цр▄╔╕╔▌с█▄▌▀▐▐▐▀▐▄▄█▀рс▀▀р▀рррррр▀▀▀срр▐▐▀▀▀▀▌▀▀▐▀▐▐▐▀▀▀р▀р▀▀▐▀▀┘╙╥╫█▐███▐▐┌╨░{W@56687Huб├█руффсффцччцхцццчшшшчшщшъъщшчшщшццшччцччшщшшчшщшчччцццццутуффтффутр▀▀▀▌┘╪╒╙╥╤═╔├│ў                                                                                                                                                                                                                є~yyyxwxxwtsrrrrtrropprtwsqqnmonmmmkljjfkhhkkifigfffdefegmvwpa^_\\bmmdsОж╖┐└╝╕╡пвРАВ|rlkrЕОМИЖГ~|~АГЛЛМММРСФЦЫЯвдезвЫЪазйзе░┤░▒╖╣▓й╜╤╧╛╡╨┘╔╜╞▌с╧╔┘▀╘╡е╨ф█┼╗█щ╫╝╤эю┌┴т∙є┌╠ї■°┘▌√■Ў╓▌№¤єчы№ ¤чц№  ё═я  °╦к╕ь  √╒ЫЕГДР╖ё  ¤╒УИА}ВИХ╚·  ¤▌ЮСДЕБББАВЖМН░ё   є▒ЧЛЖЗЖИЕЖЕКМПЩ┼Ў  ■с╖ФРННЛИЛЙЛККМНРСйю   ¤╘гТМКЙЙЖЕДЖДДЖЙРж┌№  ў╩ХБvljfl|йю   ю╡ХЗwtГСТКЙУ▒т¤    °╦пн░иУХейвШв╔°    Ё┼еТЫ▓╝╡ЬТе║╠ь■  √╙│бк┤┤дЮс   ·у█╫╬├╔╓╓╨ь   №▄╙ц·■¤ш╒╫э   °тє■ Ўу▀∙  №ысщёшщьр╚╞ъЇэр█▐▐▄┌┌┘┌┘╓██▄█▄▌▐▀▌▐▀рр▐▐▄▌▄█▌█▐▄▐▌▄█▄▐▐▐▐▌▀рс▌▀▀с▀▄рр▀╓╨╥╫█┌▄▌▄█┌╪╨пxSA332EoЪ├┘▀туффуццчшшцчццчччцччччшщщшшшшщчцчччцчччшшчуччцчцчуццшшцсутстухфс▀▐▌▌██╪╓╥╥╨╬╠┼╣┼                                                                                                                                                                                                                шzxz|xyywvurrrttrqnnmqwysnponmnnmiknlhdjilmmlinidefbedbeeehlfbc_`dgffzФк╖╛╜╡пиЬХПЕxwxsokqГООКЗВ{w}БДКММЛНСФЦЧЭгегдйеЬЩЭзкиил▒▓│╖╜▓н╜╤╤└┤╥┌═╗┴▀у╠╛█ц┌╖г╨х▄╔╛▐щ┘┐╥юЁ▌╞х∙є█╬ў■°▐с√■°уу√■ўуф√  ыц№  ё╦ю  ∙╒и▓ч  ¤┌ЩЖДЖР▓я  ¤╒ХЗ}А~ГИХ├∙  ■▐гСВЕББАБЕИН▒я   Ї▓ЩПЛЙЕЖЕЕЖИЙКЪ├ї  ■ц╕УСПММКНЛЛКККЛРРощ   ¤╒иУОЛКЛИЖДГДДЗКСд╘·  №╙Х~qmmilzащ   Ї╖ХЛz{АКПЛИСп█√    ·╙║┤▒иТФжквЧЮ╞ў    є╩лЮап║╡ЫТд╣╞ш■  √╫╡зн┤│йж▀■  ·щ┌╘╠╟╚╤╙╠э   ¤▀╥▀Ў■■ы╪╓я   √тЁ■ °чр∙   э▌ъЄщэїь╔├ю√Єт┌▐▄▄█┌█▄█┌██┌┘██▄▌█▌▌▄▄▄▄█▐▌▄▐▌▐▄▐▐▌▄▌▐▐▐█▄▌▌▐▌▐▀▀▌▐рр▌╪╤╙╪█┌████┘╫╨▓~YA204CkЧ┐┘▐сфтууцчцчцццуцчшчшщчщччшщшчшчщчччшчцччччцчччччццчуццчхфуцурсуфхур▀▌▄█┌╪╒╥╤╧══╟╜о¤                                                                                                                                                                                                               щ|{y~xyywvtqtsssrspnorswtqooonmmkjmlmkehjjmmheheegfffdchfcflmhfbbfihhБШм╡╢┤пкдЪХПИursvsnrВИИЗЗГ{x}АБГЕООННПФХШШЮжйздиеЭШЬжмкзо│┤┤╣┐│н┐╥╤╛╡╘█╠╜└тф╠┴▌щ▐║а═ф▐╠└▀ы█─╘яєр╞ч∙єр╤ї■∙с▀∙■·ыщ∙■·шт√  ьч√  ё╔э  №▄знч  ■сЯЖГДОнь  ¤┌ЩКБДБЕИУ┐ї  ■рзРДДБГБАВЖЙН░ы   Ў▓ШОИЙЖЖДДДЗКОЩ╛Ї   ъ╢УПНЙКИМЛЛКЙКМСТпч   ■╘иУКЛЙИЕЕВГЕЖЗКСв╬°  ¤╒Ф|rjgdgwЬщ   ї┐ШО~}БМПНЛСо╘·    №╪╛╕▒йХФймдШЬ├Є    ∙╠▓СЮп╡┤бТж╣─ц¤  ·▐╡Шк┤▓еЮ▄№  №ч╓╧╚─╞╙╒╧ы   ¤у╙▌Є¤ Є█╫Ё   √тЁ■ °с╪·   Є┘щЇыяўя═╛ё№їц┌▄▄▄█┌┌█▄┌▄▄┘┌█▄▄▄┌█▄▄▄▄▄▄▌██▄█▄█▌▄██▄▀▀▀▐▌▌▐▌▐▀▀▐▌▄▐▌▄╪╓╒╫┌██▄▌▄┘╫╨╖ВZB222AfС╝╫▄ртутуцчффцччцшшщцццхчучшшчцшщщщшшшщчццчццчхчччцчччцхххфсфтрртуфтрр▀▄┘┌╪╓╙╥╤╧╬╩┬┤▀                                                                                                                                                                                                               щ}{{}А{xxxvstvvwvrronpty|wrppqpponkkihidhklmmkegfbdgggfad`_dmqrkcbefflЗЫн│▓▒кеЩХТНЙontutptБЗМСОД~y{ВДДЙННЛМУХЩЧаилкжйквЩЪкнмжм┤╖╖╣╜╡о┐╥╙┴╢╘█╧╛┬ущ╧└рыр╝е╦р█╨─рщ▄╞╘яїу╚ц∙Їу╘Ї■√юъ°■¤ъ┌°■¤ы▀√  ях·  я╚э  ¤тжзц   шЮЗГДМжш  ¤▄вЙАБАГЗУ╗є  ■сйПДДАА}~БДИНмщ   °╗ЩПИИЙЗЕЕДЕЗЛЩ╗Ё   ё╢УУОНММНМНКЙММПТос¤  ■╒мУЛККЗДДГДЖЖИИСЯ╦°   █У{pfb`dqЦч   Ў─ЧПВББЛСПЛПо╥∙    ■█─║▓кЦХмнжЯг╛Є    √╧│ШЮн╡│дТл╗╞ф¤  ·ф║Щж░▓лЯ╓·  ■▀╩╔╞┬┬╙╪╘ь¤  ■ц╫┌ю¤ ўр╒я   ■уя■ ∙у╓√   є█щЄъЁ∙Є╧╜є№ўц█┌█┌┘██▄┌█▄▄█┌┌▄▄▄┌█▄▄┌█┌▐▄▄▄▌▌▄▌▌▌▌█▄▌▌▌▄█▌▌▌▌▐▐▌▌▌▌▀▌┘╥╥╓╫╪┌┘█┘┘╪╓╗И_D522?`Л╖╘▄ртутцчхутцчшчщщшшчччщцчщшччщъъшшччшцхцчцццчччцфцццуххфстфтстттхтр▀▀▐█┌┘╪╒╥╤╧╬╩┼╕░                                                                                                                                                                                                               ш|}~~|yxwtvwuuwvsrnnoqsxxtsqoooqsornnlfkkkmkgbgfedfffdcg__fqvslb_ceeqКЫйонлгЮЪХСМЙuqtxxtzВЙПСНЗА{|АГЕЖКОСПРХЧЪШвйливзигЩЪи▒оз▒╖╣╖╣└╢▒┐╤╙─╖╘▄╨┐╞хы╥┴рют┐ж╔т▐╥╞рц▌╠╫ьюф╠чЎЇш┌є■№юхў■ Ё█Ў■■я▄·  Єф∙  я╔э   ч▓зх   эЯИДДМЯх  ¤сзК}}~БДР▒я  ■х░РЕДБААБГЗКРлф■  ў└ЫНЗИЗЗЗИЖЗИОЧ┤ь   ї║СПЛКЙЛМЛМККМКОСл▐¤   ┌▒СККЙЕГДГЕЖЕЖИПЩ─Ў   тХxmea_cnУщ   ў┐ТНВ~БПФПМОм╤ў    ¤┘─╣░йШФкпкаа╣э    √╧╣РЪм╡│иФм╜╚у№  √ф║Ъеп▓зд╧ї   с═╔┼─╛╓▌┌ь√   щ╪╙щ¤ √х╪ы№   єє■ №ц┘¤   Ў█щёыЁ∙є╨╜є№∙ч▄┌█┌┘█▄█╪╪█▄█┘┌▄▄███▄███▄▄▄█▄▌▌▄█┌█▄┌█▌▐▀▐▌▐рр▌▄█▄▄▄▌▐▌┘╓╤╥╫╫┘██┌┘╪╫┴МcE621526CiЪ┬╫▀ссууухцхцццуцччцччцххчцшчшччшччццчччччухцццууфццхчччустуфтрсттртуср▐██┘╓╥╥╘╥╬╩╞╝нї                                                                                                                                                                                                             ▀|{y}~~~{yvvxxwtvuvpqrty|xuwvrooonmljllmnoqpmjghfehhdda`^\ahiijheb]ZiГФЬааббЮЯЬЩУМГ{twВЛКЖЖЗВ{БВГДИККНПЦЧЧЧЬввиполжн▒иШШ░╝╢и╣╚╟╛╣┼╞┴├╥р▐╠╪тр▌▀щьф▀ьЇю╨▓╚чЁш╙▌ЄЁс╪ь·°с▌ї√ї▀ч■ ·тю  ·чЎ  ї╤ь  їсЇ  ·ьь¤  Ї░д╙·  ЄзОДГЗУ╟   Ў╕ИД|~БЕОЩ╨   ·╔РКГБ}АБВБЛЩ├ї   ы│РЛЖЖДГДДЗИМНЯх   ■╙бУНМЙЙИЗЖЙКММЛПа═ї   °┐УМЙЙЗДДДГВВГДВЗеё   Їгv_UUX\oС▀■  °─ЧРКЖМХЩЦОЦк╟Ё     Ё╥├╗╢мбд▓┤кЫжю    ■х╜ЧЩ╢╗╜▒Чж╝╞╫∙   я╠╢╘ыэ═║┼ю   шЁэу╓╨х·ўЁ·   ъхчь√  √ёъ°   Ёъ∙■№щущ■  ¤ууЄЁюЄїц╚я√■їс▌██▄███┘█┌▄┘╪┌╪┌╪┘╪╪┘┘┘████▄▄▄█┌┘┘┌┌█┌██▄▄▄▄▄▄▄▌▌▌▐▐▀▐▄┘╙╥╤╙╓┘┘╓╪╓╘╬▒БV@622@bЦ╝╫▌▀стухфууухууцчццччцхууцшчччццфцццфуффцхццццуууцхцчччустттррсхфсрр▐▀▌█┘╪╓╙╙╥╧═╩╟┬▓╪                                                                                                                                                                                                             ▄~zuz{~~{zwyyyxvwuvnqqqy|zssrpporopnnolimoppokhkhffe`cbdc^]cfgijje\ZnЙХЪЯЯваабЮЪХРЗА{tvВКИДЕЗБxzБГДЕЙЛМОТЧЪЫЫЯеекониз░▓кЪЫ▓╜╕м╣╩╩┬╛╟╔─├╙ус╥┌хцурьєщ╓шЇЄ┘╡╔цяч╙▌єЇф╘ы№√ф┘ї¤ў▐ч■ √ьЄ  ·╒я  ї╧ь  ЎфЎ  ¤тх№  Їлд╤·  ЇеНГАЖС╟   °╜ЗЕ~АГМЧ═   ¤╧ПМГБАВВЕДЛЦ┴є   Ё┤ПЙДДДГГЕЗЗНОгт■  ■╓гСНЙЗЙИИЖИКМПМРЪ╟Ї   ў┴ФНКЗВГГГВБББББЗЮъ   Їеy]VZ`cpО╙√  ў┼ЦПИЖКУЪШОТм┼Ё     ў╫╩└╣кЧг▓╖мЭеы     ь╛Ча╜┼└▓Шб╗╟┘∙   ї╙╛┌ЁЄ╪╝┬ы   юєёш█╧ш√√є·   эщчы№  ■єэ∙   Єъ∙¤√х▌х¤  №учєюыЎ№ы╟ь¤ ўт▀▌┌███┌╪┌┘██┘┌██┌┌┘┘╫┘▄███████╪┘┌┌┌██▄▌▄▄▄▄▄▄▄▄▌▐▌▀▌▐▄┌┘╥╘╙╓╫┘█┘┌╪╪╤╕ЗXG822>aР╣╓▄▀тфхчцфццчхчццффцхцццццццшччфффффуууухухццууухччшшшшцуттсррттррр▐▌▐▀█┘╫╒╙╤╥╧═╩╩┼╣│                                                                                                                                                                                                             ▄А|yА~~{yuxxwuuwuuosrvz|zuwuproplmlmonmpoprrlgjffefbfa`_^afgchnuu`[rЛЧЫагеггвЯЪУФЕ|{vxБЛЙЕДДВ{{ВЖЖЗМНРПУЩЯаЭвкймн▒ои░╡лЮа┤╛╢о╗╠═└╜╔═─└╥ут╪█щщхтэїю▄чїЎр╖╔ъЇэ╒▄єўф╘ь√∙ыуЎ¤°уу  √щю  √╪ы  Ї╤ь  ўхї   чу·  їкб═∙  °йПДАДН┼   °╣ЕЕА~ВЛХ╚   ¤╙ОКГВ}~ААВВЛХ└Ї   ё╡СМЖЙЕЖЕГДДЛОе▄№  ■╪зФМЙЙККЙИИКМНКРЩ├ё   ў└ФОЛЙЕЕДГБ~~~~zБЬф■  їдy^XXisvН═√  ў├ШРЙБЙУЪЩСХп╞Ё     √█═├╗оФЯ┤╕лШдч     Ё└Ыа└╔┬│Чд└╠▄ў   ў█├╓ює▐├╜ш   юєўэ┌╬ы№№Ў·   Їьшы№   їю·   їю·■¤э╩ц¤  ¤хшєяъї¤ю╩ш¤ ·т▌▄┘██┌┘╪┘┘┌┘┘┘██┘┌┌┌┘╪▄┌┌╪╪┌██┘┌██▄████┘┘┌┘▄▄▄┌▐▐▀р▀▀▐█┘╥╥╙╓╫╫╪╫╪╓╘╤╗М\K945?\Л╕╓▄рруффсуццуухуцууцчшчццхцучццуфцффтуцццхууццчшччччшшчшхфтсссттт▀▀▀р▐▐▌█╫╓╙╤╥═╩╔╚╞╝и■                                                                                                                                                                                                            ▄}yu~~~{ywxyzyxxusnnpsz~ztupqrpsoonppmjqrrpnlilhede`gb``][afeipyx_]vНШЩабигдегЯШЧИА{xzБИЙЗЖДАx{ВЗИЙНСФФЦЮдгбелммнпмм┤╖нда▓╛╝░║╬╨┬╗╦╧╚┬╥цц╪┌ъячть°Єрчї∙ш╝╧э°Є▐▀Ў∙ц╙ы№№ъуў¤∙щы¤ ·уц  ·╓ы  ї╘э  ·юї   щс·  Ўмг═Ў  °нРДДП┴■  ў┤ЕГАВЙХ╠   ■╪ПКВБББВГЛФ╛Ї   ї║ПЛЕЕДЕЖЕЖИКОг┌√  ■╘лУЛЙЖЙЗЙЙИККЛЛРШ╜Ё   ў└ХОИИВГГГ~|yzzБЭт■  Ўиy\Z[ajtК╔·  °─ШОЙЕЛЦЫЪПЫ░╚ё     √▄╩─╗░Эж╡║мЪЮс■    є┬кж╢┬┴╕Ън╟╤█є   ∙р╧╤┌хр╛╖т   ёцчщ█╟ч№√ї°   ∙юыю№   ўё∙   ∙Ё·■ ў▄ч■  ■эЄЇюшї¤є╩ч¤ √у█┌┘█┌┘╪╓┘╓┘╪╪╪┘██▐▄█┌┘┌█▄╪╫┘┘┌┘┘┌┌█▄█▄▄▄█▄▄▐▄▄█▐▐▄▌▐▀▄█╓╥╥╥╫╫╪╪╫╫╓╫╥╛ОaL735>[Й▓╓▄стууффхццхуутуухчхццчцхццццччцчцшфтфццхфццхцшчшчччщччууутр▀тт▀р▀▀▀▐▌▌▄╪╫╘╙╘╨╦╟╟╞╜░ё                                                                                                                                                                                                            █}zБА~~{ytxvxwwwtsqprv|~zvvrqsmpnonnonmpsrpmifihfgecd^___`dccjuz^`|ТЩЭгеидедвЬЦШКГ~ГЛРСНЙЕ~{ВЗЗЗОТЦРХдйжЯжоон▒┤│м│╖▒жб▒╛╛╡╝╧╤┬╗╦╧╔─╙шч┌▌ъюш▌ъ∙ўсхў№ю╜╩я·Їсуїўысю■■ш╫ў √у▄¤ ·уф  °╪щ  Ї╫я  ¤ЄЎ   юр·  ї╕й╚ї  Ў╡РД~ГП┬∙  Ў╡ЖГ|~АГЙТ╩■  ■█РКВА}}А}БАКС╝ї   ў└ТОЖЖГЖДЕЖИЙМЯ╙∙  ■╫оУЛКИЙЙЙЙККИКИПШ╝я   ў┴ФРККЕЕДВ~|xvz|ЖЭр■  Ўо|id`\crЙ╞∙  ў╟ЫПККЧЭЩТб╡╦я     √▌─└╣▒Хе║╗мЪЮ┘№    ё╟кж┤╝╝╗Ъ│╬█▐Ё■  ∙▀─╞хы▄╕░▐   Єщюш╘╞цЎ°єЎ   №ЁэЁ√   °эї   №ў°■ ¤ъю¤  ■яюЄьчЎ¤ў╧х■ √ц┌┌┘▄██╪╪█┘█╪╪╪┘┘╪█┌█┘┘┌┌▄█┌┌┌▄┌┌┌██▄██▄┌┌██▄▄▌▄▌▐▄▄▐▀▌▄╪╥╤╥╫╫╪╫╓╫╒╫╥┬СeN93298=Lvм╥█рстуууцццхфцццццццччшччццчхцуууфцтууутрртсууусуууууффср▀р▀▐▀▐▌▐▀▀▐█▌▌┌╫╥╥╥╤═╬═╩╞└╗к├                                                                                                                                                                                                           ▄|zАББ~}~}{zyxxvssrvВ|wustturrsssroprsrrusqmmiifefa_^]_ccbfeefiАУЯвгдгбЭабгвЮЫШХНКМНММЗА~ГДЗЙПУЧЩЮгви▒┤не▓║╢░│┬┬╗╕┬┬╕и░╦╥╩─╘р┘╦╒┘╧╞▌ўў╫╙ў¤Ё╨у ¤ь▄° ∙╧╚ї■ў┌╙∙¤э╘ш ¤ы█°■№ф╤¤ №ыш  ¤Ўї¤  ыу№  ї▐¤  є╘э  √┌ийс  ·╪ЬЕВВКаъ  ∙┐РД|{|ВПец■  ь┤ПЗГББ}~БВДОкр   ·╤ЮЛЖЕГГГЕГДИЛФ┤щ   ∙┬ФЛЖДДЕЗЕЕЖККИКС▒ю   ∙╞ФМЕГ~{xvvy}}БВЙЩ╦∙  ■╒ЙppjlnwЕия  √█пШУОПЪЯЯЦЧо├▌ў     Єхэ▌╛Ь╕╓╪┴ШЩ╩Ў    №╧╝┬▀·Ї╘н╕чяъы√  °у╔о╥▌╥┐╣┘∙  ■■■■єЄя¤ ¤∙   №▌╨фЄ■  ■Її    ўЎ¤  √ї■   √юьцтє■№┘▐√ ■ш▀▄┌┘┌┘╪█┘█┘╫╪┘█┘┘█▄▌███┌┌╪█┌█┘┌▄▄┌█┌┌┌▄▌▐▐▀▄▄█▀▐▌▀▀▀▀▀▀▐█╥╧╙╓╫╪╫╫╓╓╙╦оUA<8:Fpи╨┌▀туццчшшчччччшшчшщшчщшщщчччшчччуууууутсухусттт▀сттуттт▐▌▄▌▌▐▌▄▄▀▐▐▌▄██╫╙╙╥╥╨╤╬═╔┬╗н⤤¤¤¤                                                                                                                                                                                                      ▄Г{Бz{}{{{yxxwuvvyЕВzvuvwwsruvurqnrtsrtsrpnkigedbababe`adeglvЙЭзжзждвЬаЮЯЯЮЪФУКЙНМЙИДАГИККПЦЫЭаддк││мз│╝╖▒┤└─╝╕├┼╝и▓╬╪╨╞╘т▌╩╙╫╥╚▐ў∙█╒∙■ё╬т ¤ъ█ў ∙╠╩°■°▄╘·№я╪щ ¤ю▌°■√х╓¤ №Їё¤  яы√  юр№  °т√  Є╒ы  №▌кж▀  √▄аЕГБКЮч  ∙╕СГ~{z}ВНвт■  Ї└РЖВ~}|}|БДНж┌■  √╒еОЙЕЕЕДВГЕЛУ▒ц   ·╞ХПЙЖЕЗЗЕЖЖЗЖИЛРоф   ∙╔ЦНИД~{zz{||}ВИФ┬·   ┌НttoprxЕзя  №▐пЬХТЧагбЭЫи╣╓Ў     їЄўю├а╝рр╚аЪ├ї    ¤╨╜╔ъ¤■▀▒┴ьЇэч°  °у╔д╔▌╤╞├╪ў      їЄё■ √э√  √т╦╒ю■  ¤їў    ўЎ■  №ў¤   √ЄюшуЄ■№╫┘√ ¤х▀┘█┌█▄█▌▄▄┘╪██▌┌┘┘█▄┌┌┌▄▄▄▄▄▐▌▐▀рр▐▐▄▐▌▐▀▀р▀▀ррсрсттсттр▄╘╨╥╒╓╘╒╫╓╓╒╬▒ГUD>99Dnз═┌схцццшшшщшшщъщщъъъъщъщыъщччцхцфуутууутсуууустср▐сутр▀▀▄▌▄▄▄▐▌▄▌▀р▀▐▐▄▄╪╒╥╤╥╨╬═╩╔┼╜▓дСЙИКИ╖                                                                                                                                                                                                     ▄Б~}АБ}~|{{xxxwvwz{~Б{xywwwwssstsqnortuvusqoliiffeb__^adbdeehm{СвгввбаЮЬЭаввЮЬЩХКЖКЛЗВА{|ДЙКЛУЩавдййо│╖▒и┤╜╣о┤┬╟╛╢┼╦└м▓╤┌╤╚╒ус╩╙┌╒╦▐Ў∙▐┌·■Є═у ¤ы▄ў √╨╬°■°▐╪√№Ё█ъ■¤Ёр°■√ъ┘¤ ¤їя№  Їщ·  Є▄√  °щ°  Є╓ь  ¤р░йт  №▀аЕВВКбр■ ∙╖РГzz}АЛЪ┌¤  ·╩ТИГА~~А~АВМв╘¤  №┌жНИГЕДГГДЕИМТ░х   №╩ЧОЗДГДЕГЕДЖЖЙЛСир■  °╚ШЛЖБ|{||ААА~БГЗУ╜∙   ┌П|xssv}Йея  №▐║жббгжжгваб░╬ё     °·№ё╔з├чы╥вЫ║Є    №╙┐═є  ш╢╞ё∙Ё█Ї ■°▄╢м▀Ёс╡▒╓Ї      √Ўє■ ¤Є°  ¤ы╓╥ц■  ¤єї¤   ўє¤  №∙¤   ¤ёючуЄ¤·╙┘·■№фс▄▄▄▄█┘▄┌██┌▄▌р▌▌▐▀▀▌┌▄▀р▀▐▀▀▀ртттсррсссттфтттстсуутрртс▀╥╤╙╓╫╒╓╪┘╫╓╬╕ДYF?9:Biг╦┌учшщщщъъъъщыьъъыььыъщъыъъшшшццуутутууссстсср▐ссрсср▀▄█▄▄▄██▌▄▄▄▌▌▌▄▄▄█╫╒╥╤╥╧╬═╔╚╞╛╖еУНЛКЙЕ╒                                                                                                                                                                                                    ▌ДБВБ~~}~~|zzzxwxxzАЕzyxxvttrsssqpmrwxxwwrqpmohfea`d`bb_aefjlАЦаггдвбЬЫЭЯЯЭЫЫЦУКЗЙКЖЕГЕМОПУЬзджлп▒┤╢▒о╕└╣▓╖╞╦└╛╔═├▓│╘т╘╚╓чц╠╒р▄╥▐ї·ф▐·■Ї╥ф ¤э▄° ∙╥╥°■°у▌√№Єсы■¤Їц°■√єь√  Їц°  їш°  Ї┌√  Ў╬ї  є┘ю   р│▓с  ■саЕВЙЭ▄■ Ў╢СВ~||~БЙЧ╙¤  ¤╠УКГ}|{~}БВМб╙¤  ¤сзНКДГГГГВДЖКСнф   №╧ЫРЙЕДВВВДДЕГИЙОз▐■  ∙╚ЩНЗА{{~ВВГБАБВЙУ┤·   ╪ТЕГГГДИПгщ■ ¤у╗кккеедббЯб▒╠Ё       ■є╨░╠эё╫аЦ│ю    ¤╘┐╬Ў  я╗╬Ї·я╤Є■■ї╥з╡щЄъ└и╨ё■     ■ЎЇ■  Їў  ■Ёу┘с■  √єє√   ўє¤  √·¤   ¤Ёьцря№·╧╪·■№ху▀ррр▀▐р▀▐▌▌▀▐срррср▀▀▀ссрррррсуттуфстссттусутстсуфцхуутс╨╧╤╘╒╥╫╓╫╘╥╤║ЙZG?9:BdЮ╟█цчшъчщщщышыыььыыээьыъыыъшччхфцуутсттуттуутср▀ср▐▀рр▀▐▀▀▄▄█┌▌▄▄▐▐▌▌▄▄▄┌╫╫╙╤╨╤╧╬╦╟┼└╕зУЛЙЙИЗГ№                                                                                                                                                                                                   ▄ВАБГВАБА}~~zy{|{}А}zzzxvtuttuwsvrtwwvtuooljkhhgcaa^afcdfgil{ТЮЮЭаЮЭЫЬЭбаЭЭЬЫЦМИКЛЖГБАЕМНСЦвиклп▒▓┤╕┤▒╣┬╝░╕╩╧└╝╩╨╔▓│╓х┘╤▄хт╙╒ур┌уєЇыф·■ї╪х ¤Ё▌° ·╫╘°■·ц▀·∙Їює№■ўъў■¤я┌ў  ўч°  Ўфў  Ў╪°  ї╨Ё  Ї▄я   тддх   чвБ~ЙЧ╒■ Ї┤Р||}ВМХ╬¤   ╤УЛДА~~ББГДНв╥√   хиКЙВВГГЕГЖЖИПкф   ¤╘ЭСИЕГГВВЕДИЖЗКРй▄¤  ·╚ЪМЖ|z}ВДДДБЕЕЕКСоЇ   ┌ЦРОНРСФЧи▌∙■№с╢дваЮЭЬЩЬЩа▒╬ю       ■ў╒┤╥Єў▀лЦмы    №╓└╩Є  я└╥Ї√Є╤Ё■■ї╤й║ў■є╬п═я■      ўЇ   °°  ■Їш█┌№  ∙ёє√   °Ё√■ №√¤   ■Єэф█ы√°╠╘°¤√шуссутс▀рсср▀стттуфхфсрссссттт▌рттттхтуууцфутфтуттхфффуфтс╙╤╓╫╫╓┘╫╪╫╓╤╝П\H;7:AcЩ┼┌фчшьщыъюэыыыыыээььыьыыъъшшшцчцццуттууртсртрр▐р▐▌▐▀▀▐▄▄▐▄▄▄▌▌▄┌▌▌▐▌▌▄█┘╫╪╓╥╨╬╬╬╦╟┬┐╕зФНЙЗИЗЗ╢                                                                                                                                                                                                   ╬ГВАГВГГВАБВВВА}{{{}АД~{zxuwyxvttustorvvwxxtqpmjhkjfffdad\bfgikuНЬЯабааЬЫЭЫЮЦЬЬЧХНКИЛИЗЕББЕОТФЪдкйн▓┤▒▓╢╢╡╗┬╝│║╦╥┬╡╩╫╠мк┌щ┘╩▄яэ╒╫цц╪┌Ў√Ёц∙■ў█ч■¤ёу∙■°▄╒Ї■√щ▐∙¤ўшь№■∙щЇ■■Є▄є  ∙хў  °фў  Ў╘Ї  Ї╥ё  Ў▐э   фжет   щдЕВ~ЖФ╘■ Є╢Р~|~АДЛФ╠■   ┘ТИВ}~}А|АВЛЯ╥√   ьлКЗББАБГБДГЙПжх   №┘ЮСЙКИЗДГЕДИЕЗКСе█¤  °╔ЮРЛКЗИККЛЙИЙЖЗЙНль■ ■▄бЫЧЦФХЧЫл╙Є¤√рпбШХУУФФХТЭо╔э     №√■Ї╒╡┌Ў∙х┤Хжы    √▄├├э  я┼╓Ї√ў▌я№■ї╒╚╓∙ ·╪╢╠э■      їЎ■  °∙   ўы▄╙·  ∙Ёё√   ∙є√■  ¤№    їьт╪цЎї═╘Ў¤№ыфсттусррутсрууфтууфурсттутфффууфухффуцхцхфцрсутффшщщщшцху╙╤╙╫╒╤╓╙╫╓╒╧╛Т`K?==@_Ъ╟▐фчщъъыыыююэыэююяяяюююээъщщщцуцфхустттттссттт▀р▀▀▀▀▐▄▄▄▌▄▄▄▌▌▌┌▄▌▀▌▌▄█┌╪╓╤╥╨╬╬╬╩╟├└┤зЦРМЛКККГ■                                                                                                                                                                                                  ═ДЕГБВВГВБАБГВГГА~~АБГ|{xuyzxvuvuuupuwtwwwonmkmkmnecdccgabffghqЙХЩЬЭЯЮЫЬЯавадвЫЧПЛЛОИДБББГПФХЬжомп▒╡▓╡╗╣╢╝┬║│╗╧╒┐╕═┌═░н▐ъ▄╬▀їЄ▌█щъ▐╪Ў¤їцЎ■·ья¤■Ўщ°■·с╒Є¤¤ь▌Ў№°шъ№■√щЁ¤■Ї┘Є■ ∙уї  °тє  є╥ё  ї╥Є  °▀ш   чйб▄■  ызЗГ~ЖФ╘■ Є╗СА~|||~ЗУ╤■   ▀УИВБААВАБГЛЫ╬√   ЁлМЗБББГДБЖЗМРжф   ¤┘ЭРЕЖДДГВДИМЙЙОУе╪¤  °╦иШШЦХФФТСТФУФХШЫдт√ ¤▀мЮШХФФЧЫи├ы№·▄бЧТКИЕЕИЗЗПв╝ф     √ыущ╒╖╪Ї∙ц╗Ъещ    √▐└╗у ■э╞╫Є№√фю√¤ў┌╞╥√ √с╔╧ы■      ўў■  Ёё   Їщ╪╨∙  ·№√¤   °Є·■   №    °юу┘рЁЄ╧╧ё№№юхуутфс▐сттссууцффшшчфхцхффххчффхчшшшъыььюэюююююэюяЁяюэьыт┘╘╙╘╓╓╫╪┘╫╘╬┬Р`I=::@aЮ╦тчъюяЁёёёЄёЄёёЄЄЄЁёЁЁЄёяэъщъшцхфтуутттсссрррр▀р▀р▀▀▐▌▄▌▄▄▄█▄▌┌┌█▄▌███┌╪╪╒╙╙╨╬╬╬╬╟├┐╕иШРОМКЛМЗ╒                                                                                                                                                                                                  ╬ЕДГЕЖЖГГБДДЕДДДВБА~АГЙВ~{{yyzvwvvustqvwvxyxrpmmnmmnhgfc_d]bcefgnЖШЬЬЮЯаЫЮЭЭЯЮаЭЪЦСМИКЕЕЕЕЗЗРЦЪазмо░╡╢░│╜╛╝╗┬┐╣╝╨╓┬╣╥▌╥▒осяр╠▐°ї██ыяу╘Ў¤ўшї■¤яэ·№°Ї°№°ш╪я¤■ё▄Ї√°шф·■№щэ√ ў╪ю■ ∙▄є  °тё  є╬я  ї╙Ї  ·фт№  шйа╓№  ъжИГ~ЕТ╒  є├УВ~||}АЕТ╥    цУКБ~|}|БВЙШ┼°   ёмМЛГГГДВ~ДЗЛРет   ¤█ЩСИЗЕЕЖЖИКНКОРЧл╧¤  °█┼├─└╗╕│пноокдЯЯдк╪ї■√▐┤ЮХПНПСЦб╡ф∙∙┌УИ~ztsvtwvzКз┘     №щх▌╦╗╥Ё°ш┐адч    √▀┼║┘¤¤щ╟╓Є¤■ўє√■∙с╪┌¤ ¤ч╦═ш■ ■№  №єї■  яЁ  ■яу█╥°  √∙ў√   √ї∙■        ·эс╪█шы╥╔ъ№¤ёччхчщщчфччуфцчщщъыъшщщыьяяЁЁЁЁёєєЇ°°ў°∙·№¤¤¤■■■¤■■   ■¤°яр┘╫╓╒╙╫╫╪╙╥╤┼УcI=:=Edе╘ъяЇЎЎў∙·√···√№¤¤¤■■¤¤¤№√їящшхуусттуууссс▀▀▀▀▀▀р▀▀▐▐▐▌▄▌▄▄█┌▄▄█┌█рр▐┘┘█┘╫╒╙╥╧╬══╩┼├╛╣лХПООНООМв                                                                                                                                                                                                  ╬ЖЙГЕЗЗЖДДЖЖИЙЗЗДВГА~}}БЕВ~|{{zxxwwutvrxxxzxvnooopnmnjjgfdg`cccefpЗУХЩЬЭЮЩЬЬЭЮЭЮЬЪЧТНГВЕЗИЖУШЭвзо▓▒╢╡▒┤┐┴╛╗─┐╗┐╤┘├╗┘у╓╡░хёт╬▌∙°┘┌эЁф╥Ї■·щЇ■ ьт·■·ыє■¤ю█э¤ Ї┌Є¤√ы▀∙ №ыщ· ∙╫ю■ ∙шё  °рю  ё╧я  ї╒ё  №хр№  шкЯ╤·  ъзИВ~БП╘■ Ї╟ФВА~~ВЕС╙    ыШНЗГБВДАБЕЛЧ┴ў   ЄлКЙДДДГГГЕИМРг█   ¤╓ШСИЙЙИКМПФУЫж┤└╨х№  ■ЎЇяёёЁът╫╦╛╝╡кжзе▓╤ю№°╪мНБ}||БЗФпс°Ў╓М{ynklsptq~КЮ▌      °°ї▀╛╤э·ъ╞ШЮу¤   √у┼╡╥··ч╔╙ю¤ ўє√■√у█р  ■ь╨╟ц¤ ■¤  Ўяє№  юю  ¤щ┌┐─ї  ·√°ў   √ўў■   №    ¤ю╪╩╤ьё╘┬у·■єъэююЁЁяюяєєЇў°·√√¤¤■■■■■■¤¤¤¤¤№№¤                       ўш▄╫╪╫╓╪┘┘╫╘╥╔ЫeM=:=Cg▒ф∙■                      ■їэъчцхуфурстус▀▀▀▐▐▀▀р▀▀▐▐▐▌██▄▄██▄▄█┌┌▄▌┌█▄▄┌╫╒╥╤╧╬═╬╠╞─┴╗лЪУПППТФРЗ                                                                                                                                                                                                  ╬ЗЗЕЕЗЗЖЖЕЗИЙИИИЖДВВАБДКГА{||zwxwtsrsqyyyzzxsqqpppoqnlidac^beffhsКШЩЬЮЮЮЩЪЩШЩЧЪШЧЦУЛВГГИКОПНЦЬвекп│┤╕╕│╢─╔─╕╔╞┬─╥▄╩┴▌ц┌╕▓щїх╥▀··╫▄Ёєц╨Ї■√щЇ■ ёр°■№юё■■є█ю¤ Ў█Є■¤я▄° ¤ыщ· ∙╒ч■ ·цю  ў▐ъ  ё╬э  Ў╓ё  ¤щ▐√  щкЭ╦∙  ъжИГАН╙¤ ї═ФГ|ААВДР╠■   ьЬОДБББАБВДМЦ╜Ў   ёпЛИЕЕГВГГГЕЙНЮ╙№  ■█ЬУРРРСЦЩдо╡┴▄ъЁЇ·    ■√№¤¤√°Їщ╙╕▒жЭЧУФ▓╔ы·Ї╟И}qggipwДнс№√╫ЛЕ}|x{ЕЛДДз┬┴▄■      №√р╧╒ь·ю╞Ча▄√   №х─п╠Ўїт╥╒ь¤ ўю·■√чрф   Ї▀╥т№■√°  їшь№  Ёь  №ц╪─╡я■■·ЎЎє   №ўЄ■   ¤■   ■ё╪╦╩чё┌┴▀∙■¤№¤¤¤¤¤                                                  √ъ▀┘╫╙╙╪┘╫╓╙╥╔ЯkO>:=Cj╖Ё■                        √Єюшцутфтррсу▀▐▀▀▐▀▌р▀▌▄▄▐▐▀▄███┌┌┌▄┌╪┘█┌┌┘██┌╪╒╥╤╧╬╬╬╬╩╞└╗наЧЦЪЧЩЩХЛ                                                                                                                                                                                                  ╬ЙКЕЕЙЙЙЙИККЛЛКИИЗДВБАБГЗЕБ|{zyy{yxxxwtwxxyzvsqnoppqqolkggmdegfgfrКФЦЪЫЫЬЪЫЪШЩШЪШЩЦТЛБГГИМННМЧвеем┤┤┤╗╝╕╝╟╦╞╕╩╩╔╦╥╪╠╞рш▄║┤ь°ъ╒у№·┘█Їўъ╘Ї №щє■ Ї▀° ¤яя■■ї▐ю■ ∙┌Є■■Є╪°  юч√ °фы№ ∙╫ц  ў▄ъ  Ё╧э  ∙▌ь■  ы█√  шнЫ╟∙  шеЙБА~М╦·■ў╤ТГБ|{~ВВР╦√   эеПЕВБВАГЕЖЛФ║°   ЇпМЛИИЗЗИКМНПУг╠√  ■р╡дХШЫаж╡╟╧╨сў√¤¤■     №·√√Ўш╪╟пЬМВytsyЙ┬щ∙ё╜yq``^bhpВ░ц¤¤х╡└ШИИЯ┐╝бУ┐уёї√     √¤№с╩╥ь√ё─Цг┘∙   ■х┼▓╚ээ▐╠╬ь¤ ∙є·■·шфш■  ∙ф╧▀∙¤·ї¤ їъш√ ■ёь  √ыяяфш√■·ЄЇя   ■°ю■   ■■    ў█╚╟цєр─█°                                                          ·ф┌╓╒╘╘╫┘┘╓╙╥╩ЪlR=89@q╝ї                         ■∙Їщуттсттссср▀▀▀▐▐р▐▐▄██▄▄█┘▄▌┌┌▄┌█╫╪██▄▄┌┘┌┘╫╙╤╧╧╧═══╟├╜╕ндЬЩЪЪЬаЩН■                                                                                                                                                                                                 ╬ЙЛЙКНМЛККЙИЛЛЛКЙЗДДВГЕЗЛЗГ~}{xzxxwxvtxzzz{zvvrrqopsqnjeehefhhggsМЧЩШЫЪЫЦЧХФТТХТФРНЙДЗЙЛОУФСШзййп╢╗║╛╝┤║╩╨╟╕═╥╦╞╒у╒╟ръ▐┐╣э∙ь┘ш■·┌▐ў∙ь▀Ї¤№ъЁ■ Ї▄°  єщ■ °▄ы■ ∙█є■■Їщ· ■ют· °╙р№ ∙╫у  ї▌ш  ё╥э  √ъэ¤  Ё╘∙  чнЭ┴ў  фдКВБ|М╔ў№∙╘ФГБ~{~ВВР╟°   ькПЕВАББВДЕМФ╢·   ї╣СОЛММННОСТХб▒╬ў  ■ы╦╕нии░╣╠▀у┘фў■■■     ь┘рр╔мФЗ{rmhfbeiqГ╕ы∙Ё╛{jccdkr|М┤ъ■■я╪╤┼мв─чс│Я╬цхы·      ¤№у╨╨ь№ї─ХЯ╘∙    у┬╖╨ьэ▌╥╠ъ■ √є·¤·ыхъ№  №щ├┌ў¤∙Є√ ∙шф°■■Єы¤■№ї√·°щ∙■№їЎя■   ∙ы     ■    °▐╦├уєу├╒ў                                            ¤¤■        ¤¤№є▀╙╥╥╥╥╘╓╒╙╙╥╩ШoS?:;9FYФ▀·       ■■■  ¤        ¤¤№ўЎюхтсс▀▀▀рр▐▀▐▐▄▄▌▌▌┌█▄▄█┌┌┌██┘┘╪┘╫╫╪╪╫╓┘┘┘╪╒╙╙╤╧╦╔╔╔╞├┬╝╕нХ|pjilnlЇ                                                                                                                                                                                                  ╩КПЛСФХФТХУФСССТУТСОЛККСУТМИЙДЖБАБА}z|~АААГД~yyyxyywvsqpmoprponkl|НУПМИЙЛНСХХФЦУФФЦЦФРЕРЫажйем╣╡░╛╤╤┼╞╔╟╩╘с╤└фЇёрщ∙∙ышЇЎу╟ъ¤ єы¤№єя∙√ы╦Є √шф¤ ї▌ё ■Ёс¤ ∙тт¤ Ї┘ы ¤ы═ё №ш█∙■є═╓∙¤Ё═▐¤¤Ё╪т∙¤я╘рў■Ї╦╥ў √╪╡ъ■Ў╫▓▓╔ю■ў╘╕йЮШУЬ╜у°Ў┼ЮЧРЛЛКНЛФи╫№  я╡ОА~zzzyvuw~Т█■  юП|liggjdefknwГЩ╘  №▐Щ}xwvvwxwurqlfd~╤∙ №┘ШРЙЗДБААА}zyyБИлрєэ├У|wЗв└═фр═х·√я¤ Ў╚к╓·Ї╚Ю╫ў°р▐■    Ї¤ ¤ё▄ш√·у╖Ю║ш    єр╪╓ў■■єсч№ ■№°∙√·ў▀т№  Ў╘╚рЁЇяэЎ  ўъЁЇ▀╞ъ¤ ·ы╒╞╤ю√■  ∙Ў■ ■Ўфє    №■   Ї╓▓г╙ъ▌┼┬щ∙·√■■■¤№°°ЎїЎЎЇЇЄЁюююьээюээьэьыыыщъшъщщшчщщщъъъшшххшыщщыюыр╙╚╟╬╧╨╧╨╨╧╨╬╞ЪvQA>9BXП╓ї№■¤√··∙∙∙°°∙°··√√√√·∙°ўїЇячтр▀▀▐▄▐р▀▐▀▐▐▌▄▄▄┌┘┘┌█┌┘┌▄┌┘┘┘┘┘╓╫╫╫╫╪╓╪┘╪╘╥╤╨╧╩╩╔╟╞├┐╗╕мФ|neddfm                                                                                                                                                                                                   ╬ИНМУЧЧФХЩШШХЦЧХЧХУРЛЛИРХФНКЛИЙЕВАА}~АБДДЕГ}zyyxwzvwssrqqqpqqokm}КОНЙДГБЗМРФФЧХФЦЩШЦФИСЫгйоо▓║╣╡└╒╫═╧╘╧┼╪х╙╞ъ∙Ї╪с¤■яцЇ∙ш╞ш■ Єш№¤єЁ°√ь╬ё■·шх¤ ї▐ё ■я▄· ∙с▀¤■ё╒ы■¤щ╠ё ∙у╫°¤ё╚╓°№э╔▌№№ь▐хЇЎъ╘тї¤Ё┴╥є¤ў╪╣щ¤ї┘╔├╦ы■Ї╓└▓ЮЦРЦ╡┌ыц┴УКГААВДОЩ╦·  ыЮАqliiljjjkvО╙№  щР~rqqsstvvww}ЛЭ╪  ¤тЪБ||zyyxytri^Y_w╚є■√█ЪСКИЖГВБ~БА}{zДИи┌Ёь├У~zЕг├╙Ўю▀фЎ·Є· Ў╞Ы═ўэ─Я╓єї█▄■    ·■■·ь╓р∙Їс║б│ц    Є╪╥╨ў■■Є▐т√■■√ўў·№√шх№ ■∙╘╞▄юЄшчЇ■ ЎфяЇъ╨х· °ъ▄┌▐ю∙■  √∙■ ¤Їсё¤   °¤  ■є╪│б╨ф┘─┐хЎў°ў°ўєЄєЄёёЄЄЄЁююььъщщъьыъщщшччшщшчшшщчццчщшшчцфсуухцхчшч▄╤╔╔╧╬╧╧╨╧╬╧═┼ЪwP<73@QЙ╩щї°∙∙°°ўўїЇЇєЄёёёЁЁёЁяюэьшцс▀▌▀▀▐▄▄▐▀▌▌█▄▄┌▄▄┘╪╪┘┘┘┘╪┌█┘╪┘╪╪╒╓╓╫╪┘╫┘╫╫╤╤╨╧═╚╚╚╞─├┐║┤иУyjb`^aм                                                                                                                                                                                                   ╬ИУПЦЩЫЧХЫЭЫШЧЦФШХХУТПМРЧЧРЛЙЙКЗЖГВААВБГЕЖЕИБ|{}z|xxusspsvsurqno~НТНЙГГ~АГЕИНРНТХЧШЧХКФЭи▒│п░┐╛╣─█▄╟╥█▄█▄▌╓═ю№ў█▌¤■яхє∙ы┼х№ їу√¤єшї∙я╪ё■∙эц¤■їсё ¤э┌√■Ў▐▌¤¤э╧ъ■№ч╔Є■ўс╓°№э╚┘Ў·ш╔р°·э╒▄ї√ю┘сЄ·Ё╬╤є■°╘║т∙ё╓┐╢└ф∙э╠зШСЙЖПз╥ьщ╢Аvnnqtvw~Н┐°  ьаwhgdfhikmq{Н╙√  ъЧИ|{zyxy{yz{АКЬ┘  ■цЩАГ~~{zzuupk\PIPu┬ю¤∙┘ЪУМКЗДГВВ~~|zxБИж┌эы─У{Жг╞╪ўяучёЎєї■Є┐Ч┼юц╜г╤юЄ╪╓■    ъ·■Ўч╤┘Єё▄║б▒т■   є┘╙╩ё■√я┌▌°¤¤°Ёї·№¤яъ√ ■ў╪┼┘ьЁш▀є¤■ўшюєы╪фЎ√ўяўїфюў■  ўє¤ №ёуэ°■ ■¤¤  ¤Є┘┤г╠р╪┬╛сёЄЄЄЇЄєёяююююээычччццхуучццффхцффффтуутррстурттр▀▀срссссус╪╬┼┼╠╬╨═╬══╬╬─ЫxP;55=K}╣┌уьэюэяюээяюээюээьююэщчфсрр▄█┌▄▐▌▌█▌▐▄▄▄▄┌█┌▄█╪┘┘┘┘╪╪┌┘╪╪╪╪╪╓╫╓╓╓╓╙╓╫╘╥╨╧╬╦╩╚╚╞┼┬╛║▓зПve]Z\^ў                                                                                                                                                                                                   ╬ЗПСШЯаЩШЭаЮЮЪШЧЧХХФСПНУЫЩТНМММЛЛИДВ}ГЕИКИЗЗГ}}{z}zzyxwuwxwvwrnuКНМЕАА|ГИМЛНУЧШЧФЗТбл╢║╕▒├┼┐╟уу╒█▀╪╒тэс╫Є¤ў█▌ ■ЁтЇ№ы└у∙¤їт·¤їшЄўёщї√°Ёш¤■Їтя■№ъ╒√■є┌▄√№ч═ь■№с╠ї■Ўу╪Ў№ы╨┘є∙ч╠▀ЎЎь╪█є√э╒┌ю°ъ╬╥ё■ї╠з┌Єщ═зТШ╒Єф▒К}vv|ЕФ├тт░{jdehklnxЗ╡Ў  ЇмsuuxwwvwzБС╧·  ьдЙ~А}А}АГКЩ╪¤ ■чЫАВ}}z{ztpg^L=9Gs╜ъ√°┘ЬЦМКЙЖГБВА}}{zИе╪ыъ┼Т~Жз╦┘єю╫▄Ё°Ёчьт╕Ф┐цр╕г═тф╥╙№    эїєю▐╔╓юю╫╡Ынс■   ё╧╩├ъЎЄф╨╫є№№Їэё·№¤Ёш·■¤Ў╪┐╒щьц▐ї¤¤їшчюш┘уї√ЎЇ√·Ёюї¤ ■єя√¤·юршё√ ¤Є∙ ■№Є╪│в╚┌╫┼┐▐ььфшъыъъщшшщшшчцтртсрс▀▐р▀▐▄▌▌▌▐▐▐▄▄▄▄▄┌┌┘▐р▄┌┘╪╓╓╪┘╪╪╪┘█┘╥╚┬╞═╬╧╬╬══╬╬┼ЪuP<638Etз╠╪рцчщшчццццчффссссстутср▀▐▄┌┌▄▀▌▌▌▌▌▄▄┌▄┌┌┌╪┌┌┘┌██┘╪╪╓╫╫╪╪╪╒╓╒╒╓╒╘╓╫╘╥╤╨╧╩╟╟╟╞┬╛╜╣│еНsbVWXД                                                                                                                                                                                                    ═ЙУУЪжеЮЪавваЯЬЬЪЩШЧУТРХгЮЦТРПОМЛИЗЖДДЖИКМММЛГА{}zzzytsxxxwxtquГСРНИВВ}~|}~}ДБКОУЧХФКХе▓╖┐╗│╞╦╞╦щъ╧▀Ёю▀ц∙ю▀Ї¤ў▄█ ■я▀ё∙ы╚р№ ї▄∙¤їцЇ№ї╪ю¤·Ёш№■Ї▀ю№№ц╥∙¤ё┘▄∙√у═ю¤·с╒є№Їт▌Ї√щ┌сыът▐▌яЇы╤╧эїч╧╓цЇх┤░ъ√ё╖Щ╨ыт║МЗО╞ъ▀йГrijoyК╗фтп}nihikmquЗ▒Є■ ў║Жzwwwxyz|{ДУ╩∙  юмПГБААБ~ГЙЦ╥·■ чЬДГ|zzwsj[J913Co╡ш∙Ў╫ЬЪМЙИЗГВВ||{xy~Кд╒чч╞П~{Ип╓уыщ╨╪эїютЇ▀нР║▌┘▓Ю╞сч╥╧√    юЁЎъ╫├╨щш╤оЧлр√   ё╔╜║сЄь╫┴╥эї∙єщя∙·√юрЄ·∙ё╒┴╤шюу█є№√єфущф╪▀є·ЎЇ№·ЁэЄ√ ■эы·■∙ю▌хЁў√№ї∙№№·я╒▓а┴╓╒╚┐╓цу┘▄▐▀р▐▐▐▐▄▄█┘╪╫╒╘╘╘╪╫╫╪╪┘╪╪╪┌┌╪╪╫╓╙╙╙╤╥╥╓╒╥╥╥╥╨╨╥╙╥╙╙╓╫╓╨╞╛├╔╠═╦═══╬╬┼ЫsM;415BnЫ└╥┘█┌┌▄▐▐▀▀▀▀▌┌█▌███▄▐▐▄██▄╪╪┌█▌▄▄▄▄▐▄▐▄▄█┘█┌┌┌┌┘┘┘╫┘╫╓╒╓╫╫╓╙╫╫╫╪╫╒╓╓╥╥╤╤╬╩╟╞╞┼┴╜╣╖пбКp_XSXє                                                                                                                                                                                                    ═ЙУЦволвбджждаЯаЮЬЪЫЧФХЮжаШХУУТСММЙЙИЙКМПРННМЕГ}}}|А}}}~|yyzzzxssxДПТМЗ~Аz}}~А~ВГИНУЦФУИФм║┐╟┬│═╙╬╙ыь┘щЁЁщщ·єфї¤°▐▐ ¤ю▌ё∙ъ╧у√■ЎщЎ√ЇхЇ¤°▐ь°°єё·¤Єъё∙∙ш╧ў№ю█рї·▀╠э∙ЇршЇЇщсуя∙у╞╠цш▀╟╤тщф├╛хёр╖┐▀ё▐┐╖т°ю│Ф╟шр╕П}З┴у┘│ЙumlnwК│р▀░Жzonnqrs{Илъ■ ∙├К|~||}||}ДС├Ў  Ё▓ПГААББДБББГИФ╦ў■ чЭЕВ}{uutn_F6*&*?mму∙ї╥ШХЛЗГГБА~|zyyx|Жа╤уф╦Р}zЛ│▄шхт╚╥щєэ╙р╘иН▓╙╨йЭ╝█ц╓╬Ў■   ёышт╨║╔сс┼гФи▌°  ■ю┼╕п╫у▐╧╕╟уяїячьїў∙ъуыЄЄэ╧┬╤ущс▐я∙°Ёр▐шт╨╪ё°їё°·щцю∙■¤шч°¤Ўъ▌фЁ∙№∙щЇ√·°э╤мШ╜╤╥┼╗╨▀▄╬╧╤╨╤╙╙╓╥╤╥╤╨╧╤╧╤╤╨╤╥╤╨╧╧╧╤╧╨╧╨╤╤╥╤╥╙╥╥╥╒╙╧╨╤╙╧╧╧╨╤╧╧╨╥╨═╞╛┬╚═╬═╠╠╬╬╧╞ЬuN:202AkЩ╛╤╪┘┘┌┌┌┌█▌█┘┘╪┘┘╫╓╪┘┌█┌┌█┌┘╪┘┌█▄▄┌▄▄█▄▄┘╪╪██┌┘┌┘┘┘╪┘╫╪╫╓╓╫╒╥╙╥╙╒╙╘╫╙╥╨╬═╔╔╞┼╞├┐╗╕┤наЗmaVXз                                                                                                                                                                                                     ═КУЩи│педджийжжжгбЯЭЩШШглзЫШЦЧЧЦФФСОЛНРСУЦЧХТКЖДЕГАВ~|{{z{z{{{wtvДСУОЗААz|{|{x{{ГЖНСУРЛФ░┐╞═╚─╥┘╥▌яш▌я¤√ьц√°щЇ·ўу▌ ¤ы┌є√ъ╗┌√¤э╘Ёўю󯤹хщ√√Їь∙№єЄїўєъшї∙ьущЁЇ╫╩╪ыц╥╞ъюу╫╪щї▌╤╦┘▀┘и╕фЁх╕╕▀я▌╢┤┘яуаЬ▌Ўю╖Щ┼хф╠ЧИЛ╛▐┌┐ЧxrnqzЙ░▄█░ОАwtruux|Жец¤ ∙╟НВ{zzy{z{~ДП╢є  Є╢НВ}|}АББАДИУ╚Є■ щЭГ|zurkdK4*# '9iе▐ўє╥ЫФКЖГВ}{yzyxuvzДЯ╨хщ╬С}zЙ░╘┘┌╪┐═фЁюфр╔аЛд┐╗гШ┤╒с╧╦є■   Їєы▄╔▓┴╫╪║ЪСд╪Ў  ■ъ╛▓л═▀╒┴░╝┘ьёэтщєїЇш┘хэяш╩╖╠хщ▌╧ьЇЇы▄┘▐▄╤╪яўЎєўўшфъї·∙суЎ√Їу┌рЁ∙√їфё°ЎЇщ═зЦ╢╟╦┼┴╔╫╙╦╦═╧═╧╧╥╤╧╧╠╧╠═╩╔╠╩╬╠╠╠╠╠╠╨╨╨╧╨╨╧╧╬╧╧╨╨╨╥╧╧╬╧╤╤╧╥╙╥╨╧╧╨╧═╞╜┐╞╔╠╠╩╔╦═╧╚бuM80//?iЧ╜╨╘╒╓╫╫╫╒╫┌┌┘┘┘┘╪╫╪╫┘██┘┌┌╪╫╪┘┘┌┌█████▌█┌╪╪┘┌┌┘╪╪╪╪╫╪╓╫╓╙╒╒╒╥╥╥╥╙╤╥╙╤╨╬═╔╟┼┼╞╞┴╛║╕▓кЫХpc^l                                                                                                                                                                                                      ╬ЛЦа░╕┤лйлмолйкижжзигЮЯкмивЪЪЪЩШШЦЦФРРФФЧЬЪЦТЛЗБВБВЖДГА}}}|АВАzwzГРСОЖ|w{zАБ}||ДЖЗОХТЗУ▓├╠╘╩└┘хъъї·чЁ ■Їя№√ыяўЇчр■№ъ╪Є√ы╛╘ў∙ц╠шЁштє¤■ўю·№°хЎ№Ўшшєєр╥Ёїч╫╪щы╠─╠▐╫жз╒чт╞╕тёс┤│╓с┘н╢▐яч┼▒┘юр╝╡╪Ёх║м▀Ўє╠з┼уш╓мДЛ╗┌▌╚Э}uqsxЗм╓╫░ПБyuswqx|Жбс№ ∙╟ОГ}}{z{{}~ДМ▒є  Ї┐МА~}}АБВБАБЖТ├э■■шЩГzuojbU:%#6eЭ█єЁ╤ЭРЙЕГА}zxxwwwttwГЭ═тщ╤С}zЖз═╘╙╬║╞▐эу╞╙┴ЦЗЦ░иЮЧм═█╒╙я■   ё╙┌╙┬л║╠╧┤ЩРЯ╥є■ ■ш╝йв║╟╧╝й╗╓ьящсхяёьчрсшэу─░╔сч▐╫шЁяц╘╫▌╓└╥эЇєэїЎф▄фёЎї┌▀є°Є▀┌▄юЎўЄрьўєют╟ЮФ▒╚═┬╕┴╒╨╔╩╦╔╔╩═╨══╬╬╬╩═══╬╠╬╔═╦╦╩╩╠╠╬╬═╬═╬╠╬══╨╧╨╬╨╬╬╬╬╬╨╤╬╩╬═╬═╠╞┐├┼┼╟═╬═╬╬═╞бtL9/--AiУ╕╬╥╓╫╪╪╪╪╫╪┘┘╪╓╓╓╓╪╪╪┘┌┌▄█┌╪╪╪╪┘┘┘▄▄┘┘█╪╓╫╫╫╪┘┘╪╓╪╪╫╓╓╫╒╒╫╙╥╤╥╥╥╥╤╥╥╨╬═╔╚┼┼┼╞╞┬╝╣╕▒зЫ                                                                                                                                                                                                           ╬МШг┤└╣░о▒▒╡╡▒▓░оп░плзи▒╡░ибЯЯЮЬЬЩШФУУУФЦгжбШТОИЗДЕЙЙЗЗДГГББДВБ}{zДСУНГ|{yzy{||xx}ЕМФТИУ│╞╥╪╥╨сьЁёЎЎыё ■Ёь¤¤ью∙·ш▐√√ы╫ё№ь┴╙ЄЎт╔цяц▌Є¤■√∙·∙Єрю·є┘┌т▄┌уъя▌┐┬▌▀╞г╕╘╤йЩ╧ус╥╧┌юх┬╖╒хт╣┤рЄэ╙─╪яф─п╫ёы╚╖уўЎс┤─сы▐╡ЖЛ╡╪▌╠б~xquzЖз╥╧кОАwvvxw{~ЖЭ█∙ ў╞НВ{|yz{z|~ГК▒ё  Ў┼ОБ}}{~АБ}АЕС╗щ¤¤цЫЖ~xpi_TA'!2bФ╓Ёю╠ШОЗЕА|{yvuuuutvxВЪ╔сш╙С{uЬ╕└└╗▓┬┘шр╬╤╝ФЙСзкЩСа┼╘╠╟ы■   ї╨╨╚║л┤╗┬│ЪРЫ╔я¤ ■х╜жЧ╕╙╠╣и╗╪ыьч▐фыяьу╓▀шэр─з╞▀т╒╟уьъс╓╓┌╥╚╤щЄэцёёр╫тяэ▀╥╪юЎю█╙╪эїїэ┘цїЄы█╜ХУи┬╩┐░╕╙╨╚╞╚╩╔╔══╩╔╩═╦╩╩╩╩╩╔╩╚╦╔╩╩╔╧═╧╬╬══╧═╬╔╔═╠╬══╠══╦╬╬═══╬╬╧═╠─╜┐─╞╔╩╔╔═╔╦┼аtM7---AiР┤╠╤╙╒╒╓╫╒╪╫╪╪╓╪╫╒╒╫╫╫╫╫╪█┌┘╫╫╪┌╪┌╪┘▄█▄┌╪╪╫╪╪╪╪╪╪╒╫╫╥╙╒╒╙╒╓╒╤╤╥╥╥╤╙╥╤╨╧══╔╞───├└╗╡╡▓ие                                                                                                                                                                                                           ╬МЬи╗├╛╡┤╢╡╖║╕╕╖╖╡╢╢│о░╣║╢▒йеиеддгбЩЪЫЮЫЮжкжШХПЙЙЖКРОЛЙИЗЙЖЗЙЗЖБ}ЕРУП~xwy{{}}|{|~АЕЛХОЙФ┤╦╪р╒╨шєЄэ∙№ЄЇ ■яф·√юы°·эрў°ы▄Є√ю╬╪ёє▀╩рцссь·√ш╓щЁф╧фєч╟╨щы╔│ць▐╣╛┘┌╠┼├╚╩╚╗═фх╓╛┌яъ╥╛╘фт╥└сЇЄ╒┤┌єш╦┤╒Єя╨┐рЎ°ч║┴▀ьс╡ЗН▒╒▀╬жysx{Жг╔╦зОВywuvuz|ЕЫ╙Ў Ў┼НД||zzz{|}ДЙ▒Ё ■°╚ПВ~~}}АБАА}~ДС┤ф·№хЩЖzsnbT?,.^П╤ьъ╞ФЖБ}{xvvtrrssruuГШ╞▌ш╙Ф}uxСн▒ийк║╙ф█╧╧╗ФЖНЮбЪСШ╗╧╨╩ц№   ї╤╤╟▓бо└╞╢ЫМЦ┬щ√ ¤х╝гХ╝╘╠╕й╕╪эът┘▀щьщр╒▀ъьр┬░┼▌т╥┐┌шх┌═╙┘╥║╩чяш▌ъш╪╨┌шу▐╟╨щЄы╓╥╙ъЄёш╙тёяш╓╖УУг╛╚║л┤══─├╞╚╚╩╠╩╔╚╩╠╠╟╟╔╩╔╟╔╔╔╔╩╔╚╩╟╔╔╩╩╔╧╧╬╦╠══╠╦╔╩╦╔╚╠══╬╬╠═╠╔╔┬╛┬─╚╩══╩╠╦╔┬аtM7*+*@iР▒╔╤╥╒╓╫╪╓╪╓╪╓╒╓╓╒╥╥╙╙╒╓╫╪╪╪╓╫┘┌┘█┘┘┘┘╪┌╪╪╫╫╫╫╓╪╫╫╓╒╥╥╒╓╒╥╙╙╤╨╥╥╥╤╨╨╧╨╬╠╩╩╔╞├├╛╝╣╡│░з│                                                                                                                                                                                                           ╧Лг░┐╟├╕╣║╗┐┐╛╛╝╗╝╗╗╕╢╕╛└╗║╡ппнллидвбвижн╝╗╕йЫТПНЛОТТРНМЛМДЙЛККЖДИПУПА|yvwxyzzvxy|ДМФОКЦ╕═▌ш┌╬э√∙ю·¤ўў ■эу·√ящЎ№я▀Їўы█Ё·ы╨╙шу╨╦┘┌╫╘фьф█рщэ╘╜▀Ёу╞╦фш▀╓ръх╥┴┘ц┘┴╛═╒╥╩╩тчр╦╫яЁ╪╝╤щъ╫╟сЎЇ╫│╪єъ╨╡╫ЁЁ┌╧сє∙э┬╣рют╖ЗМн╙▐╬г~ytuzЖг─╞зОywuxxz~ЖЩ╤Ї Ў├ЛЕ{}xz{{|{ГЙня■■∙╟ОЕБ}zz|А}}ДТ▒р°∙сЦЖyreUB.!0[Л╠чф├НБ|xtrqonommopsuАФ┐┌ш╙ФvxДПХУСЩ▓╧х▄╬┐йРЗКабЪРТн╜╖┐у√   Ў╒╤╟╕зи╢╞╣ЫОФ╗ф∙■№ч╜ЪС└▄╥┐о╕╘щч▐╫▌чшу╪╨█щъ▄╜Я┴┘▀╤╝╓р█╙╩╠╘╧о┼съф╘хт╦┼═╪▄╙╗╔тьч╙╩╬цЁюу╨▌эыф╤▓СТЮ╝╞╕з▒╩╠─├┼╞╔╔╚╔╟╞╟╔╟┼╞╟╟╟─╚╚╚╞╚╩╩═╩╔╩╬╬╠╬═╠╩╔╔╔╔╟╔╦╩╔╩══╬═╩╔╩═╔╔┐║╜├╚╩╠╩╩╔╔╔┬вpL7+(,@hР▓╔╨╧╥╙╒╒╥╓╫╫╒╙╒╓╫╙╥╙╙╓╒╒╓╪╓╘╒╪┘╪┘╫╓╫╫╓╫┘╪╫┘╫┘╫╒╥╥╤╘╤╙╓╒╒╙╒╙╤╨╥╥╤╨╥╤╨╬╩╚╔╔╞├─├╛╗╣╕┤░в├                                                                                                                                                                                                           ╪Нй╢╞╩╞╜└┴┴┬─├┬┬├├┬├╜╕╛┬┬─┬╝╡╡│┤╡╡┤мо░┤┤║├├╛│зЬФУСТЮЮЦУУУХРФЦФРЛЙДКРТП|utwxzz}z{|~ЕНХОНШ╣╧сс╫╙Є¤√ы√■·° ¤ь▐·¤єчє·ёсшъшыюїф╚╟╤╪╞│╬▌╙└╓Єё╧└фь▄┐█єЁ╤╧цэт╧▐ъщ▀╧╓шу╨├╧р▐╩┼рщс╨╓яЄ▄╦╙ъя╘╡▄Ўї╫▒╘Єь╙╖╥эя▀┴╪Ё∙Ё╬╞▐ьу╖ЖКи╧▀╧аzsuxЖг╜└жП~xwuwvy{ЖШ╔є Ў┬ЛБ|{{z{}{ВК░ь■■·╟ОДБ|{zz|Б~АДЕУо▄ў·▌УГuhXB2$5]Й┼тр┐ПzuqponlmnnnnoquС╗╫ч╥ХАrm~ОНЖВМз╚▌╫╚╢ЮЛЕДЪЪФМЛа▒╖║▐∙   Ї█╥╚│ЯЭ▓┐╢ЧЙТ╖▀ї№№ы┐ЪО└█╘╛ги╦ст┌╨╫ту▌┘╘╘┌▐╒▒Щ╝╓▄╨╝╞╥╙╚╝╞╩─з╗┘у▌╬т▐╟╛╤▌┘╧╜├▄шх╥╚╦уэъ▀═┌щчс╧▒УОЪ╣┼╖бп╟╔├┼┼╞╞╞──┬┬├┼╞╞╟╟╟╞─┬╞╞╞╟╩╩╩╟╟╔╩╦╔╦╩╩╔╔╔╩╬╩╠═╠╩╚╩═╬╔╟╔╟╩╔╟╛╖╣├╔╩═╠╠╔╩╔┬ЮoI7(*.?hР┤╔╨╧╥╒╓╓╙╒╒╙╥╥╙╒╙╥╥╙╙╒╒╥╓╫╒╥╒╫┘╪╫╒╓╓╓╒╪╫╒╥╒╙╓╙╙╥╤╨╨╙╥╙╙╥╥╙╙╨╨╤╥╤╨╤╨╨╬╦╚╔╩╔├└╛╜║╕┤▓нЯ╪                                                                                                                                                                                                           ▐П▒╜╦╬╚┴──┼╞╞╞╞╞╚╚╩╔┼┬╞╩══╔├╗╝║╕║╣╖░▒м▓╖┬═╧╠┴│еаЪЧЧжлжгЯЪУОШЮЮЪХПИПФУСИАzzzyywyuvw|ЖЛФСПЧ▒═тЄф┘ё¤√Є√■■  ¤ь▄·¤Ёуюўя╫цыф█цэ█╝├╙╘╢и╘▄╩┴╒ЇЄ▄╥хёь╥┌ЇЎф╥чїЁ╥╪эёх╦╓ъщ╓╩╘ст╤╬сыу╥╥юЄ▄┐╧ыя╓╢╪ЇЇ┌▒╨ёь╓╢╠щэу╞╥Ё·ї╨╝▄ыс╗ЙЙд╦┘═вА|rrtДЯ╢┤вО|vwxxx{~ЖЧ╞Є■Ї┬МАy{zzyy{}БЙ░ъ¤■√╞НГ~{{xzy{||БЕТо█їў█ПАk\F0! 6^Й┴▌█┐П|usqompoomlmmqtС╕╫ч╙ХБtp{МН{xЕа─▀╘жТМЕ~{ЛСРЛЙПЧа▓▄ў   Ї┘╤╟▓ЬР│╛░ХЛУ▓╓я№№э┴ЬО╜╥╔╣еЬ┴╓╪╙═╙▐▐╫╛╗═██╟иШ╕╥█╬╜╔╩╟╜п╢┴║ж╣╥▐╪╦█┌╬┴╩╓╪╨╚╩╓▀с╥┬╟▐цф█╩╒уф▌╧▒ФПЦ╢├╖Ъз┬╟─┬╞╞╞──╞──╞╞┼──├┼├├──┼╚╔╩╦═╚╟╔╔╔╔╦╟╔╚╟╚╔╩╟╔╩╩╚╟╔╔═╩╩╠╦╬╩╞╗┤║┴╟╔╩╔╔╦╩╚╝ЫnG4)*.?gР╢╩╧═╧╨╥╙╥╙╤╤╥╥╥╙╥╥╙╒╒╒╒╙╒╒╥╤╥╙╫╓╒╙╒╒╙╙╒╓╒╤╥╥╓╥╥╥╒╤╧╤╤╥╤╨╨╤╤╨╧╧╤╥╨╧╧╨╬╚╚┼─├┬└╛╝╣╡▓пиЫш                                                                                                                                                                                                           ▀У│┬╬╨╦┼╩╩╠╦╩╠╠╧╬╨╧╠╚├╩╠╤╤╠╟─╚├╞╞╞╞┐├├├╞╬╓╒╥╦╜░йжжЯ┤┤▒ппл░лп▒оибШКРУУСМЕ~|||{y~{}|~ЖЛТПСФо╬сьчсє¤·ё·¤∙∙¤№ц╒Ў°щ┘щєщ╩счр╚╥т╘│о╨┘╦н╘х█╞╘єЎ▌╚шЎЄ█┌Ў·щ╘уЄЁр▐ьёц╩╙ъы╒╜╥чф╦─рьх╙╥ьЄ┌║╞ъЁ╫╢╘ЄЇ▌▒╤яэ┌┬╨щєш╟╨ю№Ў╧к╘эц╛ОНа╚┌═вЕ|tsvДШ▒┤бМ}yuuvvxzГУ╗Ё■є┬МВ|yxyxyy~БИмц√■№╦ЛВ}{{z}{~~БЕРк╪ЇЇ╫Оy`M3! 4]И╜╓╘┐П{xwtqpopoonpontТ╣╫ъ╒ФАmjwКГqsАЪ└┌╧ЬКД|zИМДАИУХм╫Ї■  Ї╥╦┴пЩЛи┤нПГОп╘ш·№Ё┬ЭРо╗╗▒гФ│╟╠╩├╨▌▄╧╜╗├╬╥├аЧ▓═╒╠░╜╞├╝╢╡╕▓д▓╚╤╧╟╪╫╦╛┼╧╙╤├╜╤▐▀╥└├╓▀▌╫╧╫▀▀┘╦░ФЛУ│╛│ви╝──├┼┼─├├├├┼╞─┬┬┬─╞╞╞╞─╞╞╟╞┼╟╞╟╟╟╞╟╔╟╩╩╔╚╠╠╔╩╩╠╩╔╔╔╔╟╚╔╟╩╔╟║▒╕├╔╠═╔╔╩╔╞╣ФiF1%).@gТ╕╔╬╬╨╥╙╙╤╥╤╒╘╤╤╨╥╤╥╒╒╙╥╥╙╒╙╤╥╙╒╥╥╥╥╥╥╙╙╙╤╤╙╒╒╙╥╥╒╫╥╨╨╨╧╧╧╤╙╨╧╨╨╨╬╧╬╬╩╟╞┼└├├└╜╣╕│▓пзЧ°                                                                                                                                                                                                           рЦ║╚╥╘╬╞╠╩╠╦╦╬╧╘╘╫╓╘╤╠╤╙┘╪╓╧╠═╚╔╩╔╚╛─╟╬╥╫▐р┌╥┼╣▒мнл╟─╛╜╣▒жа╣╛╛┬╗иЬЦЦШЧСОЖЖБ~xu{xzy}ДЙРОПТм═тЎычє∙їтЁ·їяўЇ╫╦ёё█╟▀э▀┐█х▐╟╦█╥╦╚╧┘╓┌сшу┌╪Ї·у═цЎЇ▄╒ў·ч╨тЇё╙╙ьЄц╞╬цч╙╗╦уф╞╗▐эф╞┼ьё╪╖─щЁ╓╡╧Ёє▐▓╦ыь▄┼╧цЄъ╩╔э■°╨й╙ьц┴МЙЫ╞┌╬дЖ{utxДФеоаК{xxwxyz{ГР╡э¤Ё├МБzxtxxyz~ВЗер·■№╠МЖ}zz{y{y}~ГОг╒ЄЄ╘ОvV?+!6]Е║╒╫╝Мyusrppnoooopppt~С╣┘ъ╘Фqjmvvln}Ц╝╙╚СЖ~xwuБЕИВ~АЗРл╙Є■  Ў╩╕▒мЧИЯндНЕМк╧цў№ё╛ЫТЮгжйбОк║┐┴╜╔┘╪╧╝п╝╦╩└ЩТм┼╠╚╕╕╛─┐╢о│пгм├╤═╛╘╘├н╝╔═╨╟┬═█▐╬╣┐╬╫╫╘─╧┘▌╓╞жРЗОо┐▒Эд╝┴┴┬╟╞╞╞╞╞┼┼╞┬┬╛┐┐┬────╞╞╟┼┼┼╟╔╟╟╞╞╞╟╠╦╩╟╚╔╞╩╩╩╔╔═╠═╩╩╩╩╩╩╟╣│╗┬╚╔╟┼┼╞╞╞╣СgD2''-@hТ╢╩═╩╨╤╥╥╨╥╥╒╒╥╙╥╒╥╙╙╙╘╤╥╥╥╥╥╤╥╥╤╤╥╥╤╤╤╙╒╙╥╤╙╤╥╥╤╤╨╥╤╤╤╧╬╬╧╥╧╨╧╬╩═╬══╔╞┼╟├┬┐╛╗╣╡▓▒неФ■                                                                                                                                                                                                           ▀Ц╜╬╘╓╨╩╨╨╒╘╒╫╫┌┘▄┌╫╤╬╙╓█▌┌╒╧╒╘╪╓╓╒╤╘╙╓╫█учт▀╤╚┴┐┬╠╘╤══╨╥╥══╠╩╬╧╜вЪШХХСРЛЛЖБ~|Б||~ГЗОНПТл═тЇюяёєю╬чу▌ряя╥╛ьь╒╗▐ю▀╡╒ур╔╞р█═╜╬▌▌╙▐шц▀█є·ф╤уЇё█╥Ў∙х╬▌єэ╧╤эєц╛╞чч╨╕╟рр├╕▄ът╚└ъэ╫╖└цэ╓╖╨эё▀╔┘цч▌╛┬фЄь╦╟ы√°╤л╙ьх┬НЗХ┬╫╠дЖ{wuyГСенЮЙ|xxvuvyzАО▒щ√я┼НБ}{{zz{z{~Жа┌° №╬НЖ}{{{zz|ВКЪ╧юЁ╤НoK<,&<`Е╢╬╤╛Лxuspqpppoooqqqr|П╡┘ъ╘Уrijjjfj{У╖╤┬РБzxvr{ВБ~}ВНд╧я№  ї┐░мдЦКФЯЪКДНж╦уЎ№є╛ШНРЮгжгЧд▓╝╜╣╟╒╘╬╜иг╕╛╖ШСз┴╬╩е╕┼╚┴▓гбждм╜╟╦─╨╬╝ж╖═╬╧┐╕╟╪█╟п│╚╙╥╧╞╩╤╓╧┬аОЖОи╖░Ьа╢╛┐┬─┬├╞╞┼─┼┼├┴┴├├┼┼─┼╟╚╞─├─├├──╞┼╞╟╚╩╩╚╚╠╩╔╔╚╔╟╔╔╚╚╟╟╩╚╔╚─╣│╕└╚╔╔╔╚╚╔╟╣РfD0%'+@jТ╢╔═╬╬╤╥╥╨╥╥╥╥╤╨╧╤╬╨╤╥╘╤╤╥╙╥╥╤╥╙╥╤╥╒╙╥╙╒╙╤╨╤╨╤╤╤╤╤╧╨╤╨╨╧╧╧╬╧═╠╠╬╬╩╠╩╩╚┼──└└╛╛╝║╕▒▒маХ                                                                                                                                                                                                            рЧ┐╥╫┌╥╬╥╨╘╙╫╪┌▐█▐рс▌█▌▌ффс█╫┘╓┌╪╫╙╥╪╫▄ртщыч▀╓╦──═╓р▌┘╪╒╬═╧█тццс╤╜мЭЩЧХУМКДБ}А|}{~ГЗППСРе╚▄эш┘тыт╕█эф╫╙╫╨╖шш╨╜╫щ▄╩╙▄▄╧─▌с╙┼╠▄т╓╪ччусёїф╤сёя╪╠ЇЎу╦┌Єю═╧ыЄс║╛фц╬╖─█▄┴╢╪ц▀╞╛шы╓╖╜ты╓╕═ъЁ▀╢╩хш▀├╛рєь╧┴ъ¤∙╤н╧щф╞ПДС╝╙╟дЖyuuxВОбоЯК|xtttxzz~ЙзуЎь┬П~yyxzz{yz|ДЫ╒ї №╤ПЕ~{{{{yyx{|БЙЦ╔ъь╨ЛjN=.$ ## #'0FdЖ│╬╥║Кzxvtspqqnoooopp{Н▒╓ц╙УВrihgeaiwП┤╦╝ПАxutqxzБА|w}ЛЯ═ы·  є│ваЫСБПУФКВКб╟рЇ√Є┐ЦПЛТШЯЩЛбп╕╗╗┼╥╥╩╛лдн╖┤ХСе╕╞╚╣┴├┬╜пЩдаЪг║╔╚┤─╚╖г╗╧╧╬╝▓┬╙┘┬мп─══╦╗┬╧╙╠╝ЬМГЛж╣лФЪ▓╝╛┐┬├┬──├┴┬┬┬┐┬┬┬─├├┬├┼┼┼─╟┼┬──╟┼─╞╔╔╞╔╟╔╚╞╞╞╔╟╚╔╚╟╟╔╩╔╟╚┼║│╢┴┼╚╚╞╟╩╔╚║ПgE1&',BjТ╢╔╔╩═╨╨╬╬╤╤╤╤╨╨╤╙╨╧╨╨╥╤╥╙╥╤╥╒╒╤╨╥╥╥╤╨╥╥╤╤╤╤╤╤╨╤╨╨╬╠╧╧╧═╬╧╬═╔╩╩╠═╦╚╔╩╔╞╞╞├┬┐┬╜╣╖▒нзЬ▓                                                                                                                                                                                                            щЩ┼╘┘▌╓╒╪╪▌▄▀руфсутр▄┘█уъшч▐▌р▀ухутттттуцяЎЎЁт▄╪╫┘рччхьЄЇёычщюёёт═╖вЩЦУСМЙББГИВБ}ВЕИНПСРб├╫ц▀╞╘с╫╡╥чт╙▄█╧╖ту╩║╙ф┘╣╩▄▐╬╛▄у╫╩═█с┌╘тчфтышу▌тыч╪╩яёр╩╪юы═╔шя▄╡╗тф╠│╜╓╫╛╡╥с█┼╖хч╘╣╕▐ч╓╗╩хщр╗╚ущр─╗▀ёъ╒╩ф¤∙╧л╩цу╚ФВО║╧╞еЗxuuzВМЯмаН}xttstuy~Жв▌Єш╟СБzyxxz{zz{ДШ═Є ¤╨СЗ~{z{z{z{||БЕУ├хщ╧ОmUB1($&-121/3?PhИп╔╧╗М{yxusrrrrppoppqzКо╙х╤ХБphd`^[etН▓┼╣О}vvsmsw~~zwzЗЮ╔ш∙■ ЄпЧЧЦМ|ИСХИБЙЮ─█ё·Ё┐УОМФЮбЩРЧ▒╢╣╡├╬╨╚║ЪЫ┤╣│ЧФг╕╚╟ж▒║╝╣нЦгЮЫа┤╞╟╕╝╛▒в╖╩═╦╗░╜╧╘╜жг╝╚╔╟╝╗╟╠╚╣ШКДЛж╡жТХ│╝╜╛╛╛┴└┬╛╜┐┐┴┬┬┬├┼├╞┼┐┴├┼─╞┬┬─╞┼┬├╟╔╦╔╠╔╠╚┼╞╞╟╞╔╟╔╟┼╟╞╞├─┬╣▒┤┐─┼╟╟╔╚╚┼╣ПhE-%&)AjС╕╔╩╬╧╧╨╧╧╤╤╧╬╬╧╨╥╧╬╬╬╧╨╥╥╤╨╨╤╒╒╥╥╤╤╨╨╙╒╤╨╤╥╥╨╧╤╨╨╨╧╧╨╧╧╧╨╬╩╚╩╠╬╠╩╔╚╔╚╟┼─┬└╛╗╡│▒нкдЦ╘                                                                                                                                                                                                            щЧ╟┘▐т┘╫╓╫┌█▀рцхчыьююьыьяяьутцууххуфччъььЄїїёщфуфшэяяыъшЇ∙Її∙√·°ю┌├йЬЩФТНЗ~|}АДВВ~АВЕПСТФг╗╤▐█┬╩╪╧▒╚с▄╦╙┘╧┼╓╙╟╣╨с╒╡┼█▌╬┼┘у╒┐├█ф┌╦рчт┘цяф╧┌шч╘╞ъэ▌╩╘ыч╦╟ты┌▓╡▀с╠▒│╥╘╛│╬▐┌├╖ух╙╗╖┘▀╒─╠уьр└╟ръс─╡█ёш═╡▐·°╨к╟р▀╔ЧКР╢╠╞зКzusvКЬкЯК}ywttuw{АЕЩ╒юц╟Т}xvuuxyxzzДФ┼Ё ¤╨УЖ}{{zzy{z{}БГС╗рх╨Тs]OC:44@ECACIQ[nИй├╬╝М|zxusutsqnooonqyЗи╨т╤ЧБpgd_\[bsЛн┴╢П}ttroor~vrxДЪ├фї  ЁоЭШЦЛ|ЕНРЗБИЦ╛╪ю∙я╛СНЛШааФКЩ┤║╗│╜╩╧├╡ее╢╗▒ЦУб╡┼┼гго┤▓йЫдЮЪЫ▓├├ж╕╣оЯп┬─┼╖л╡╦╨╕бЮ│└├┬п│┬╩─▓ХЛИв▒дРУ│║╝╗╜╛├├┼├┬┐╜┴┬┴┐┬┴╛┬└┐┐┴──╟╞┼┼┼┼─├╞╟╞╞╟╞╞─┼╞╞╟╚╔╚╩╔╔╔╟╟──╛╕┤╕╛─┼─┼╞├┼─║ОfD-$$'?iС╕╟╔╔╔╩══╧╥╤╧═╬╧╤╥╧╬╬╬╧╤╥╙╥╬╧╤╥╥╨╨╨╤╨╤╥╙╤╤╤╥╥╨╧╧╨╧╨╨╨╤╤╧╬╨╬═╩╩╠══╔╚╚╔╟┼─┬└╗╗╣╡│▒лкгФю                                                                                                                                                                                                            ъЩ╩▌фшс▀▌сфхшшыъъюююъыэяЄЄёчшэяЁЁюэьъыэъю№■■¤°ёяяЁЁї°ў№№¤¤°·■■■■Ўх╠оЮФУТНИА|}ГЕЖИЕЖЖЗРУООЪ╗╚╒╒╛╖┼├▒└╪╒═╬╥╦╛╧╠┬╕╔┌╧▒┴╪╪╩╛╓▐╙──╪т┌╒рхт╪ръу╧╙▀▐╪╨фц╪╟╨чф╔└сч╪▓▒▌▌╠╗╛╦╩╝░╩┘╓├│▀с╥╖┤╓▐╘╟╧рщу┼─▌ъф├м┌Ёщ╠▓╫∙ў╤л┼▌█╚ЫДО╖╔─кК{vsv~ЙЪжЪЙ|vwxtuvy~ДЧ╨р▌╞Т}{xwx{zx{yВС╛ю №╥ФЖ~{zА}|{{||АО╡█р╧Уxh[SNMIILPRSUZcpИж└╠╣Л|{wsqrsrpmppolnwДб╬р╨ЪВne_\ZYapЙй╝▓Р}utqmko|wrwГФ╝▌є■■я░ЪЪЦК~ДЙЛЕГИУ╕╓ь∙я╛СЙКЫаЭТКЦп╕║░║┼╚╝пФЯ╕┐пФРЩ▒─┬газннбПЦЩЧЩй┐└и▓┤зЬи╖╗╜░г░─╔│ЧЧп║╛╝пн┐╟┐нФЛГКЯпвНС░╕╗╗╜╗┐┐┴┴┐┐┐╛╜╜╜┬─┴┐└┼├┴├├─┬├┬┬─├─╞╟╟╟╚╞╞┼╞╞╞╞╟╟─╟╟╞╞├╞─┼╛╣┤╖└┼╞─╞╞┬┼├╕ЛbB+$ &BjТ║╚╔═╬╨╤╧╨╨╧╧═╬╧╧═╩╬╬╧═╤╥╤╥╤╤╤╘╥╨╤╨╤╤╥╙╙╤╤╤╥╥╨╤╨╨╧╧╨╨╤╥╨╠╠╠╩╔╩╔╠═╔╟╞╞────┬╜╖┤▓│▓мжЮТ¤                                                                                                                                                                                                            ьШ╬тъьцф▐▀тфшшээёЇўўЄЇЎў°∙ўяэюяёёёёёєёЇў·■  ■№°ўЎ°∙··∙№·№■     ■√ы╙▒вЩЦХТЙ~zz|~БГДЕИКСФСПЧо┐╔╩┬└╛║│╝╧╔╝┼═╚╢─╚┴╡├╙╔о╣╘╒─░╥▀╤╡╕╓▀╒─▄фс╙█цу╧╤▐▐╥╔▐с╘┼╬ур╔└▀ф╒╣╡╪┘╩░о╔╦╗н╔╪╙├┤┌▐╨└╜═╓╘╝├▌щу─╛┌щт╚▓╪юц╔п╫Ўї╤║╟╫╫╚ЬМТ┤╞┴зЙwsru~ЗЪдЪК|vwxuuwz|ГХ╚╪╫┼Т|ztwy{yx{|ДС╝ы■√╥ШИ~{zz{|{z}{|~Мо╒▌╧Цymgb\ZVSQUXYY_fsЗд╛╟│ЙyvtsnoqokijkljmuГЬ╦▐╧ЪАlg`\XW_nЕд╖оПzssqlhm{}upwВФ╗┌Ё¤■э│аЩЧЛАЕИЕБЕР░╤шїы├СЙИЦЩЪУИСв░╢┤╣┴╔╝нЭа╡║лТРЧн└└бТЩдеЩНСППУе╣╛│╕╡жЧЯм┤╢жЩл└─пФЫ╢┴╛╖йз║┬║зУЙ~ЗЭйаМПл╡║╝┬┐┬┴┬╛╜╜╜╝╗╗╝╜┴┬┬┴├┬┬─├─┬┐┴├┼─┬╞╞┼──┬─├┼╞╞─┬╞─╞─┼╞╚╩╟┼╛╕│╖┐├─┬┬─├─┴│Йb@*%#)EnХ╜╞╟╔╔╬═══╬╠╬═╧╧╬═╧╧╧╨╧╧╤╤╤╨╤╧╨╨╧╥╤╨╥╙╙╥╤╨╤╤╤╨╨╧╧╨╧╧╬╧╬╠╩╔╩╩╠═╠═╩╚╟╟─┬┬─├┴╝╣╣╡▒▒мжЫЧ                                                                                                                                                                                                             ыЩ╨чяёьщфхшьььЁЄїЎЎЎєЎЎ°·√·ЇєїЎўўЎЇЇЇєў√■    ■№√√¤№■■■■■        №є┌│ЭФФФУК~|~АГЖЗЙКОТХПЖПж▓┴┼╣▒╡╡▒╡├└▒╗┴╛▓║╛╝╣┬╦┴м┤═╨┐о═▄═┤│╥▄╤╗╓р▐╙╪фт╬╩┘▐╒╚╪█╒┼╦с▐╔╛▌т╘╡╢╘╤╚╗╡╜└╜╕╩╓╓╞│╘█╨╖┤╩╘╘╛┐┘шх╞╡╫цр┼▓╙ьф╚о┘ЇЇ╙╖─╥╘╚ЯЕС░╜║зИvtsw}ЖЧЭЩИ{xtutuy||АТ├██├Р||yy{yxx{{ГР╡ъ■·╨ЪИ~{y}}~zzz}~Кй╧╓╬Ц{qmhd]ZUUX\__agtЗа╣─пДwrqonnlkjhjjkjmrШ╞┘═ЬАleZYWX_jВб▓кОzssqkelx|tnuБТ╣╘ь√¤ь╕еЫЦЛ||ВЖЕАБПп═щїы┐ТЛЛТЦШТЖКШи░▒▓╗┬╝мУЩп│жТМТи╝╗гПФЮаУКМОМТв╕└╢╡┤иФЦдооЮШж║┴мФа║─╝░гб╖└╖ЯСЙАЗЩжЮКОж│╖┤╝╜╛┐╛╝╝╜╛╜╗╗╗╝╜╛┬┬─┬├├┴┐┐┬├┬─├├─┼┼┼──┼────┬┬─┬┼──┼┼╚─├╛╖▓╕└┼╟╞┬┴┬├┐▓И_="!!)EpЧ╜╞╟╚╔═╧═╧╬╠╬╬╧╨╧╠╬═╬╧═╨╨╥╤╨╨╧╬╬╧╥╥╥╥╥╥╤╤╤╨╨╧╧╧╧╨╧╧╨╨╤╨╬╠╩╚╚╠╬╬╔╞╞┼╞├┴┬┬┬╛╣╡╡┤░ниеШ╞                                                                                                                                                                                                             ЄЫ╒ьєЇёыхщъьэяєї∙·√¤√√№№¤■№ЎЇїў°··√ў№¤■¤■■   ■■■■■■■            ■№р│еЭЪЦФК|y~{~БГКОУФЧРЖКЧдк╖пгиолн▓ег▒╣╕е╡╝║о┤├╣зп╚╔╕з╚╓╩░▓═╪╦╣╥▐▄╨╒с▀╬─╙█╨┼╤╙╙╦╬╪╓╩╩╪█╨╢м╬╘╔▒й╣└╜│┼╧╤═╛╬╙═╖н┼╫╙╜╝╒шх╩┴╓у▄╜Ы╤щр┬й╓єё╙п║╧╒╔бЖРм╜╗жИvtuw|ЕЦЭШИ{wtwuwz{}ВС┴╒╪┬У||wyzyxuz|ДП▓ц¤∙╧ЩИА{xzz{{yzxyyЖз╬┘╧Ш}snjhb^YY\^_^eivЗЬ┤┴жБtpnjjkiihfhhjimr~Ц┬╙╦аАmg^[XU\iАЪйзНukoqkely{smr~О▓╨щ∙№э║ЫРСЙyЕЕПк╞чєъ╗ТИГЛПСНЗЖПанмн╣┴║зРОЩжЯРМПд╗╝аНТЧЩРЙЗЖЙОЫ▓╕│▒▒жЧЦШбдШПЯ╕╛кУг╣┼┐жЯЫ▒║пЪПИ}ЕЧбЬЙОао╡┤╗╝╜┬┬┐╛┐┐╛╗╗╝╜║║╛╛┬┴┬├┴┐┐┬┬┬─├─┬┬├──┬─┐┬├├─├─╞╚╟┼┼┼╞├┼└║╖╖╛┐┬├┴┐┐├╗оЖ\:#!"*GrШ╝┬┼╞╩═╬╔═╬╠╠═╬╠═╩╩╠═╧═╧╨╤╨╧╬╠═╬╬╧╨╨╨╥╨╤╥╨╤╨╧╬╧╬═╠╩╬╧╬╬╩╩╔╚╟╔╩╩╚╞╞┼╞┼┐┐╝╗╗║╣┤▒олжбХэ                                                                                                                                                                                                             їЬ╫Ёў°їэяяЁЄєєїў·√√№№№    ■√°°°°∙∙∙·■■■■■■■  ■■■№ √     № ■      ¤ц╡гЪЫХФК~|ББЕДДЙНШЧЧОГЖРЧи░вЧЮгЩЩмиЯвкоам╢╖▓пплвй┴┬▓в╛╧┬нп╟╥┼╢╧▐┘├╩▐█╚╜╧┌╬╜╧┘╒└├╪╫─║╙┘╧╜╕╟╠╟░а┤╜╛▓╛═╙┴о╩╘╨╖и┬╓╒╛╣╥чу─│╤с┌║Ь╩ц▌┬з╨ёЁ╙п╢╩╙╔вЖРи╡╖иЙuuux{ДФЫФЖ}ztwuuvy{ВС╗╤╓└С|А{{zyxvzzВНоф∙∙╨ЩЗА}x{zzyxwtruДе╚╓╧Щ|rlhgc_[YZ[]aflvЕЩ░╝гАslihgggheefhljkr~Ф╛╠╩бАmd[YVVYh}ЦкзНvoqqhcjytip|Мл╔уї√ь╕ЧТРЙ|x{ВДВНв╜уёч╡ФИВИОУРЕБИЦжии▓╜╕еПОУЪЪРИМЯ╢╣ЯОУЧЧПЖГГДЛШ░╢мклеТОФЪЬЦСЭ┤╣дПШ│╡овФЦл╢оШРД|ГТЮШИНЫйо│║╝┴┴┐╛╜╝╜╝╣║╜╜╛┴┼┴┴┴┐┬┬┬╛┐┬┬┴┬─┬┴┬─┼─╞─╚╞╞┼──╞╞├┬├─┼┬┬╝╣╖╣┴┴┼├┬├┐┐║зБY8!! ,KtЩ╝─╟╟╩╧╧╠══╬═╠╩╚╦╟╔╩╩╬╠╧╧╨╬╬╠═╧═╩═╧╧╬╨╬╧╧╧╧╧╬╩╬╠╬═╠╧╬══╩═╩╔╔╩╩╔╟┼╞╞╞├╛╜╜║║╕╖│онизЫР■                                                                                                                                                                                                             ЇЮ┘є··°ЁЄЄЎЎў°·№№■¤¤¤■■■ ■■¤∙№·■■■■    ■■·№■■■■ ■             ■  №ч╜мбЮЧХКБ|~{ББЗНЧЧЧМБВКСЪдШРРЦФЦХФХЮдвЦд▒┤зе▒лЬд╗║мШ╡╚╗мл┐╚╝╡╩┌╓┐─╪╫╔└╦╙╩║╔╙╥┴╛╧╥═├╩╬╠╖й┬═╟мЭн║╣░╗╚╨├п╟╘╥║г╛╓╒╝│═с▀┴м╧с┌╕Щ╞т█┬ж╠цф╫▓│╟╨╚вЖОг│╢йНvurt{ГФЫХЖ}ztwssxz|ВР╢╠╘┐С{|yzwwwwz{Йз▌°°╨ЩЖ~{xzxwutrnkmАб├╥╦Шxnligda\\Z\`dgmvДЦк╡Э}mijgfdcbbbeeggjr}У╣╬╩бkbXVUVZg}УадКqhnnd_jv{skjzМж┼▀Є·ъ╝ФККЗ|v}ГВ}}Йа╕рюу▓ФВ|ВИНОГzГТЮаЯ▒║┤аПНХЭШПЛМЭ╕╢ЧЛПТУПЕ~БВЗСлоззеЮПЛМСФРНХ░╢бПРЪклЯФШи▓мЧНВxАОЦТЛНФгп╖╗╛┴╜╜╛╛╗╗║╖╣╗╝╝╜┬┐┐╛╛┴├─┴┬┴┬├┼┼├├┬┬┬┐├┬╞╞╞╞─╞╚╟┼┼─╟╟┴╛╗╡▓╢╜╛┬╛╛┐╛╜╣еU6%$$.LvЪ╗┬╞╞╟╩╩╚═╩╩══╠╠╧╩═╩╔╩╩═╬╨═╦╠╬╬══╠╬╧╬╨╧╨╨╨╨╧╨╠╬╬╠╩╚╩╚╔╚╚╔╔╔╚╩╔╚╟╞╞─┬┐╛╜╛╝╗╕┤▓░лигЧЪ                                                                                                                                                                                                              √Я█ї№№√ЇїЎЎўЎ∙√¤■■■■¤¤¤■■■■¤№√√№¤№№¤  ■¤ўфЁ°№·√¤№            ■√¤ №х╜иЮЯХХКВВБВБГДЕКПШЧЧЛ~~ЖМСТЛЗМОНРЧЦТСШЩХЭйнбЫжгаи▒░еХо╛│ее╕┼║п┼╫╘╝╛╫╓┬▓┼╥╩▓┐═╬╜╕╬╙╞╣╞═╦┤д╝╔┼нЫк╣╢и▓├╧├о┬╙╙╜б╣╨╨╜▓╠ур║г╩▀┘╖Щ─▀╪┬е╔цц┘╣│┬╬┼ЭЖНЬп╖йНxvuwyВТЫФЗ~yvurtuvw~Пп╚╥╜Р|}zzxwwxz{Ив╪єЄ╨ШЕ~{z|yyvqkcbc|Ы└╬╩Цvnmjigb_^^^agjnxДУй┤Ъxnhgeab`__abcfgip{П│╟╔а~kbVUSTZe{УавЕqhkjgajx~qckxЛг┴┘эїш╜ЦОПЖ{w}ГГ}{ИЫ┤┌ът▒УАz{ГОПА{АЛУФЦк╢пЪООЦШЦМИЛЫ┤▓УМПРТНЕ}АБДОдкЫЧЩФЛЕЙОФУОТл│гПРХбвЯОРднжЧЛБz~МЧФКЙТЮл░╗╜┐┐╝╗╝╗╗╕╖╗╜┴╛╛╛┬┬┐┐┬┬┐╛┐╛╛┐┴├┴├├├───┬─╞╞┼├╞┬├─┴┐┬├╜╝╗│░╢┐┬┼─├├┐┐╣д{R1 ""0MwЫ╝┴╞╟╔╦╩╔╩╩╔╩╩╠╩╠╟╔╚╚╔╩╠╬╨╧╩╩╠╬╠╩╠╧╧╠══╬═╬╨╬╬╩╬╧╬═╔╔╩═╩╟╟╚╟╞╞╟╞╟╞├┬┬┬┴┐┐╜║│▓▓оидаЧ╧                                                                                                                                                                                                              ·Ы┌Ў№√√·№¤¤¤¤■■■  ■■¤№¤¤¤№¤¤√√№■■■■■  ■√їЄў√               ¤ўїїў¤∙р╖еааЩУЙВВ~А}Б}БЛРШШЧК|{~ГЙЛЕВЖКЛЛОККПХУМЧвдЪЪдЮШЯлкЮУк╕оги│╝│л└╤╧║╝╘╥╜л┐╦─│╝╩╔╗│╟╬─│└╠═▓б╢╞┬пЯй╖┤оп┐╠┬й┐╥╙┐Ь╡═╠╝╢╦т▐╖б╞▐╫╢Ш╜█╒┼╡╦уш┘╕░╛╦┬ЬЗМЧи│йНywtuwВУЪФЕ}yywvwxz{БОк─╬╗С~|xxvvuwzzАЗЯ╨юэ╬ЧБ}{yzwsokcZ[b{Ш║╬╚Цuonkkifa_^`bfjnvБСелЧwlgfebb__]]``cdho{Он├╟Щ|jbYWSUXf{СЩаГkekmf^jvyncizКа╜╫шщу╜РЖКЖxt}ВВ||ЕЧ┤┘ш▀░Т~xxБМОДzБИОПТз│йФЙЗЛНОКГЖЧ░оТЛОССЛДАГВЕОгжХОПОИДЗНРКИПзпЬНМРЫвЫСРЯйвХЛy~ИСТКЗСЯн░╕╛┐╝╗║║╗╝║╖║╝╝╣║║╜┐┬┬┐┬┴┬┼┐╜┐┬├┐┬╛┐──┬╛┬┬─┬┬─┬┬┴╛╛─├╜╝╕▒н┤╝╝╛╝┐┴┐╜╖гxO."/OzЮ╝┴┬╞╞╟╚╞╔╚╔╩╠╬╠╬╔╩╔╔╩╟╔═╬╠╩╦╩═╚╔╩╬╧╠╧═╧╧╬╬═╔╔╩═╬╔╔╔╚╔╩╚╚╚╚┼╚╚╟╞─└┬├├├┬┬┴╗╢▓плжбЯФў                                                                                                                                                                                                              ¤Ц╪∙№√∙∙№№¤¤■■■    ■№ўєёюЇ·№Ў∙·■■№¤¤  ■¤∙ї··¤·             ¤їц╤фыс╧║зЯЬШФЙББ~БАГБЕМУЩЧЦЙ|z{~ЕГ~|ВДЗЗЛКИМПОКСЬЮХРЭЫЩЪвЯЧУжпзвео╖оз╗╩╚┤╢╧═╡е╗╚╛ж╡─╞║┤├╦├░╗╟╦│Щ░┬┴мСе╢│зй╗╟╛в╗═╧┐й╡╩╔╢ж╞▀█▓в─█╒╕Ш╗╘╤┬б┐▌ч╪╣н╝╦└ЪИКФг▒зМ|wuvxВСЪХЕ}yxvuuvyzВНе┴╦║УА|zzzyxz|{ЖЪ╩фф╬Чzzzzwrjd^\\_wУ╡╩┼ФvollmkgedcbdhjnsПдмХumgccbba`_abbcgjn|Нй└├Шxh^WWTUWbyРЫЬБlgknd\jy{obiyКЮ╝╙сюф╣ОЕКЗut}ГБ}yЕЦ│╓у▌кСАxzГММД|АЙООРб░дПЕБАИЛИВЗЦнкПЛМОНЙВВГАГОЯеФПРМЖВЕЛТМЖОбзШОМНФЪШММЪжЬУМ~x{ЗТСЖВПЮл▓║╝╗╝╗╗╗╗┐╝║╗╛┐╝╛╜╜┐╜╜╜╛╜╜╛╛╜╛┬├├┬╛┐┬─┬├├├─┬┬┬┬┬└┴┬├┬╜║│пн╣┐╛┴╜╜╛╛╗┤ЪvM+!0Q{Ю╗├─╟╚╚╔╔╦╔╔╩╔╩╔╔╩╔╟╚╔╚╚╩╩╠══╠═╠╠╬╠╠╔╠╩╩══╩╔╩╩╩╩═╠╩╚╔╩╔╟╚╩╔┼┼┼╞─┬┬┬┬──├┬┬╛╕┤нижбШШ                                                                                                                                                                                                               ■Ц╪·¤¤√·№¤¤¤■¤¤■■■¤¤∙юЁ▐▌ы·№∙¤■■■■■  ■■■№№■              ■№ёф▌╤▐цт╬╣иЮЭЧФЗ~{x{x}{ВНУЩШХЙytw|БА||БВВДВГИМЙЕПФФУСШШХФЫЪТУгигЯгзмзз╡├└▒о╩─▒а▓┴╢го╛┴│Я╝╔┐ж▒─╩▓Уо┐╛лЩг││еж╖╞╝Я╡═╬╝Ю▓╟╟┤о└▄╒▓Ю└╓╤╖Ц╣╧╬├а╢╪х╓║л╗╞╛ШИИУа░дМ|vruwБПЦПИ{ywxxz{|ГМв┐╩╣УБ}xyzz{|~|~ДФ─фц╨Ыxxxwqld_[ZW]tТ░┼┐Хvqllonmgggffhmps}ОвжУtliecbbbb_adffggmzНд╝└Чyh_WTSRUbxЛЩЫБgdnpa_iuynbiyКЬ╕╬┌тт╣НЕНИvtzБВ}ДФп╤▀┘еОy{ДОСД|БЗЛМПЭиЭПД~}ЕИЖБЕФкжМЖДЕИЗ~|АБГМЬвСОМЙГ|ДЛМИЕНЬвХПЛРЧЫЧНЛЦвЬРЛ}wwПСЕ|МЫл│║╗╝╛╝╗╗╗╛╜╗╛╝╝║╗╗╝╗║╗╝┐┐┴┬┬├└┴├├┬┴┐┐┴┴┬┬┐┬┐┴┬├├┬─├┼─┐╗┤пн╢╜╛╛╗╝╛╛╗│ЦsK+ !/Q|Ю╗└┬─╞╞┼┼╚╚╟╟╔╩╚╟╚╟╔╩╔╔╔╚╔╩╚╔╩╩╔╠╩╩╩╔╩╔╔╔╔╔══╔╩╩╩═╩╔╚╔╚╚╟╔╠╟╟╟╟┼├┬┬┬├┬├┬┴╜╗╣▓мдЮУ╤                                                                                                                                                                                                               ■Х┌√■¤√Ўїў∙√√√№■   ■¤·°єё°■■№■■       ■■√√ ■            ■№Ї▄╬╨╔═╨╚┬│дЩЩУПЗ~|{~~БАГНФЪЩХЗyrqx|yux}А}АГАВЕКЙДМРПМЙУУССУХПРЮвЬШЯййгЬн╗╖мз┼╛мЪп╜▓Шл╕╕нж║├║п▒┴╞▒Фй╛╛жРв│паг╡┬╢д▓─╩╢Хн╚┼оШ╣┘╒пЯ╝╥╧╢Ь╣╧╧┬Ю│╘у╓┤Э╢─╝ЦЙИРЯлбК|wuuxАОЧТЕ|yyvvvx{zБЛЯ╝╟╖РБ}{|zzz{{}БДУ╛▐х╬ЫВzxxvri]WWXVZrНн╟┐Уvqkklomijhhinqsu}ЛЮбМvlifecdec`cddeehlxИЯ║╝Хwh_VRRQRawЙЧЦАf`jnb\fyzkbjxКЧ▒╔▄ът╡МЕНЖxqwББzxГСн╠▄╫кНx|ГООЕЕИЙКОЬжЫМГy{ВИЖБДТггЛББЕД~xz}ВИЧЩОНМИВГКОЙДЙЩЯУМЗМЩЪХКЙФЭЪОЛwv~ЛРГ{МЩз▒║╜╗╝╗╗╗╗╛╜┐╛╛╗╣╕║╗╗║╗╗╜╜╛╜╛┐╝╛┐┬┬╛┐┴╞┬├┬┴┐╝┐┬┬┬╛╛╝╛╛╜╗┤░п╖╛┬└┐┴╛┬╝┤УmG* !/N}Я╣└─╟╟╚╟╚╩╔╞╞╔╔╚╟╞╔╔╔╟╟╔╔╩╟╟╚╠═╔╔╚╚╚╟╟╩╚╚╚╩╩╔╚╚╩╩╩╩╩╩╔╞╞┼╚╟┼┼╞╞┴╛┴┐┬┬┬┴┐╜╗╕╖▓лЯЦР∙                                                                                                                                                                                                                У▌¤■■¤···√¤■■■■    ■■¤¤№¤  ■           ¤              ■ўр╘─╟╬╞╞╚╞╗лвЪШУНЗД~x|{{|ВОХШШУЖxqpuzxtty{y{|y|БГДВЙММЙЛУПММТФНПЦЩФХЮегаЫм┤▓ид╜╕еЧн╕мЦе││дФ╕─║ем┐├оХи╗║дМЮ▒нЮб▓└▓Хл├╚│Хм╟├кШ│╒╙пЮ╗╧╦╖о╛╔╠┬в░╨у╓┤Ь▓└║ЧЗЕНЫжЬЗ}wuttПФРЕ{wzvvvz}}БЙЬ╗╔╖ПБzxxxxxzzБДУ╗╫с╠ЫВzuroj_TSUXU\pЛз└╝Фyqkkkkklmlkkoruu}ЙЧЩЙumjjffffaaabbbchkvЖЫ╢╡ТtcYPPRPTauЙЧХБe`kl_ZdvxlcjxЛЦо┼╪цр│ЛЕНЗvmu}Б{yАОм╔╫╒нМ~xzГПСВ|ДЙКЛНШбШМАyyВИЖАДРЮаЙБ}}ГД{xz|~ЖФЩММЛИГ|ГЗИЗЕЛУЩРЛЗНЪЧТИЗСЪЧМЙzxКПВzЛЧдл╢╜╝╝╗╗╝╝┐║╗║║╗║╗║║╗╗╝╝╛╜╛╛┬┬╛╝╜╛╝╜╛╛┬╜╜┐╜╜╝╛╛┴┴┐┬╛┬┐┐╗▓пк▓╗╛╝╗╝╗┐╗▒СiB'"0Q}в╢┐┬├┼┼├╞╟╟╟╞╟╟╩╩╟╩╩╩╟╞╚╚╟╞╚╚╔╚╟╚╚╟─├╞╚╚╚╩╔╚╟╚╚╚╟┼╞╔╩╚┼┼╟╟╞┼─┼┼┬┬┬┴├┐╛╛╝╗╣╕╡пеЪФЦ                                                                                                                                                                                                                 Хч■  ■¤¤¤■■■■■■     ■■¤¤■              ■             ¤№я▐╫├─╞┴╗╗╢▓кЭЪСЙЗЗЕЕГАББЕОЦЪЦТДxmjtxtnquvty}{}ББ~ВИЙДЕЛИЗЙМРММСЧХФЫдаЧХжммзи╖▓вЦз┤еУанмаЮ┤╛╢йн╝┐йМЯ╣╣бЙЫмиЫЯ░╝нХд┐├мУе─╛иШ┤╙═░Ю╝╩─╕п╝╔╠┬го═▀╨пЩо╛╖ФКДНЪдЬЕ}wvuxБОЦРЖ~xzuwvyzzВКЫ╣╞╖ПВ{xxyxxzzz|Р▓╥▐╩ШАysriaZTQU]X[nИд┬║У{qlkkljmnpommoqtzЙЧШЖtkeedbbaaaaaa`bfkvДХ│╡Рp`WPRRQVcuЙФУАd`imaXdv{mcivКХн╜╤ф▄░ЙДИДwovАВxw~Оз┐╬╬оЛ}tsЛМГ}АЕИИЙФгШЛ~wvЗЖАВОЬЮК{|АГ{vwz}ГПСЙККЕВЗКЖДЖРЦОИДЙУШРЗЖРЦУЛИ}xv|ЕЙБ}ИФбк╡║╝╗╣║╗╗╛║║╗└┐╜╛╜┴┐╛┐╜╛╗╝╝╜╛╛╝║╝╝╝╜╛┬┐┐╛┐╛╝┬╛╛╜╝╛╜╜╗╗╣│он╡╝╛╜╝╝╝╛╗пНgB& $1Q~е╢┐┬├┼╞┼╞╞╚╚┼╞╞╞─├─╞╞├╞╚╔╚╚╩╔╩╔╚╔╔╟─┼╟╚╞╞╞╞╞╚╚╔╚╞──╞╩╔╟┼╟╟╞╞├├┬┐╜┬┐┬╛┐┐╜╝╗╗▒иаЦТ╫                                                                                                                                                                                                                 Чш    ■■■■            ■■                           ■¤єёу╨═┬─┬╕м░оибЪЪПДДЕЖДЕДГ~{ВЛФЩЩФЖvjhmurmoutruvuy|Б||БЗЗГДЛЗИЙММККОПНТЮвШСУЯиива▒оЯХе▒ЯОЧйиХС│┐▒аз╕╗гНЪ╣╖ЮЙЪивЩЫп╗йФе╛┐йТб┴╕дЦ▓╧╚пЬ╡┼┬╖░╗╚╦└ге╠▌═лХк╜╢ХИГКЧвЭЕ}vvtuАОТЛЖ~{}wyz|}}БКШ╢┴▓ПЕywwxxw{x{{БП░╩█╞Ц}tnnb\TNQU[X\oЗв┐╖Р{rmklnikmnmjjhinwЗФЧДqhcb`]]^^`aac`bgmvДУлкМn\VVSOMUcuИЦУ}ebkmd[dw|ladtИХн╝╤▀╪оКЕКЕunuБ{w}Лв╜═╬пЛ|ro}НРАxДЖЗИТЫЧК~vt|ЕД}КЦХЛ~vw}~xsuwyАЛРЖДДАzy~ВЕДВЕМФНЖВЖМОНЗЕНХСКГ|vrxЕЙ}yЕСЪж│╣╣╕╕╝╜║╜╣║╣╗╗║╗║╛╝╜╛╜┐╝╣╣╝╛╝┐╜┐┐╛╜╝╛╛╛╗╝╝╗┐┬┬┴╛┐╜┴╝╜╕▓йл╡╗╝╗╗╗║╜║нКfA$#!%3UБж╡╛┴┬┬┬┴├╟╟┼─┼╞╚┼──┼╞├╞╚╔╚╚╟╟╔╟╚╔╔╚╞╚╚╚╟╟╟╞╞╟╟╚╔╞╞┼┼╟╞┼┼╞╞┼─┬┬┬┴╜╜┐╜╜╝╝╝║┤▒мдЪФП√                                                                                                                                                                                                                 Щы    ■■                                           ¤∙шх╒╨╦┴╗╗▒иждаЫЦЩОД~ГДЛММИБГЙУШЧСЖwggpuohmtrpswuuzА}{БГВ|ЖЖЕЖККИИЛННСШаЧПСШЯваднжЩХдйЫОХааЦХо║▒вд╢║ЯНЩ┤┤ЫЛХдЯЧЫп╖дУе╗║жСЪ╝╢аТм╚─ож▓╛└╖и╖┼╩╛йи╚╪╔йХй╣│ХЗАИХЯЫД{xxywНУОЖyxuxy{}{БЖЦ┤╜пОЕ|zyyzxywzz~Нл╞┌┬У{qjgb[SOOQTV[mЕб╜┤П}smkknlnqoogccdivЕФЧБqe_`^\Z[^_bacbchlvБСйзКl_[YWSQXgvИУР{fdkld]ew{kdetИФк╜╬▐╓░ЙБЕВsjrwt|КЮ╕╩╨░К{qs{ЙНАtyБЕГЕФЪХЗ}tr{|~КЧЪМ~trxyroosw}ДЙДА~|xvy~ЕГВЛТМГ|БИЛИЕЖНТПЗД|wsxБЕ}xДСШв░╕╕╕╕║╗║╜╣║╗╗║╝╛╝╛╛╝╛╗╝║╗║╗╗║╛╜┐╛╛┐╛┴╜╛╜╛╛╗╝╜┴╛╝╛╝┐╝╝╖пкл╡║╗╗║╗║║╖зЖ_;#"!$8\Ей╢╛┴├─┼─╚╞╚╞┼╞┼╟├───┼├╞╟╔╟╚╩╔╦╟╞╚╔╚┼╞╟╚╞╞┼─┼─┼─┼╞┼┼┼╞╞┼┼╞┼─┬┴╛╛┐┐╜┐╜╝╝╝╝║│пдЬХРп                                                                                                                                                                                                                  лы                                                №°Ё╪╒┬╛┐╜╢┤мбЮЩЧШЧЩНД~}~~ДЙМЖ~ДЗТЧШУЗwffouofjqpmppprx{ux|БА~АДДДЗЛЗДДЙИЖМЩЭХООТЫЭЪЪжаФСЮдЦОФЮЫСРм╡кЯв▓╢ЭНХноЪЛСЮЭЦЦл▒аСб╖╖вРШ╢▒ЫТд├┐мЪм╣╛╢м┤┬╔╛ЯЧ─╒─жХж┤пЦЗВЙХЭШД{vuvuЛОНЗyzxzzА}АЕФ░╣кНДzzzyywyxzzБНз┬╥╝Тxnb``ZOJIGMS\lДЮ╣▓О}qlkkmlnqqkbcccftЖУФБne`^\[[]``a`bcdgku~СгЮИk]\a[YX]mxЗФТydenmbZetxjbbsЖФл┬╨▐╒▒КЕЗГriq|~us{ЙЩ│┼═░К{qn{ЙРtw{ААДРХПГwqsxyxw}ЗТХН}rrssnoppqxДКГ~}zutvzБ~~ЗПК{}ВЕЕГДКПНЙГ{tpuБЖ{vПЦб░╣║║╕╕╕╗╜╕╕║╗╕╕║╣╗╗╝╛╛╝╝╜╜╛┐╝╗╝╝╝╗╜╝╜║╗╗╗╝║╝╛└┐╛╝╝┴╝╜┤олк▒┤╕╖╖║╣║│вАY6 %:bЙп║╛┐┬├┬┬┼┬┼╟╞╞┼╚┼┼─┼─├╞╞╟╞╞╟╟╚┼╞╚╟┼─╞╟╚╟╞┼├├├─├─┼├─├┼┬┬├├─┬┴┐┐╛╜┴┴├┴╜╜╜║╖▓ндЬУОЁ                                                                                                                                                                                                                  ┤ц                                              ¤№ЎЄщ╤╫╞┐╛┤пмжЧХТРУФФЙГ~{|}БДЛКЙКМУЦШУЗwfcpsldippnqtopv{xu{~~y|ББ~БЕЕБГЗЗЖЛЦЪРКНСШЩЦЧЪЩТТЪЬУМСЩШУТд▒зЮа▒│ЫНХикЩОСЧШХШжкЭСЬ│┤ЯРЩ▓пЫСв║╖оЯз╢╝┤ж▒└─║вЮ╛╥┬дХдойЧИБЖУЪЦДzuuvxКСНИ~yzwyy|||АЕТн┤иНГ|}}{{xyxxu}Лв┐╨╕Нsi[Z]WNEDEKOZkГЭ╡мН~qjmnmlmmmjgeeeisЕСС~rha_]]^aabbaabginu}НбЬЖl`Z[UY\et|ЕПОyfeon`[ersicbsЖЦ▓╬┌▀┘│ЛВДБqgnyztt{ЙЪ▓├╠нИznmxЙТАuwyzy~НЦМ}upqstsvzГФЧК}sqsrnopprt~ЗВ{xwvtt{А~{{ГЛЗ}xy}А}}БЖКЙЖБyror{Бzt~НШго╣║║╢╢╕╗╜╣╗║║╣║╛╝╛╗║╝╝║╕╗╗╝╗║╗╗╝╝╝╛╜╛╝╛╗╝╗║║╝╛╗║╗╣╝╕║▓лзл┤╣║╗╣║║║░а{R2'?fС┤╗╜├─╞┼─┼┬─┼──┬┼┼┼─┼├└├─┼╟╞╟╚╔╞╞╚╞├├├╟╞─┬┬┬├┬├──┼┼─┼────├├╛┐╛╛╝╗╛╛╛╜╗╜╜║╖╖пжЮСУ                                                                                                                                                                                                                   ┴с                                            ■■·їэцс╔═─╜╗▒ггЯЦФСРТХХКЕ~||x~ГЕЖЗЛНТХШФЖvcblpkehpnhmmmouwsv}~}z}АААВЕВ~БГДГИФШНИЙНХЦФФЩЧПОХЩПЗНФФМОандЧЬопШМФееЧЛОЦЦТФвдШСЭ▓░ЮХЭнйЬСа╖╕жФа▒╕▓ио╛─╡ЦТ╗╬┴зЦгмйЧИГЗТШУД{ussuИНМИ~zzxz|zБЕСзпзНАyzzzyxzxyx~ЙЬ╗╔▒Кl`V\^XNIDCINZj~Ъ│иН}qkjkkjkkkicfggjuДСП~tmkjgfdddd`a`ahmqw~ЛЫЩДl`ZVUZ_ht~ЖПНxgjooa\htvjbbvЗЪ╣╒уъ▐┤МЖЗВpjnw|towИШо└╟кИxlhvЙС}rrtuuzЛФЙ|vnnorrtwГМТК}tsstnprsttГБ|zyurtuz{yxВКД{vvxzww|ДЙЗЕАzrmr|Аxs|КХво╕║║╕╕║╝╗╣╣╕║╣║╗║╝║║╝║║╗╗╝╛╝╗╗╝╛║║║║╗╕║╣╗╗╗║╝╜╗╗╗╝╛║╣▒идк│╣╣╕╕╕╖╕оЬvO1!,DnЦ╢║╗┐┬├┬┐┬┬├┼───┼╞╞───┬├├─╞╞╞┼╟╟╞╚╞─├├┼├├┬┬┬┬┬├┼┼╞╞╟╚╞┬┬├┬┬╛╜╛╛╛╜┐╛╝╗║╜╛┐╣▒каШП▐                                                                                                                                                                                                                   ╟▌■                                           √°ьъхр┘╔═─╣│кбЯЬПОММРУУМЙВ~~|БАДДИКОЦЦЦРЖvaehhdbfpmimnnptwrsy}zu{Б~||АБ}~ББАЖФЦКГЕМУУССФСНПУЧКЕМСФОНЪжЮХЧззФКУааФНПУТСУЫаЧРЩллЬСЩкеЬХЯн▒гУЪн╢▒бм╣┐│УО╣╔╜дФЮжеЧИБЗТЧОД|ywvx~ЙОНЗyxwy{}{z}ГОбйвО|{{{yxyxwx|ЗЦ╢─йДi]WWZWPKIFINYg}ЧпдМ|nijjjiijiiggggkwДТО~uomnnighgca__dknpxМЦЦВm`[WTX\er|ЕМКxfdpo_[hrrjcbwЙд╤юЁюр╖ЛВДДojmvxrswЕФм╜┼дЗxlkuИО{pnonryЛТИzsnnnqqswОТЙ~vwvtpnqrtr{А}||xusrtvvvАИБvtuwxvu{ВЗЖЕyqmqz~ysyЙСЮн╡╣╣╕╕║╗║╣╣╕╗║╣║╝╝║╝║║╗╕╣╕╣╕╕║╗╝║╕║╝╗╣╗╗╝╗╗╗╝╗║╣║╣╣╖│нзжм╡╢╕╕║║╕╖пХqN/,ItЦ┤║╝┐┬┬─┬├┬├├├─├┼╞┼──├┬─┬─├├╞┼╞┼─╞╚╟┼╞┼─├└┬─┬┬┼╞╞┼─╟┼├┬┐╛╛┐╝╝╜╜╜╝╛╝╝╗╗╝╝┐▓лвШУУ                                                                                                                                                                                                                    ╨╫¤                                          ¤°Ёцу╪╩╚╚╟┬╕▒иЫЦЧМКККОУЧРМД}}|}~~ВЗКФХЦРЗwdfhld_eomfilmnqrnpu{xv{|{z{А}|{}|}ДУЧИГГЙУУННУСМЛТХИЕЛПНЙКЦбЩУШвбСКТЮЬФКНРРОРШЫФУЪедЪТЪжгЩРЧм░вУЧй│ови╖╛пРН┤╞╝жТШжжЧЙДИРЦМВ|wwux~ЖННИ~{zz{|~{{АГОЬгЬР{{{zyxywxwzДФ▓┐еГk_WUQNIFGGIMYf|ЦлвН{oijjihiihgfgghkuГОНАuqqnlhiieb^]bfkprx}ЛУТАmb\VUUZalxГМКxjipn_^gsvi`bwКпс√·ёр║ОЗЕГnijt{squБСе╕┴ЮЕvjhwЙН{pkjlpyКПЗ{sopoqrqv|ЛРЗ|uxyxrpqsvu{}|}{xursuvsrД}vstvzyy{БЕДГ~zqkq{АtpyЖПШл╡║║╣╕║╣╖╖╕╢╢│╖╕║║╕║║║╗╕╖║╗╗╝╗╗║╖╖╕║╕╢║║╗╣╗╝╗╗╗╜╝╗╗║╖медк▒│││╢╢╢╖оТnI-*LxЪ╡║╗╝╛┐╛╛┴┐├┴─╞┼┼├├─┼┼└└┴┴┐┐├├─├──╞╚┼╞╞╞├┬┬─╟┬├┼╞─┐├└┬┬┬└╛╜║║╜╛╛╜╛╜┴╛╜╜╗╖▒иЬХПр                                                                                                                                                                                                                    ╒╙¤                                         ■ўыщ▄█╘╥╨╞┴║▒лдЪУУИИЗЗЛПЦФПЗ~}ВАДВВЕЙПУФОЕvdfgha_gokfkliipvnpuxsovyyuw}}yz{{|ЕСЦИВБЖПРНМНККМНПЖЖКПНИЖХЮШТФЯЮПМУЩШТЛЛНММОФЩХОУЯвЩРЩвЭХСХзодТФж▒квз╡╣нПЛ▒─║иЦЩвдЧИБИМРЛВ{xxxz~ЗМНЗ~{yz{{zzz|БНЩбЬПБ|{{{xvvvxw{ДУо╕ЯГm`WSNJFFGHLOVd{ФвЫНynjljhghhgggiiknuВКЙАxsolkiihd^^^chpruy~КФРАqf^XXUV\ftВККxhiqnaaipqibcxМ░с··Ё▌╕ЛГГВnjkrxtrtБРд╡╜ЫДsjjwЖН{nijnq{КЛЕ|soomrttv|ЗЛЕzwxywrprrqnzВ|}}ysqtxxvt~Б{uttz{|ЖЗДГ|rkpz~rnwДМФй╖╣╖╖╕║╗╖╕╣╕╣╢╕║╗╗╖╖╖║╖┤╣╕╕╖╗║╗║╕╕╗╛╜╗╝╗╗╣╗╗╗╣╖╕╖╕╕╕┤лгго╡╖╖╖╣╕║╕мОiE(,R}в║╗╝╛┐├┴┴├┬┬┐┬├├┬└┬┬├├┬┬┬┴┴┴┬┼┼├├┼╞┼├┼├─├├─╞─┬┬├┼┼┬┬├├┴┴┐╛╛║╗╜╛╜╝╗╗╝╗╜╝╣┤меЫФХ                                                                                                                                                                                                                     ▄╥№                                        ■¤Ётт╙╥├┴╞┬╛╖пйаХРТИЗЖЗЛРЧХУЛЗБ}~{}}ГЕНСФРДrbgfh`_enibhmkilpjlsutpuxywz~yvwzxxБПОГ~~ВКМКЙМЛИЙННДВИМИДЗХШЦУУЩЩНЙРШЧПЕККККОУФСРУШЫЦРФЫЫФКТелвХШжойЯд┤╕йНК▒╝╖зФХвгЦКЕЙНТИВ|vutx}ДКМИ~{y{~~}{z|БЛЦЫЩП~yzzywxxyxw{БПм│ЭГl]TNKHFCAGOSWbyРвЯОymikjgghhgefiijnuБЛИАytqmhhfb_^]`gkrvxyАКУОАtk`YYXWWapАКЙxllokackvui`dzКЭ╩ъыы▌╡МВББlkku}slrАНа▒╕ЫБrfiuВЕ{mgjrv}ЖНЗ}tnjkrtuvyЗМГ|xxxvrpnpqsyА}}~ytot}}yr{АzvruzГББДЖИЖ}qmqwxpovАКУж╡╣╕╖╖╕╗┤┤┤┤│▓┤╢╕╕┤┤╖╗╣╕╣║╗╣║╗╣╣╕╕╢║╕╖╕╕╕╕╗╛╛╝║╝║╗║╕▓лдгй▓┤▓▓▓│╖▓зКb>#/VВд║╗║╝╝╜╝╝╛╛┴┴┬├┬┬├─┬┬┬├───┴┴├─├┬┬├╞╞───┼─├┬┼┼┴┬├──├┬┬┴┐┐╜╗╜║╣╣╝╝╗║╗╝╗║║╣▓заХРу                                                                                                                                                                                                                     ф╤·                                        ўщ▄▄╪╧╬╟╟├║▒оидЭФММЖДЕЖЙПХХТЛЛИДВБВГГЛНУОДp`ccc^]fnhcjkiglohkrspluyxruzyst|zyБСХВ~|БИКЙЕЙИЗКМКАЕЙКДЗТШХТТЦЧКЙНТУРИИИИКНРФРНРШЪФПФЪЪЦПРбйЮРТвйжЬеп│жМЙм╣╡кЩЧЭвШЖБИНПИБ|yxxzДКМИyxwyzzzxyyБКФЬЫМА{yyxxyyzutv}МзмЪjYRNKHDABELSW_tМЪЪМxljkjhhiihefhknouБЙЖБysqojhc_ZZ]cinsxz{КРОБumbWUWZX^l}ИЗynookfgnstlbf{ЛХз╜╘у┘╖НДДВmgjrzuorБЛЮп▒ШqhfrЕМzmfir{~ЕЙЕ}uljjrwvuyИЙВ{wyz{qpkmoqx~~ВГ}spw~}u{}}{wvzДМКБАГЗМК~qkouyqqvЙТж▒▓▓│┤╖╕│╖┤╖╢│▓╢╕╣╕╣╗╗╕┤╕║╣▓╕╖╕╕╖╣╣╗╣╕╣╗╗╕╣╗╗╖╖╕╢╣╕│▒кджм░▒││││╕░бВZ83\Жз╣╗╝╗╝┐╛╛┐┐┬┬┬└┬╜╛┐╛╛╜┴┬─├┬┴┬─┬╛└┬┼┼─├├├└└┬──┐┬┬┬┐╛╛┐┐╛╛╗╝╜╗╣╕╕╣╕╣╣║╣║╗╗│гЧСЧ                                                                                                                                                                                                                      ь╚°                                       №єщ┘╓╒╩╩─└┐┤олдЯЩПКЛЖГГДИСЦЦУЙДГЕГ~~}~ГДЗЛУРГn`ade_]hpg`hljgikfinqomswwstwxuuwxxБПНБ}{АИЙИЗКЖГЖМНБДЗДБИПТСПРФЦКЗМППЛЕЗИЗЗЛССПНПФФТОУЩЩФНПЮжЬТПЪзвЧбо░дНЙз│┤мегвЭФКВЖМОЕА|xvux{ВЙЛЕyyvxzz{z{{АИТЪЩМ|wuvuuxyzwus{КаеЦ|fXRKJHDEDIMSW_rМЬЫЛxljkkhfijgefhinotАЙЙАyutrpmf`[]behlsxzzИНКБxocZUWZ]`k|ЖВzsqokhhowwl`ezКФд╖╦┌╘╣ПВА|nghv~tnr~МЭмоЧrefrБЕzlfjsy}ЕЛЖ|vljlrwxwxЕМГtruzupmlqtv|}АЖИukxИЙuz}zw}ЛОМВБАЕКЛ}lhlsvnqt~ЙСе░▓┤│╖╖╢│┤││┤▓┤╢╕╖╕╣╖╝╖▓│║╣╡╕╖╣╕│╖╢║╕╣╕╣║╖╣╖┤┤╕╕╕╗║╖░иддлно▒▒▒п▒зШzT57bЙи╕╕║╕╗╗║╝╛┐┐┬┬┬┬┬├├┬┬╛├├┐╛╝╛┐┴╜╝┴──┴┬┬─┼┬└└┬┬┴┴┐┐┐╜┐┴╜╗╝╝╝╝╕╕╕╣╕╕╕╕╖╣╣║║пЪФНя                                                                                                                                                                                                                      ю─Ї                                 ■■■■√Ёххф╒╨╠╩╔┬║╢пжгЮЩЧЛЖИЖВБГЗОФУРИДБЕЕЗИГБГЕЖМРОАl``bb^^ioe_hjgfmlfhnpljrvrnrwvqswwwРФГ}{~ЕЖДДЕВГЕИЗ~АДЖДБДПФРПТФУЙИКОНКЖДЖЕЖЙПРМКНСФОНРЧЧТММЫжЩМОЪдЮЦЭзмбНЙвп▓нмйеЭСДЖЙКБ|yxwvx}ЕККДzwtuyyxv{zЗТЪЩЛ~zwwxswvwsqrxЖШаТxcRNHKJKPPMPTX]rЙЧШЛxljkjihiihfijkknuБЗЗБzutpqnhca`cikouxzzЗЙИАxmaYVSU[ck}ЖГyrnljkoquwn_dzЛТЯ░┐╤╤╝РГГoegtztnp|МЩйкЧ~qhhqДЛ{kglt{}ВИЖБwnjluxxuxГЙБrmtzАvoknrsy}}АЙНДvr|ЙОВsy|{~ИТМВ}~ГЙЛ{nikqsnns|ЗРео▒││╢╕╢┤┤│╕╣││╕╣╣╕╕┤╕▓╖┤│▓░╖│╖╖│╖╕╗╣║╗║║╖╕╖╣╕┤╕╖╕╖▓мжддммо▒▒│░░ЯПoM1BEE?2( (@Zjyyunf`abeeeffedhjkllpuz{zoZPJGHIKOZisy{{xwmaW]p{r][_bjtБИНЪжЭЙИЗВwknБhadjvБЕЗАrg_Zb|Жzhcg}В~БЕЖБxg]ev~uklrwsledyД{romnmlnouИСВrjm}ЗГsmnrttolsДЛБtszГЕ{lcaeihfhmrБСазл▒▒оллллнноопнннппнлкм░░▒мпоооопкзлннлооойлллнжЮЦЩЯвзклмкжзЮ|U00]ВШзм▒п░░▒▒░пп▒▒░пн▓н░│┤│▒▒▓┤▓▓┤▓▓о░░▒▒░он░онпннзн▒▒░нп▒│▓пн▒нм░▓│ож╛                                                                                                                                                                                                                                    √╙№              ■·ЎЇєєЁЄю▀╤╠╦╔╩╞─┴╜╗╗╖┤йдбЬЬЩУОКИЗДБ{ВДИЛННЕ~wut}ЛХЫЪЭЩЩЪШЫЧЦПГyqrtqfZ[hoqАЛДp]cjf``ff`emjcbipe_fkjabirpkhnuolnqpknspnnputmry}ВПЦЛ~vtvzzvsuwusvz{utzААzy{ААy|АББ}ЕДБ|{}ААxwЕД~y~ЖЕzuuzxqpstttwz~Б{wsrtrsrturrx~Д~phd]WTMKIFJQYamy~yofd`ZVRKGEDBACL]qsfWG?:;;:4,%$;Yjxytoibebbbabbdcfhhjjotz}znYOIGGHILZisx{zxtm_X`ryq\YbjnuГЙМЧгЫЖЕДГ}uvААi_bjtДЗБrf]U`|Еxicf}В{~ЖКГxh]etytolpvskdfzГzoikommmnwИТГrhi|ЛГrlnqvtnhrВЙВur{ВВ{lcbfggfghpАРЭжл░░нммлнннлллкмп▒по░░▒░▒▓мллллйзжмнннннлммппнмгЪЦЩЯвзжиждвдФsJ,!>@FIHGILKIWo|ysgUB5032/)'$2Mfwytnhfa`[UOJBDHIKNNT^isxvjZJEDGIIM]houxxuoc[YguzlX_p~|{АЖЛСЦУГoinr|ЖЕБxrmnr|Вzlb[Ub~БsbYay{w{ГИВxdbfpyvlinqof`ar{wkfenkhilrАЕ~rcg{ЗАpjhmpohfr~Ж{mpu{zk`eehfbaafyЛЦЯвдздевджвгбгвгжездезжждздвавегдвбгдеадеегддгиЯФФЧЮЭЮЯвбааЫУtN2"7_АФдджеджжеагзйллмйоонмп▒ооммлждизезмп▒│▒▓╢╛╝╗╝╗╗┤▓│░нлмнмклнн░ибя                                                                                                                                                                                                                                         ├°           ■№ёых▌┌╒╫╬╠╘╓╨╞├┴┐┐╣╢кЫЯЬШХТФСРПНИДББ~А}}ДННЙЖЖВzsqnorГХЩЬЭЮаЭЪЧРГzuqomhXQX^^Wat{xwzth_ajhfntogcfg`_fmlaafjkfdlrnlnmgbirngfmrlhntyw{НИ|pntwrmpvwqlowyspu|Аwxz{}{АА}{{АААzw{|}xzАzvz|{wqnu{|unposstuy~|xonpqpmpnjcbix~wn`RMIJKMQSMHIOarysbSA<:::CJHGHIIGTlwunaL>1./-)'%!0Ievwuogdb^YSOJ@=DHE@AFXenwuk\JCFHJJO]iptxxxpcZZjy{iXas}{{ЕКТШЦБmcfmuАЖВ}wnotx~ymaZW`yqaXax|yy~ГБufaft~ulhkpne]bsytkb`ikihntИ~qgk{И}ohhlppicoБЖ{mqu~wkcbehfa^^ixЙЧЮввдбдвжлдгджддгдгЯаббаЯдггбгжгжбггдвбдзжвбЯЭаШХХЪЮЩЩЮабЯЯЩРkC+  DiЕХавзжеззжджжкзйкезддзмлкйзклкзйлмн▒▓│╖╢╣╝┴├┬┼┬╛╗╖┤▓▒ннопннннижш                                                                                                                                                                                                                                          ═є          ■√√ыцфр▄╒╒╦╟╙╫╨┴╛╣╕╖▓пдгбЫШУОРРОПМИДАА{y{z~~}ГМОЙЗДБ|snnoq~ПЦЩЫЮЪЫЧЦОБzvpppfWPX`YRbu|xvyui`chebr}qdafh``fihcabjnieksljoqkbirphhnsibmxxtyЙЙ{rosvtnouvrlqwunnu||vxz{|}БВГА~{zА~zvuz}{wz}А{xuw~{vpmsy}tpmnqsssx|{woqqrrnolga_guyul^RLGFFLRRMDBM`ryscQ?845:@EEB@??APjwul]H=1+--'# /Ffwzxogc`ZUPMIGEFHE=6>QaksrkZLEEGIIR_hmswwwmb\]lwyfXdt~zyЕКНСПГma_`gs|АА}smqw{~xncZVbwzpaV`w|vyГ~re_cqzukgkmlf\aqzkbckkhgks~Г}peh|ЗnhgkmpjeoАЖzknt{~wia`beea]aiwКЦЯбаЯЫЬЫагвгбваЯвааЭааввбедждббЮаЫЮбббагжевааЮаЧУХЮЮЧЫЯЮЩШЩЧИ\:$&LqИХбвгвгдддвгвгбведеввдзжежджзийм░▒▓┤╕╕║║╛╟═╬╧═╩├╗╕│▒ооннлкллзв╤                                                                                                                                                                                                                                           ╒ю          ¤ёїус┌╨╘╠╬┴╟╤╒╬┴┬╣╕╕▓маЮЫЧХФСУСННЛИГАБ~~~||}БЕККЗЖГА|upnmmxЙЧЫЬбЯЭЩЦМБ|xtttdSRZ_YQ`p{~КМxiacgjjrvpgadf^]bjjc`bknfchplkoohckpniinpjgnuwuxДДzqotvrmptrrnpuvqpv|{uty{{{ГДДА{yxzuuz|zwy}А|xuuyxtnkpv{upllnqrsx|ztnnnpnklieb_iw|um^URLJJQVRJ?FM`ryscQF?<=<>A?<:544Ihrsk\H=@MhssiYE:/2ALQSD4,!!.FUisuqgZTQIEDJPNGBB@<78PmyytlXEADHKQdjpoqttobZV^owr_ZhwynrzГЕЙОПВtmaXVY[_dimpqtxytmg_`huzrbVdvyuvy~ypc\bq{wkgmolf^_o|yl``hjeejq{А{maeyВ{qgehnngcnАЖzkkqy|wh__`acc`_drГТШЧЫЫЪЫЩЫШЧЫЩЫЮЫЮЯЯЭаЮЪЪЮаЯаЮЮЮЩЬЪЫЧЮЭЭбЯбЯЪЩЪЪТУХЧЧЦЩЧЩЦУНyT,,PwЛФЩЮЩЮЮЯЭЭЮЫЮЬЮЫЫЭЭаЭваЭЮЮЯджл░╣─╩╬╨╤╤╨╧╥╘╥╥╤╥╧╠╟┬╗╣╢▒лнлжа┐                                                                                                                                                               №№№√                                                                            Єч∙      ¤Ўъц▐▀╓╥╠╩╦╦╚╟─═╬├▒│нжгбЫШФХФФУМЗКИИЖВА~|z|АБВЖЖИККД}}xupoqsquДСШЭШЦТТСНАijpn]RW`dRMZff_]klfglmh_irodbfga]ckk_\bhjfagmjfhifekoleflthdlusjlzГwkjorqonppolosvoos{zutuy{yДРКАzvy~{vrqw|yxzАvpnnxyukhinuuqlmossux}zsmjigdb^\ZZ^bpzrk]RQW]][[^^]^`nxyvjc_a\VROPKIIECBOhqskZF:15EV_ZTA501>R^krupfWRKFBADJTI?>A=;?Up{ztjWDACDLUlutrsusm`YX_q{p\[jvulmxВЖКРРДxrdXUYZ[^aglmsxytljd_jx{rcWey{rpy|xpcY`qzumhjkjb]^o|yj^_kkfeho}В|k_bwЕ|phehnkcbm{xmhpy}wi][_aca]^coВСЦЧШЪШЩЪЯЪЪЮЫЭЫЫЮЯЭЩЧШШЩЩЮЪЭЮвбЫШЦЦЪЯЮЭЮЮбЮЪЩЧТОТХЦЦФЦХШЦУИnG& 0]ОФЦЪЩЭЬЯЮбаЪШЩЫЪЪЮЧЧЦЩЩЩЪЩбежк▒╗┼╦╧╤╥╘╥╨╤╤╧═╠╔╚╞└╗║╣┤никкЯ╜                                                                                                                                                         иЙvgkljjjiih|к╫Ў                                                                       °уЇ√¤■   ·ёыч▐▀╫╥═╚╟╔╟╞╟╠╬┬▒пкзгЯШЦССУТТНЗЙЗДВА{|{}ББГЕИЙЛМКГВxuporvvqАРЧЩШЦХФУКya_mk[R[deQO[c`XZikjkpqhbinldbff`]agh`Zblkdagldcgoiajpkfhlpeenrpgiv{skjotrllnqmlorqnosxxusvyzwГРЛБ}x{|uru{}uszАvnmqxytjcfmtuqjimpqrx{{skhffcdc\XXZbnwuj]TRV_^[\bb^aeqy}uja_\]YVUVSQOLHEPgrsk\G;19KX\^YQIDFOZcjvwshZWOKDBCFLJCA@>;Ldpsn_OFGKMNNRTTRNOSV[drxtnhf^VPKECCA>?AEHKWkzzulXDAAEKThwqqspf[VZjyxeR[p|qdhvЖЙЛЛБsl_W]ggb]Z\cinrtrqyЖЗ~}sf[h{wkiqvpjaZapxqifegga[\mzyfVZiheein}Вyi_drВxngchliaaku{vkhnu{vg^^^`c`]^`m~ЛСУФТУХХХУШХЦФХЦФЦФФХФФТФХЦУФХЧЫЮЮЮЩЧУХХЧЦФУСРППСТУТТУФФОАa<%%;aЛСУХХХХХХЧЩЦФФЦХФФТУУФЧЪЭавгддзн│╝┴┬├┐║пбХОЕ{slgffkvЗФЦ├                                                                                                                                                          №чТc`e|ЙНРФХХХШФЗzmd█                                                                      ╨чЁёЄї·єщт█╫╙╤╬╔┼┬─╞┼┼┼┴╛┤кевЭЩЧХФРППОНДГБ}z{}}~ВДЙНРОЙЗИЕzklpspo{Б~tqw{~~ААwnkntpecnvnXY_bVJ\lvГМКwgafjhaaigb_dij_Zenma]koffkniaimhdfkkdgkmiccjpliflurnknpolkpqommvxrnpvvs|ЛМВyuxyqmtywmnswywpjntwrgfcktuodjmpoosz}sljhdXWWTONSZhtvnfe[\_^_^^aebgqy|tnd_``\VW\]XL@8:Mbnqn^MIJLNNLMQSQMNQV[dryyuokd[SLC=;:89>IJJRanuulZF?ACIPcspmotqe\U[kws`R]nxpbgtАДЙЛКБqi^W\mud[VZbimssqqwВАyААvkbk|wnloroj`Y_r}qgdfgeaZZmytfUTkleeio|Вyg^cszofcgikcaku|vljowztg^\^`a__]^j|МСТТТУУУССУТУУФФУХУУУФФУУУФТФЦЩЯаЮЩХУУФУФТУТРПРССССРРСРРИvS7! +HkВРТТУУЧХУУТУТУТУТСТТУУХШЭЮЮЫЮгджл▒│┤▓пквЧНДxn_UOKHIOYjАХ                                                                                                                                                      ■я╘зЛКЕtheh~НСУЦЦЧЧХХЛ~qg█                                                                      ╨хээьщъъу▐┌╪╘╒╥═╚┬┐└╛└┐╛╗│жЯЭЪЩШЦФПМЛКИГБА~~{{ААВЕЖЗЛУНЖДДДxkknrqotАvomknu{|xst{{qdhqwlW[`bUJ\lsНИvc_imf^`jia_elh_]dmnc]gngadihdejicdlnhgiomcdhnlghhpqljlrpjlpqnknwwplmswuxИКБwpu|wnlqvxompuxvofiswqifbkuuohimpoot{~smkicVUQRNPSYhssnie]Z_c_]^cc`eowxslf``_][[ZZTJ>6:L`mqk^QNMMNOKIJKKJKLMTcszysrqj\RJ?88415;ENKQ_krtn\JB@CIL\jjlpspf\W\kxs\P^mslccrАЕЙКЙАneZV]loeXQWahmswurrАИИЖВ~rir}xmkormg_YapypcbchfaYYkyxeSUlifegmyБxh^br{odbfhhbdjszvlkouythZ[^`a`^^_l}КРТТТТТТРПТТУУУУТУСТТСССТСТРУЦШаЮЮЪХУТУТУСРОМНПРПРРРРПРМАjG/$5VsЗПРТТТХФТСТТУУУТСПРСФУУХЩЮЭЫЮбжийнонжаШПЗyl]RJDA>;;?GS`▒                                                                                                                                                  ў▌╕РМППСФФН{lgkБЛРХЪЪЯаЫбТГwiНФЪzyЖн┘Ї                                                            ╘сыщчцъх▐┘╘╙╤╥╨╠╔├┐╛╗╜╣╢┤пжЯЬШХХХХОММННД}~АА}~{||АВЖЙОЦПЕДЖГwljnsqmqy{xsjhjrzz{ДЧЦГvporueW\a_RL[imry|nedilh_bhia^elk[Wfpn`[hneafie_gmhcflkefhkhbcfmlfhjqojhlpoiinqmikwwojmtuquДКБuor}vnlsvsljosvsnhipvsgeahrtoeimnlnsy{qkff`UPPONMQYiuslfc^]ad`^_ceafouwsld____]ZZXRJ>8;>??A@BH_rz{wtpgWIB6341+*1=GMQ]kvwq]MFBDIJW_`eovrg]UZisn\Vaorh_bqАЖИМЛ|kcWS\pvdWU[dhpxzxsswБЖЖБztu~ynjnqmf_Y`szpfdegf`YXjxseTUkjfegmyГwgaeoyxngcehhbahu|vjimvytj`]^`a`^\amАМТУФТУУТПООПРРРТПСОТТРППРТТРРТУФСУУУРПРРТРПОМОНОРСРПООНЗxZ8+ *BezЙСТТУУШУСРРУТУФУСРСУШЦХЧЪЬЯгжлккидЮЦТПЗ{oaPB98884357;BM├                                                                                                                                               їРКХЧЧЦЧЪЪШЪШРДwqsЗНЦЭжйм▒╣░бОБzxzДЙМКИЖБ~zЖм╫ї                                                       ╫▌ччхттр▄╓╘╘╙╨╧╦┼┴╕╣╢╕┤│┤░жЫЪШФХУЦКЙЙЙИВАБАА~ААААДЗЙПЧРДЕКЖxoikswnkt{|wmhltzzФЫШКztstr^QX`\NJ[hiccklfdknf]ckia_eli^]fnk^Zipg_emiadkhbbmncbholb_cgifghpsjflpnfipqljnuupjnuwqsБИБsls|wnmpwvjjntvsnfhpspic^gqrnhgkmmnswyplfaYTQOOKKPWjrslgc_`cd_]_bc_cntxsof`^`b\WYWQH>982./-'&,7CLR^lwyw`OHDDFFPWZblswi\UZiumVO_qsg\^oЗЙЙК{lbUP]lpgWQYdis~}ysnovГЗГБ}vx}zpmqqle\Xbtxodbfihb\[mxveY^ihbbhlxАxg^cp{ypfbegfbciwxkhluzug[]^``___boАПФФУРССРППППРРРОПОНППППООРРППРРРРТРРПОРПСНЛЙИМММООПОНОМБkK/&"2SrБЛПРРТУХТТУУЦХХЦХФТУФЧУФХШЬбдлолзгЫФПЙГwgWF92.,/41--.26>л                                                                                                                                               ┘МЧаЯЭЯабЯЬЫЪУЛДГМФЭип┤╕┐╞┐нУВz|}ИПУФУЦЦХХТОКЕА{Л│▄ї                                                  ▀┌ххус▀▐┌╓╘╥╥╬╬╩─└╕╣╡┤нм▓░жЦХТСТРФЛЛКЙИВ|}}{|}АВ}~}АДИКОФРЖВЕЖxqmnuxyllzА{qrwzxxГг╣иН{xztnXLWb^MI\ic[_jnimpnf_gkia^eojZXhpk\\jogcfkfbfjgccijdehkkd`dkkhehnojgiongfmrnhjuwninutpsВАuov~yokqtqilpuyulfgkrqge_gorlfhhihjorwohb\WQNNNLLQYjurkfdabadd_`ae`bovxupeb^^]YY[WNE>:@Tfpqi^WVVVTOMOQUSTUW[`gtzoYRG=82+*/,!$2?KS_oz}z`SJDCDCLRW_lwyj]SXlsjTN_poaY^oИЙИК{naUP\nqeXU[djxА}xrhekov{~zz}zplqune]Ybx}oeccfga[_oyvfX_nldafo~Ж}kbgvА}qhcdhgb_gvxohpwyuk_[^__]]^`pИЦЪХТПНООННОМРРРПППОППППОНПППППООНПММППРРСОЛКЙНМОПННННЛЖv\?)$#,B`ИМТСУФТХСРУУФХУТФТТУУЦФРТФЩбелкеаЩСЙvlaQ?4/+(&&,-+'),/7}                                                                                                                                               ╢МЪЯббдгеддедЭШУРНУЩбзл▓┤╝╛╝кФМННРХЩЪЫЪЫЫЪШШЧУУРОЛЙЕАyМ╡▀ў                                             ч╒ффу▌▌▌┌╪╒╤╨╠╩┼└╜п╡о▒нлнндЩШФУУРРЗЗИЖДВ~}{{{ВАБЖКООСМЗЕЕВwrlnzГБtowВ{~{zwyЛ┤╕дН}y{tmULXa]KH\e_Z_hjkprre\bhga_ekg\Zckh]\koe]eifachhdaimeainkcbglkgaenpgehoohhprnjnutninutlkyГqlx~wlkqttkjpwzujcgjmmhb^dlpjeehheglrtog_ZUPNLLMOT]krqledcdcdd__`a^fntwuphea``]ZXVLD=:CWgqnh^RNW^^^^^`_]_a`bdmw|xmZGA953/+,'-;KWcqz}y_TICDC@INR]kvwhYR[nuiPO`po`Y]pАЗЙИЙ{m_TS^kmdUO\en{Бwpfacekt}БВБzqoqqkd]\dyrgcdfd`Y]qАyh_hojdchqБЙlbdxИБsfcfhgdbj}ИАpiq{Б{l^]^``^]Z`tОЭидУНЛЛММОСПТРПППОНОНОООООППППООППОПРППППЛКИИКЛННННЛМЙАiL3! '7PnВЛРСУУУФФТТУУФФТУУУСРРСПНМРШвекжбХПЖ|peZL>20*)&%'*)%&(,.5P                                                                                                                                               ТЕТЫЮЯЯгдежззеегвден╕╛├┼╔╬╧╞╡жЭШШЩЪЯЯбггггдваЬЬЩЩЩЧЧУПЛЕБ~Ф┴у·                                        ь╙рут▄╪┘╫╓╙╬╧╠╠┼┴╗▓│лмггклЯТТППУССЛИЖЕГА}АА~{~А{|}АДИНЛОМЖБ}vwst~ОМ|x{}~}|xyyВЭ╤╩аИ{x|wnROYc[IJ]cYU^gkouwqc]ahc^^engYXfmgX\ime`bhgdglhb`ejfdfjhd_dkjdaelkgcfonggoroglwxnhmtsljuА~pkwwjknpplkowyrjedksqha\amnhfffcbdjotoi_YTQQMNRV[bmupifcdgfeb``ac`emsuuofb^]]][WRJA;;EYgomh]OJQ[`a`cffeeffghnyyo^QG=85213+)8NYdt~xaUICDGFIMNZnzxeZW`prcURboo_W^oАКЙЗИ{l^RQZokaVT]hq}Г~ulea\`blxАГИЙqknqme_Zg|АrgaadfaW^tДj[crpgchpЖПldf{МДsfcfkkb_kЖТЗqir|Вm_\^``][Y`sСе▓░ЩМММННМООПППОПРППРРСППППСРРПРНППППППОНКИЗЙКМОПООКЛЖvZ@,!",C^wЖМСУТТУФТСУФХУУУУФССПППКЕИОХаждЯХОГvq_RB71**)'$#$%&%(,/16O                                                                                                                                               xАЗЛПУЧЫЭагдежежжжн║─╬╙╫┌▐у▀╒╟╝│пкло▓▒░▒▓│▒ммзжееежзжгЮЫХХУУРНЙДЦ─ф∙                                   є╧рур▌╫╪╪╒╥╠╠┼─╜╖пгмзигбжжЮХХТПРСРИЖЗЕГГБА}|ГААБДКПМЛКИБzuoqsyЛдЯКВ|{xrnnqyТ┴▀╤ЩАutxwlPQ\aXGM__WT[intxwqdZdhc]]fkeYZelgY\ilb[bkf^emja_ikd`hnk`^ckkgadpne_gqnfhmplhoxwogkttifs}{nkvvjhlrrnjnvyukehmonh`_blokddebbciprpf[VOMMLOU\cfnsrkfeefec``_``^cmtvuofc^]]^]WOE<8:G[fmmg^LAJYbcdeijhhhhhlrzzraUOH?:642(&6LWewВД}cWLDFHGKKN\oxxdZZcqtbOQ`ih^T\nАКИЗЖzk\QQ[fhaSO]ipБ{tkfb\Z^foxБИЖypoomjf_]jДВte_beeaW^yКГi`fnmjghpДОВmac}КДtfdfihfbkЖЧИrkr}ЙАl_\]__^][_rОЭнйТЛНПРООППППППРПНПППППРРРПРСПРПРПППППОЛЙИИИКЙМЛНМКЗ~mN6(! %4QlАЙМСТССТУСРТУУУСТУУТТПНИДГДКУЮббХНГxnaI91,)&%&%$#! $%*-049Б                                                                                                                                       ¤¤єях╓╙дКЙИДБДЛСШЭавгееим▒╝╦╫▌▐рцт▌┘╓╤╠┼─┼╚╚╚╚╩╚╞┼─├┬└┴┴┐╗╕╖╡│ннмонйижЯХРИЗЬ╟ч√                              °╦▐фт┌╤╘╙╘╤╠═╚╚┬║▒дйгЯЬЭдеЪНПОМОППИДЕЕВААА}|~А~ГДДЗМЛМКИБvpnsv~Ы╛мТЗ}wodc`lБа╤у╧РwrrxtfNR]aWEP`^VS[ip~ИВti^fhc]]fneTYgneV\ihb_af_[fmhd_gheafkjc_ejjdafnngbhpoefoslenxxlfirrhfqywniv}vjfjpqlilswtkhhmrnic`dmmifda]\akrsph^VOKKJMU[bfowpjfefdccaccca`bmuwunfa[\`b]YRD:69F[djkh^H9AUadehhjjiihhmsz}te[VOFA;72#$6IUfxДЕgYIBFLMMMN^qzwf]\eqr^PRcng[TZnАИДДЖwiZRQZjj_UT^hoАБ{sle^WWZ_dkv{}vrnmokia`mЙНukbaeeaV_|ПЗiXbpojhiqДКped}МЕsfdgmjc^i~ЗАnhqx{{m^[]^]]\Z\nЕФЪФОИЙННМНМНООРРППООПРОРРРРППОППОПППМНОНЙЕЖЙЛЛЛМЛМЛИЕw`@/($")A`wЕЛОСТССПУТПРССРРСТСРПМЙДДГГЕНШЮЩРЕ}rbL3-&$#""###"!),.39х                                                                                                                           ¤¤їёъ╪╪│╢ЯЧЩЩЩЫЫЫЭЬЪЩХУМЗАzysv|ЕИМУШЭгзп║┼╧█ррссст▐▌█╒╒╒╓╪┘█┌┘┘╫╒╘╒╙╘╓╓╘╤╨╧╤╨╧╧╦╚╞╞├┐╕│лвЫЦТРОн╘я¤                         ¤╟▄ст┘╙╓╙╥╬╔╟╝┐╕┤озжааЪЧЩбЩУРОМННЛИЖДЕБ~А{}~ВВЕЗЙМИЗЗД}uojryГа├┴ЧЛ|sk_aamЖи╓я┼ЕqlpxtbNR^`UEP_]ST]koГИБre]hjc]^gkfY]hmeS[kk_\dl`[enja_gnb`fokcacjjb]frpeahroffmpmfluwmcjssebpzwjiv}tifjvrkhkpuvjfhlpnib`clpifb_]^emrrph^ULLMLPU\`eowsjhfgdcccfdccaelswuoie^]^c`ZQC;79GYdmmh^H7*  ! $*-3o                                                                                                                ■¤°ёы╫╫║▓гЩЫЪЪЬЭЮЬЬЭЯаввЯааЯббаааЯвЮФМЕ}ysqossszДЛТв▓┬╠╤╒╓╓╒╓╓╫╪╪╪╪┌█▀▐▌▄┘╪╪┘┌┌█▌▄▌┌╒╘╪р▀▐┌╓┘█┘╙═╔┼┐╗╢▓пмклнкаъ                        ╞┘рт╒╬╤╤╤╠╦╔╞├╜╖пдбЮЪШЦЪЭХЛНММООЛЗДДДБ}}{~}АВЖЗИКЙДВБ}vpjpwДЯ╜╢ЦЛ{pcY^`lДл═╪╣zjkqyv`RWa`SFR`[QR_jmuЖАpfagic^`johU]hkdQ\klc_dhc^dkib]hle`ckkbackhc`hpnebhsoaaorkajuukditrfclwwjit{skiiqpmghntugegluqjd`bilhda^\^dkprph^VMMQY[Z]birspjgefdaacedddcfltuslhc__aa_[PB;6;IYcjojbL:;IYafiihhhiihipz}{vmb][VOI?+(9EP`rБЗВoXKJOTWPOQ_r}vf[\grk\NXgohWPYmДВВВxk[RR]mgYRV_ioy{zskaVJPVWXZ_hmnlklmmojhrИГskc`ef^Tb{И~dV`nmfchn}Вzk_`xЗocbehfa]ap{thgintug_]]]]]\Z]ixГММЙИККЛЛННООМНОМПОПСРПОППОМНППООООМЛККИЕГЗЙИИИКЙЙЖЕy_C0)'(*<\rАЖМОПППРРПППРПРРРППОЛЙЖЕДГВВДЗЛОНЗsdP9#'/<°                                                                                                    ■¤·ёЁ█┌┴╖жЧШЫЫЭЮЮЮЭЭЮЯЯавббаббвеийййлнлклкйззлнлжаЭЪХОЕБyttpqtyАЗТЫвл▒│╢╗╛┬├─╟╚╔╠╬╬╨╨╤╨╤╥╙╙╒╓╒╘╙╥╥╘╪┌┌╫╒╒╓╓╥╨═╦╚╞┬┴┴┐╗║║╖╡╢                        ┬╫рт╙═╤╤╨╦╟─┴┐║┤нгбЬЦУРУЩФНЛЛЛННЙЖЕГБ{z|~АБВААЕККЗККЖДВ|uoeoxГУлгПКod][]jАЩ┐╩Эskjrxt`V\b`SKTa\SS`ijjmqnfbhkd\akpjR[hk`U^jk][fmdYdki`akib_dkk`adjjb^hsod_hrncckokcgqrgcjwsegmrqhjuwslkktqjggnsufcejonkdbbgmhcaa[\`fpspf\ULKV\\]^djotrjffgd````_b`cfirurnhd`^^__ZOC=9>MXclomeSD?DR^ehihiijjhhqyzzwnfa][ZSE1,>FP`rГКГr]PPTZ[QMO^q}wg[]jphWKWiqfVOYm}ВБГГxlZOQ\heYNUekoxzwrkaTPWYYXX\_beghimnuxut|{ofbbfg`P[wАue^_hiebfl{Аvg]^tzmccbdd`X]o{qgfhmrqf_]\^^\]Z^ixВМЛЗЙККККЛМНММНОНОНПППМНООМЛНОПМОООМККЙДББДИЙИИЙЙЙЕАjN9.+),6Lg{ДЙКНПООПППОООРПППППНМКИЕДДДЖЖЗЛМЛЗБu`K9(#'4т                                                                                          ¤√ёЁ█┘╟╕▓ЪЩЪЩЬЮЯЭЭЮЭЭЯЯаааааабеггггддийлййомол░│││││▓│▓│╖╕╢▒мкебЭЫЧФСОЛИЕГБАДЗМНРПОООРСТУЦЭгЭлзлно░│╡╖┤╕╣╡▒▒▒╢╗└─╚╔╚╞╩╩╔╚╟┼─┬└╛╛╝╢╡║╝╝╗я                       └╘рс╘╬╤╨╨═╩╟┬╛╖оиЫШЦФУТУЦРМЛНЛМКЗЕВА~}|~А~ААДИИИЛКЗЗЙВxoilxБМСМКЖБwd[[[h{НФХЗkfitxq`XagaQLYb[OT`gebcjkhgllc[akndR^il^R]ji^[ejd]dhf_^ilb^cmj]]ejgb_gpmb]isl`cnri^etpfaiwrdbjrshiswpjhiopjfglrtebeknniecegjhfe_ZX\`ouoh\RMHU]\[^ckoqnkgbdb`_`dcbbdfktvtnjeb^]__YMA??CNXbmpmgWMEAJZdhjiihhhinsxxxunifb``ZL9'*>HO\qБЙЕtg\WY]ZOLQ^szsf]^hogUNYloeTPYk{А|}~ujYOPaoe[U\flovwtpi^PL\da\WXZ[_cejnqyАzvvngcckm_UZpzpcZ^ijedely{sf][rwkdbbbd_\`oyrgdfjrsf[[[__^[Z_iwБЙЙИЙЛМММЛМОНОМОПНММОЛМНННММНОНЙЛММКЗЗДВВДИЗЗЕЗЗЖtYE4+*/4G_tБЖИЙЛМММОППМЛОППООООМЛКИИЖЕДЖККЛММИБv^H9*"#,╚                                                                               ■¤ёёр▌═╕║ЩЫЬЭЯбаЯЮЮЯЯбабааабгаввггвииккклммймнном▒░▓▒│┤╡┤▓╡╕╣╣╕║╣╣╣╝└├├╛╛┐└┐╗╣╕╡▓пкзвЮЭЬЬЭЬбвбаввгеЮЫЩЩЪЦбЦЧЧЧШУШФШРЙГА~БЕЙНОТЩЫЭажлп▒▓┤╖╢╖╡╡пп╡╝┬─┼                       ╔╙рс╙╬╧╧╬╩╞┼└╝╖пзЯЪЦТСРФШУМККИККЖДГА|}{|~ААААБДКЙЙММКИЗБznjpv{АЖЖВВБoa]_jwЕМН}ghjpuo`]eiaUU\c\SQ_f^V_ijhjpma\ajlbY`jl_RZjh^\fldYcje^_fga_dki_]eli_\hrm`^hsmcclng[etpecktrbbjpniipvqicjrqieckqndbaglnjfgejnkggk_UW_mspg\SOQWZ\Z^dorvslheeca`aebdbdeitwuojfa_]]]WHA?BHOVblnkf_TE?BS`hlkiiijikrwwuqnjfcdc]RA/&;HMZm~ДАxqj`]`\NIN_q{ue\_hkfQK\noaVPWkzБАДАuhXPQamcVNYinosvuoh\QS_hg^UUUW[_afnrzВА{zzpifhllbV\owod\]fjgddjzzsi`^n|ukcaceg`Z`pzqheemrpe^]]___]Y^htАЙИЙЙКЛЛККММНММНМНМООННМНМММННЛКЛМЛЙЕГДГВДЗЖЗЖИЙЗВyeK=3,-5=Zo~ЕЕИКМНММНООММНППНМНОНЛИЙЙЙЙЙККМЙККЖs^I8/'!   &)0╧                                                                   ■■Єёф█╘║╗ЭЫЬЮЯббЯЮЮаааагзждбдддгвдвееезиидииийкнн▒▓▓▓┤┤▒┤╡╡╡│╖╖╕╢╢╗║║╣╜└┴┬┬─╞╚╞╔╦╠═╠╬╧╬╬╬╧╧╬═╠╦╚┼┬╜╝╗╣╣╣║╣╕╖╣╕╣╕║╗╣╕╡╕╡░плигаШЬР~qjjkptz||БГГИИКПСШЩЭббвмз▓╣┐╞╦╟ў                      ╥╙р▀╥╠╨╨╬╩┼└╕╡▒идЬЩЧФТСТХРНКЙЙККИЕДБАА|АААБААААВЕИИЙМОКИИwomou{xvtx~ГВvi_`itБЕЕЕБyqoplc`ilbUWfh]PR`d[V]hklqxpb]_jn^V`kl`W^kf^^fjd]dhc\]gka[aki^]flj_]fml`]jrm_coqeZdroebkws``hoohdmqoifgqqicbkrndddjonikjgfklgd`[VW]msof]ZY\[\\[_enqrqmgfdcadegffefgkpvrnhb`^]]\SIBBHKNRblolhbYG;?O^fiihhhjkjqvxspligdce_YK9'#8FLXj}ЖВ}wna`aYPKN_nvpf^ahkbUO_nobQNZm{А}}|ufWPRbmaSPYfjlrttnf]NNcpl^TRQRVZ_iqv}ГА{ywtjehmlbW_ovpc]_ihcaflxwrhZZm|tic`bffc^ao~sgeeiqsd\]]``_\Z^erЗИЙИЙЛЛККММННМНЛЛЛММНМММОМЛМММИКЛКИЕДДГДЕИИЙЖЗЗД}mUA6006?Qn{БЕЗЗЙЛММЛКОПМНПРОООНОММКЛЙКИЙККЙЗГБ{uk_M;1(#!$&%$*1Z                                                       ■■Їєщ▌┌╜╜бЪЩЫЭЮЮЭЮаааббввбежггдзйийл░░мймонииллмлмоп░о░п░▓▒┤╡╖╕╣╣║╗╕╝╝╛┐┐┬┼╞╞─╚╚╚╞╩╠═╬╬╨╨╤╥╓┘╪┘┌█▐▐▌█▌▐▌▌▌▄█╫╘╤╬══╠╦╦╠╩╦╦╠╦╩╔╩╩╔╟╚╟├┴└╜╣╡▓зЧЙuhccjptyz~БЖЗМНСУЦЫджо│╖╗╛┬╞╦╦╥                      ▀╥▀▄╨╠╬═╦╩├┴╣╢▒ибШЦФУППРЧУМКЙЙЙКЖДББ}|ААААБВВДЖЗКЙЙММЗБzuommqwwrnqwБГysnfku~БПОБvsqlegnmcYahi[NR`eYT\glow{sc\_hl^U`lm_WahcXZhm^WeleZ]fjb^aih^]fnj^Yfni__kumadpre[dqodclwp`aglmhdjrqicjrqjdcjuna`agopjgihhklhb^XRTZkrmf]]]^[\___dnqvrjcecdddceffcefmsvrngedb][YPHCENLNQ`kmmjd\OB?KYfjhhhhkkmrusrojiffbda]PA/% $7DKWgzБyqga`cZOIM^pupgbbhj_LLapn^QN\py}z{ugWOTgmbQN[jnlrssmf]RUepl]PPUTW\_gnrz~}}}{zukjml`U]mroeZ^hjdbenwyth\\ovjcaaed`X^o{rgdaippf^[]`_]ZX]cpЖЙКЙЙККЛКНОНМЛММНМОММЛМЛМЛЛЛММЙЙЙЙЖГДЕЕЕЗИЙЖЕЖ~p[I>324>PkwДЖИИКККЛЛЛОНМНООНОМННЛЛММКЛИЖЖБ}|xslhc]P@6/+++)(# )1<х                                          ¤¤Ўёъ█▄║║гЪЪЬЬЭЮЮЭЬЭЮЯЮЮабббввгдезйииикмлййлммоп││░░▓┤┤││╡┤│▓│╡╖╡││┤╡╕╕╜└└┬─├┼┼╚╩╠╠╦═╤╥╥╤╙╒╓╒╒┘██▄▄▌▐▌▄▌рутуцццццчшшчччхфс▀█┘┘╪╫╓╒╘╘╒╒╒╙╙╙╘╘╘╘╙╥╧╬╬╦╔├╜нТ}fc_elsy|БДЖКРФФЩЫбейн│╖╗╛┴─╔╩╦╠Ў                     ч╥▌╫╨╠╬╧╦╔┴╜╡▓нжЮШХХТООЛСПМЛЙЗЗЙГВБВВ}}АААВАБВДИКЙЙМЛЖАxwqnnquutllt|Б}vswz}~Аб▒ЬБurnknqn`T\ts\NT`bVR\gktА}qb[_kn]Wbll\V_gcWYim^[fmeY[ilaX_mi\\flh`]dom`bntk`gpre\fpndbkrna`fmmhcionlhjqrkaaipmfbbgmnihjgilkd^[VRT\iold]Z^a[Y^`belorpmebcfeedeefeegotwsnifa^[\[QEBBELMQbloomg`SIDDQbgjjiikkmrtsrpligfdec^SG:/%'4BMVcx{wj_[^\TMJObrrogcdgfXMOaol^NP_oz}zz{sfWOUfl`RP\gknpsrnf[OTgrlZOSUWY[_inntzБАА{zunjll_T^nroaY_gifaemtytgVXp}vld_adc`]aqxqgcairqf[]^^^ZXYZbpАИИЙЙККЛНЛКЛМКЛМКЙМЛЛККЛЛМКЛММКЙИЙЖГГГЗИЖЕЖЙЛИД~r_M@;99?Lcv~БДЖИЙККЙЙЛЛНОЛННННПННМЛЛКИЖБА{wtqkkhea_]UG=52320.,(!#+6q                              ¤■°ёю▌▌└║иЧЧЪЪЫЪЫЬЭЯЭЮЮЮаааггвбдзззйиййклккккм░░ноп░▒п░▓│┤╡╕╗╗╖╖╗╗╗╣╣╝╝╛╛┐┬├┬┴├┼╞─╞╔╦══╬╬╧╤╙╓╫╪┘┌▐▐▌▌▐▐р▀▀сттууууфуфцщчшъыъъъььыььььъщчхутрс▐▌██▌▄▌▄▌▄┌█┌█┌┘╫╒╒╒╥═╩┬бГg`^cow{БДЙНРСФЦЭвейн╡╕╜┐┴─╟╔╩═╧╘                     я╥▐╪╧╦╠╬╦╚┴╜╕┤маЩЦТУПНММТРПЛЙЙИКВГБА~{|{БААГБВВЕЗИИЙЛЙГ{oprokntxwllsy|Вyx{zy}Н┴╞дЗyqpruuk\U[ij\QWbbSR`iqБnc\ajna\cljZVaibW[kl[Xgmg\^kk`Y`if^]enh][eoi_akuh_enqd\iqoeclpkcbfjnhchrqifmrqjaahmjea`fpogehhijhb]YUTU\kqld_\]_\\_`adnrvtmheefgedeeifehnuxtnifd_^\XPHDDELMQbmpqngc[PEAG_fhijkkjnqsrqolihhhff_YL@7-+6BJVcuzyqaVW[\OFFTdrungddfaVJPbnk[MQar}}}{seVOXfjaRN]jmlpsqldZRYhnhWMT\[\\_fkkks|ААzphkj_X`kolaU\ile`elrwseZ[pztle`^aa]Xbsypgbaippe\\]^]\ZWZaqГКЙКИИЙКЙККЛЛЛКЛЙИИКЙИИЙЛИЗИИИЗДДДДББДИИЕЕИЙЗДudQD=:9>FZrВГДДЕЕИЗДЗЙЛЛИИИЙЙИЗЖЕДБ~}xunjhhecbb`__^\OFA?><;::86,""*2?Ї                 ■¤∙ёю╫╫┐┤бХХЦЦЦЧЩЪЩЪЪЪЬЬЮЮЮЮЮаадвввгеекккзиклмоонп▓│┤┤│▓▓╡║╖┤╡╖╖╕┤╡╡╢╖║┐┬┬┴┬─╟╚╟╟╔╠╩╦╬╬╬╬═╧╤╙╥╒╫┘██┌┌█▄▌▀ссртхххххчцччшщшшшщщщщщыыщщыэыыыьээээььэыъщщчфусс▀рстууттртртрс▀▄▄▌█╪╫╤╖ЙiaXcqzЕКЛСФЦЦЫгзкл▒╡║╛└┴─╟╚╦╨╤═·                    Ў╧▄╒╬╦╠╠╚├╛║╡▒йаЪЩТСНМЙИСТПКЗЖЕЙГДВА~}}ВВВВВВДЖЙКЗДЙЖАxnkoqmms{{lmrvyyxsusv{Ий┌╫▒Н~ttwxskYLXigXQXa`RVbmpyЛ~nd^bjl][cliZXbjbW[klXVclfY^on_V`lh[[fnh][goh^_jtf^dmnb\holfekumccfmnhagopkeltsj`aimld``fmmgfhgfjjaZVQPR[iqne_^bd\[`a``lttrmgefedeeeimhegmrwunjfd_[[WPIEFINMQcprqmga^VF;F[cfghjjklpssrpkjiiiheaZOF>747@KWfw~xm]UXXVJFKXgqrngfef^SKSblgXKR`p{zy{~teWPWijaUS^iklnnojcZMVhpfULUadc``fighjp{~|{xojjha^cnroaX^gic^`jsureVZrztne_[^a^\cu{pf_^gtrc[Y[ZX[ZVX`o~ЕЖЖДЕДЕЕЖЗЕДЕЖЕБАААБААБ}{~~{ААББЗЙИЕЖЗЗДАyiYKCA@BFShz|}}~|~АБААБА~~|||zwtsqnkijgfdccb]\_a`_YRKIEEEGORNG8&!(0=Н      ¤√яЁ┌╓─│лУСТУФЦФЦШЩШЦШЪЩШШЪЬЭЬЭЯвгвдджддевизкииййн▒▓░░││╡╢╖╖╖╣╣╝╣╕╣╕╝╛└┐┐┬┬┬──┼╞╟╔╩╠══╧╤╤╤╥╒╫╪┘┘██▄▄▄▌▌▌▌▀стттртуууфцццччщшчшщщщъыььыьыыыыььььыьюэььююююяююэььэышшцтрсртфххфуухфуфуттстр▐р┌─Пnc\bp}ГЙММРХЦЪЮзло░┤╣╜└┴─┼╔╩╩╨╙╧╒                    ·═┘╒╬╠╠╦╚├╛╕┤пиЭУФМПММЛЙРСОМЛЙЕДВВ}|z~ААБВБВЕГЗИЗЙККЕЕДАxpopnlmsz}spqvwxspnpvВШ╙ыу║СВrr}vi\PWccWRXa\MTblmqwulcbgnj`^ekjZWdibW[mlWWdleY`li`[alg[\glfX[hlf_ckoe\alkb]hpmegnpjecflngafopihltshaagnld`^emmedhihiib\WTPRZgplfa]^c__`a_`hswslefgefdddhnmhfkputnjfa^]ZVLGGGJKMTfprqkdb`ZNABS^eghihikoqsqnkiggihfbZTG==:8?JYfvxuk_YYVRFAIZhqrmhfca[OER_gdUJQ^ny|{{seVQVdg]NOaojjkmmg`[RYfmfTMVadb_]digbchmx{Г|nhhlgbfprobR[hkb^^isxsh[[szuld]]_`]Zbrxqf__grpb[YYYW[ZWX^ly}}}|||||}{{z{||xwvutsronomnpqrrvx{}АДЗЖЖЖЕГvi\RKGGJMS`hnruvustsvvsrrssrooqrnmnmklhijkghfggehgfhhkkkhfcb`\Z^infXE/#,9MаЮЯЙЛОРООПРТТУУФУФХФЧЧЧШЪЩЩШЫЬЫЪЫЭаЭЯбдедззкмлммп░▓│▓▓▒┤╖╖╢╖╣╖╣╣╝┐┴┬─╞╟╞╟╔╩═╠╦═╧╨╧╬╨╥╙╒╫┘█┌██▄▄▄▌▐▀ссссстттфхццццчццццчччшщщщъъыъъыъъыъьььььэыээьэюэьээээюяяяяЁёЁяюяюэыъшччццччччшччшшшчфцццххуу▀╩Сsb\bp}ЖЛОПФШЬЭвйп░▒╢╣╛┬┬─┼╚╟╔╬╤╬╚√                   ¤╚╓╙╬╦╔╚┼┬╛╢▓ндЭЦФННКИЗЕППМЗЕЕБВВЕБ~|{АВАВВБЕАДДЗЗЗИЖИЙВyrnppnlrz{zvxzxk`cjwМ│щєщ╞ЦВll~~teYNWb^PNY`[PT`fhhimkdflro\^fieZZeh^X[jkXWhmdXarm^WcniY[gieY[gng_akoc_digabinkhgmrmc_fmmgbfnokfnvuibagnng``ejmgfgijmjb[UNNPYgnmea^`d``be`bjrtqmffgeeecdjnmkhhourmjfd`^ZSLKJLPNOYfproia_b^TIEKXafhjhhkpvuroljggihfb_XLC>:8=GVfwzsld_[WQCDLZgoomhca^WMIR_e^OJQcqy{x|}tdVPYgeZRR_jiihjmh_ZOYjpeVOYchda`fgd_^_cjryvoiimnjiqwqbX]ehc]^iqwtgU[u|ukc^^`da]cqyqh_]ftp`[[\XW]]ZY]fqttsvvvtqqsrqrrtrqrqqmkgjiecdefkpswy~ВДЕГВА|sg]SNKKNSY]`ejlmnnmlllmljghgfffgkkjkhjijjmnnmnnppsuwvxy{}}|zwuuv}АБАpU;# (1Ef}ЗЛПССПТФФУФЦХЦЦХЩШЩЪЫЫЫЭЪЫЫЭЬЫЮдебезиклооо▓┤╡┤╖╖╢╕╣║╝┐├┬├┼╚╟╟╔╔╦╦══╬╧╨╬╥╒╫╪╫┘▄▄▄█▐▐▐▐▀суу▀рууфуфхффхццчфчшшщшшщщщшщъъщщщщъъыъъъыььыьыээээээюьююяяээююююяяяяЁЁЁёяюЁЁяюэыъъъщщъщшшшшчщшшчхчщшхфцр╩Цwe_dqАИОРСЦЬЯаенп▓▒┤║╛├─╞╟╔╚╚╠╨╨╠┌                    ┼╓╘╨═╔╩┬╜╣│неЯЦСРКМЛКИЙМНКИИЕГВАА~}}|БВББГЕЖЗДДЗИИККЕЗЛЗ}ronpnmowЕГАА{qe\ahxТ├ю¤Є═ЬБkmxyreURXa]OMX_WKRae^[cijhkrvq\^gkfZ]ig_Z`jkWWekdYbpla[clhZ\flcSZghe`aineaekm`^hnkfinpkfbelngafnmigotrh__fllg`]dnqfdhkjlkb\WPPQXgnleaZ^dd`_ecfhpvqlfggghhighnlihiprrmkhdb_[YVQOQSMMXforpe]]`_YMDEP\dhjjjlprromjiiihiheb\RHB>7;DSerwqjf`_[OBCLZfpokfc`\QIEU_a\NKRes{}yyzvcVTYfbWLPcmgehikg_YRZnrfVPYdhf`]ega\Y[_dlsqjehmqtsttqcT]hja]`hqwrcXYszskc^^aa_]dtxria_enmaZZZXW[[XVZclmklnqomlnllmmolmklllhgfic[UONPV\bfjpv{{|yuocZWPNNPVZ^_beefkkkkjklkiefjkhikmnnorqrsuuvuwyy{yz|А~АААВЖВББАВДГЕЕ}iH+$ $*8XvЕЛТФФТХЦХФФЦЦЧЧЪЩЪЬЬавггвгдбЯгиккзкйико│╡╖╣╜└└┴┬╞╚╔╩╩═╬╧╬╧╤╥╘╘╒╫╫╪┘┌▄▄█▄▐▀▐▐▀тттруцхфхчччфхццчцщччччшшшцчщщщчщшщшщъъъъыъыыьыььыьээээюэяюэюЁЁяЁЁёёяяяяяяяяяяЁЁяяяяЁЁЁюэьыъъъшщшчщщщшшщщшччшчццц▀╔Ш|hbfr~ИОРФЧЬаЯзп▓│╡╣╜╛┐├╟╚╚╟╚╦╬╨╧╔√                   ├╥╤╧╔├╞└╝╕┤▒ибЪШРИКЛЙДЕЛПИГДГГВАВА~}|ГГГБДЕГВЖИЙЗИКЗЗЕГ~soorpllsЕКИГ~wi_\`jzТ╚ё■ї╙г|flwyrcTN^d[MLY^TKR^`\X`gikpwxpY^eheZ\lnbX_kiVYfkcVcqm\WendU\gmeUYgle^_hodafjgbagljgfkumdaenoebfnoicmvsg__ckkhc_bordbdhkmkaZWTTW]jrneb^deeddfccgorrkeehjjlnjijlkjjourmmkie`]ZYVQQROOYforndY[`a\TGAKW`ghiklqqqokjkjihhhec_WJDB=;CPcvzpjeb^XNFJPYgnmifda[OEJW^]TKKTdryxw|~ubWU\ibVNVahedgiie^WO^preWP[gkf`^aa^ZVWX\deedfflxwwxxsd\`iib]agrvrdV]uxrja^[_ca`fvyria_eqk]Z\[XW\ZVUZbjkiillkijijkkkllijjjjijhhbUH;66;BHNR[djmmkea_\[XXXY^abbcghfikjjjmopnnmpsqqtsttvxxx{|АА~АБГГБДЖЕДГЖЗЕЕЕЖЗЙККЕwY9)!!"&1IiВЛТФХУЦШШШЩШЪЬЬабвггззйиимннлп│╢╖╕╕║╝╜╜┴├┼┼╔╩╦╩╦╧╥╒╓┘███▄▄▐▐▐▌р▀рр▀тсттутфуффхццфчччччшъшччшшщщщчщщщщщщшщъыъщыъыъщъъыъъьььыьэээьэяяяяЁЁяюЁёЁЁЁёЄёяЁЁЁЁЁЁюяяююяюююяяяээьыыыъщщччшщщчшшшччшшчцфу▌═Ь~jcep}ИПТФЧЮааз░│┤╡║╝┐┴─╚╩╠╦╔╠╬╨╧╬▄                   ┼╨╨═╚├├╛╗▓озЯЪФФНЙКККЗДЙЛЙДВБББА~~}}АБГВБГЕДЕЙЙЙЙККЖДБ~yvojproipБККЕАpaZ\`iyР─Ї■Ў╒дyakvyreYXbd[OO[_TIR``VQ^gkntyynZ[fkeY_ooa\ckhUZgkbWboi[WajbUYgmcUYffb^`god^bhha[gkkgeiolfaeopgbfnnjfksrf^_cikfcdhmpb^^bfmja\VSS[amqlfb^_ed__eecfqspkgnlkjkjghhkkilptrollmgb]ZYYXTQKQ[dlonbXX^c`\PCFR]cgiknoppmiijhikjigdbZNDDCCEPbpromif_ZVTRUZgnlhfd_XQHIW]ZOHHP`pxzxzzraSU[c`VKS_eccfhhe]XUalnbSP\gmh`^cd_[UUUY_ccdffkwvvwxshZbnmb\aitytfY`y}ukc]^__^]gvxth_^ahg^ZZ[XW[XUTXbiijjllkjjjkjjlklhggiihfcf`WD2,'(,/4:@U\`dddceaaa`__dggfgknnmlnooqqpstswwwwxxzyyz{{{}АААББАБДЖГДДИИЖЕЖИЙИКМККККЙБhJ3%!!#*=[xКУШШШЭЮЭЭЭаЮавжййло░│╡┤┤╢║╝╝╜┬┬──┼╞╞╟╩═╧╨╥╙╓╓╓╓┘▄▌▐рсссссффхфхцххуцхххццчццчшшчцшщшччъъщшщщщъъъщъщъъыыщъыьъъыььыъъыььээээьюэюээяяЁяЁёЁяюЁЁЁЁяЁёЁяЁЁЁЁЁЁэюэьэююээююээюьыъъъшшцчщщщшшшччшшццфур█╧вАhceoЙРФХЪЮбвй▒╡╡╢║╝└──╟╔╦╔╦═╬╬╧╬╔¤                  ═╔╦╩─╛└╝╣│░кбЬЦФОКЙЙЗДДЛМЖГВББАААВБА~АДЕВВЕВВЕЙЙЗЕИЙИГzxvupmprpkoЛЙБyj_ZZ_iyН╗Ё¤Ї═Шq]kyxqcWYffXLO_aTLT]]US]insx}}n]`ef`Zarqa[amfVZhm^SeqjYWgmaTZhjaVYhkd^_fhb`beea`gkmidhrlebfnofafnogbgure^aclkgdejnn`\[[cnn_XPOU[dpsle`]\bd`_eegiotrkekomiimjjkqponpupmjhgc`]\]\[WRLT]elopdYY^cc]TLFIVbfhjknppjhihgijjhefe^RIIGEHSepsmlkjd``^ZVYgmjhcb^VMHMX[WNFHRamtxwzzr`TQX]ZSMP]fecdffc]WSbrqbTP\noe]^addZROQW[^_`einuuyz|uibdlmf^ejv{tcTdz~ukb^[^b__dv}vh]\aeb][\[XVYZWU\dhjiijkiijiigiikkifhhhhgdd`XI0+%),,05?PZ]aegfcceefefhljijmonpqrsqsssuuvxxxzzyyy{{|||}~ААБББВДЕЗЗДЖИКЗИИЙИИМНННОООЛz\@.'" %1NqКХЪЭгиммйлнно░┤╡╢╡╕║╛╛┐└─╚╟╩╦═╬╧╤╥╥╙╥╘╓╫╫┘┘┘█▄▐▀стууфхцххшщщчщшчцццщчччщъшшшщщшшъъшцщъыыъъъъъыыыыыыьээъьээьььэььыыыэьююююэююяюэюяяЁяЁЁяюЁююююяяяюяяюююююээээюэььэээыьыъщщщшцччшшччччшчччхфттс▄╤зБldfqБКПСХЩЯабй▒┤╢╢║╜└┬┼╟╔╠══╦╦╦╬╧╠╪                  ╫╔╩╔┬╛╛╗╢лаЩЩЩТРМККЙЗДЕЙЛКГВББАААВББАГДГГЖДЕЛМЛЙЙЙЙКБurqslkpspjpБОРЕvia]Y]hvЙою№э┬Нh\kxxpb[]ddVMP]_RHUc_SR_lsy~}o[_fj`Yetpd_fkdVZjl]UfnfYXhp`PXhmaW^fgd_`ege_bkj_\gnmhdhnjc`fppf_fmngcdood^`folfcelqpb[XX`no`[WSV^grsle`\`ed^_efgfosqlfioollnklpqoonpsomghhee`]^]ZWSKR_hopne]YZ`d_YQKEJ^efhilpplghhhiijidde_SKJIGHTdmomjiifdhe_ZXemjfbb^ULFKV\WLFJTdouxuvwn_WQPSQLKS_gdcccee`ZXdtveSQ_oqf]\`cbZOLQX[Z\^agmx}yqcipofacjy|saTbzytja\]^`_]ev~ui^\`cc^][ZUSWXXUXbhihjjjhjkjkiijjjhhggfecb`\UJ;6217?FIPX_bdfggefiiifgklmlnnqpppqrpsttsuxwxxz|{z|А~}|~~АББВВВГЕЕЗИЗЗИЙЙККМННПРТСТУТМЕtS6,& #+CfИЪго│╢╢╣╣╣╗╝╜╜┴┴─├─┼╞╟╟╩═╬╧╤╙╙╘╓╪┘┘┘┌▄▐▐▀▀ррстсуццфхцчццшщъщчщщщшщъыъъъыыыъщщыщщъъъшъыьэьььыэьььэыьюююььээьыььэьыыыэььээээюяюээююяяяююяюююююэююююэььэьэыыыыэьэьэээьыъыыъщшцчцччччцччччччцхуус▄╤кВhehrКОТХЩЯадл░╡╖╣╗╛└┬─╞╔╦╩═╦╦╦═╧╧╞¤                 ▀┴─├╜╝╗╕┤мзвЫЩУОЛЙЙИИЖДИКЖГВБББААААААГДДЕИЙЕЖИЗЖЕЖЙКВsnownilsunrЕСОКlcZY^ftЗжьўтнd_muuoc[^fbUKQ\^RKUb_UVajr}ЕА|k[`gg^]hqmb\ckcVZik\UftgVWin`PXfk_VZgke^]dheabffa`gnmidjpka`iqoi_fpof`gtoe_afplb_dlsqa]XXanh`][Z\`hoqngc_`eeb_dfffmrrlejurmnqpknuunnptpmgfgfc__`^]WTOT^hqqnfaZX_da]VJCIUadgjmpnlgghhghffghg^VOEGGKScooihfgddlgZW^fjgfda^ULHOW[XMFKXepsvuwwn`WPNPNIKVaggbbaba]UWgwtbRO]pqh^Z]a_WPOV^^]]\`eltБЖДА|uijqpd_bj{~taUezxukb_[^b`]h}Бxj]Z`da]\\ZVTVZWVYaggiiklkkkjjiijkiffggecbb[UOJCB?ACHMVZbdedfgihhijhikklklmmoppqpoqsuuuwyyxyy}{||~~~~БВГГЖЗЖЖЗИЙМННОООПОПРСУЦШЫЫЭЮЯЭХЗgD1)##);[Аап╕└┬├──╞╟╟╟╟╚╠╬╠═╬╬╧═╤╙╓╓╪╪╪┌██▌▀▀▀рстттттуфццццфцшъъъъъыщъыыыыыыьыыыььыььыэыьэьэььэююэюююээюююююЁЁяээээьььэьыыъъыыыыыьыюээььэээююэээээьээээььэььььььыыыыыъыъьээыъщщъъшшчшчшшшчцчччцхцццутт█╧кБlggqАКОУШЪЯджн░│╢║╝╛┴┬─╞╚╩╩╦╩╦╩╦╧╤╦▐                 ч┬┬┬╝╣╣┤░егЯЩЧФРОЙЗЖЕГЗМЙБААББВА~АБВЖЖЖЖЛЙКККЙЖЕИЛБtolnkiostrsЗЬЬСДtf]\_fqВацэ╨Тr_alsslcade_SNS^^NHVb^PRaks}ЗЖzeZ^eh^ZemhaafmcU^kl\SdsjWYin`PZfg_Y_eec_]bje_bjka^fpnieiolcaiqqfahpogahtrd]`fold_dmup]ZWXammb^]`d_dnpmg`]`cd`_efdeoqqlfirtnnsvqmrvqopuqnkghif`]]^ZVPMS\fpsogc\[^cd\UIDGT[afkmonjefhgdcceehhcXNECFIQckmidcdba_[YZainjfea]UNCMZ]WMGMZdnvwvvwm`WRRROIK\imgb``aa^X[jxuaMOaopeZZ`b^XPRcmcZWY_eipxБ~|xstxvg_bl|Аt_VkВГxlb_]\^__mБИ~k_Y]ee\ZZYUTXZUSWahklijllklkkkkkkkghihfeebZOJGFEBCFKRY`eeffgfhhikkjilllllmoooprrrortuuwxwyx{}~~~~ГВВВДЖИИЙЛММЛНОРТХЩЯЯабвгггейлмн░▒окЫ{V9% &2NzЭ┤┬╞╔╠╧╬╧╧╧╨╨╥╘╘╘╘╘╘╓╘╫┘┘██▄▌▌▄▐▀▀ррттхххххчшъщщшцшъыъыыыыыыээяююЁёЁёёЁёЁЁяяяэээюююяяяяюююяюэюээьэяяэыыыыыыыыыщщъъъщъъыъъээьъыьэээьыъъььььыыыыыьыыьыъыьыыщщшыыыьыъъыщщшшшчшччччцхццччччхххут▄╨лДiegpКОТШЪадйнп▓╢║╗╗└┬─╟╟╚╚╦╔╔╔╦╬═╠┐¤                ю╗╜╜╕┤╡│нзвЬЧУСНМКЙЖЕДЕЗЙЖБА}~АВВДАБВДИИЙЙЛЕЗЗЗЗЕЖЛНБuposoklqtsrКЩЩРКzq^\_fpАШ┐╫╕Еk_ckonjdegi_QLV`[OMYb\OOaipwz~wc[`fe]Zcjka`focW`ml[TdqgVXin]Q[gh`X\fhe][affabgjf`fqog`hqlbaiqoc`iqob\ispc^`gqmc_fmto_YUW`ji`__aaaclplf_]_dhd_cfdclsskemrsppsrrqtvspqsolgfjjf_]\[YTLOQZcmrpic[V\d`ZSKHJSV]ekoqoifeeb_``aehe^VLDCFIPcnmgc___`^XUXbilheaa^TLHP[]WLGNZemrvuvvnaYUVVSKMcqujc``b_YV\lxwaPQevte[\_`]VPUkwn^UY_cdhnv|ГuxБ~k`boДЙ{`WqДГ|mb]Z\`__qКОБl][`cb_]]ZUVZWTSWagimmkkkkmmmjlllkhijjigfcYOKJGIEEGJPX_efffiggiklmmklmmpomprqrssutuxwzz|}|БВГГДЕЕЕЖЙМПРТУФХЦШЬЬЮбжймлнп░│▒┤╢╣╣╣║╜╜╕нОhE)&#(-BmЬ▓╞╦╧╙╘╙╘╒╒╒╓╪┌┘╪┘┘┘┘┘┘┌▌▄▄▌▐сстуфффхцччшъъъьыээыыьяяюяЁЁєёяёЄєёЄЄєєєЄёЄЄёЄЁёюЁюяюююююэьээьыыьэъыыэьыщъъыщщъщщшщшшшшщщщшшшъщщъыъьъъъъыъыыъъщщъъъъъыъъъыъъъшшъщъыыщшъщъщщщшшчшшчцфццчцццфццус▄╨нДjdfpЛТФШЫажкнн▒╡╕╗╝└├╞╞┼╞╞╚╞╔╔╠╧╧╦┬┘                Ї╖╜╗│нп░йгЮЪЧФФОМККЗДЕЗЖКЖА~~~АБББАБВЕЖИЙЛРЙЙКИЗЕЗМПsqmoolmottuЖЭЭУЛАxb_cir{Н╢мЛwebdhmkhdhll]PQZa\LLYc[NOchehotrc\cii^Xbhfabfo`W_ml\TdoeUXim[S]hg`Z_ehe^[agc]blkb]fmnebjrma`jspc_honb]hqoc^agoka^empkaZXXamka__deadknmf_]`bddcefeenstmhmvxplqrolsyxqpqomhhkmgc^^\VQNORT_msoidZWW^^UMIQUMNV_fnppjaa`]WVWZaba\QGCDFJQ`hkga^`a^YTSYbilfba`ZPKKT^^UJKS\emwxsvvnaZW[\UKQfz}kdaae`WV`sБzcRVn~xiZ\__[VQYuАvaTW]a`afmuxАБЖКГlbatИЛ|bZvРН~qb]Y\_`bsЛУЕl]Z]ab\ZYXTUZZVSXejmnnllmlnomlllljhjkkihfc[QMLLMKJLNSZbgighhjjllnpoopppoootuuwvxxx||~|~АВДДЗЙЛНПТФФУУЦЪЭЮбгддейммп▒╡╕╣╣╣╜┐╛╜└├─┼┼╞╟╟╞╜дАT3.'(+:^У░╟╧╒╓╓╪┌┌┌╪┘▄▄▄▄▌▌▌▌▌▐ртрстуфуфцццчшъыьююяЁЁёЄЄёЁЁёёёёёЄЄЄЄёєєЄєЄЄЄЄЄёёЁЁЁЁяюююююэьььыыыыщщшъъъщщщщчшчччцчччццццччщщшшччщъщщщъщшшшшщщшъъъщшшъщщъщщыъщъъшшчшщшщъъъщъщъщшшччччччцхццццццхццтр▄╙▒Еkgfp~КТФШЫбзйн░│╢╣╗╝┴├┬┴┐╛┐└┴╞╚╦╬╧╬╩╖■               ∙▓╝╕░ннкжаЩЦТСУПМКЛЙЖДГДГБ~{БВГДВВДЕЗИИИКИКККИЙЖЕЕ{usqpnllotvyЕЩЬУЙЕ}ieejqyЖНПДshdghmjjmnnl]NN[a[MN[b[QRce^Yalm`bimn_Z`ge_^fm`U_ll[TdlcU[lmZR]fi_X]gke[Ybgfa`gjd^emmeajoiadmsqf`iqpa]iokb_`hpkb^fluo_YY]dkg`]^__achnmicbdbddefgfbksqhgoxxpkr|uosyztqspmgjmmhc_][WOMSVY`mrokd^Z]]YPJGJPJEMWajnmi_\[XUQRW\`]VJHEDDJT`jjhb``deYWV]ehhea_]XMDJU]\TLKU_fmtwvvsjbZY_]VMUmВБlc`_`_[Zf|Й~dVYuГ|i[W]_[UQ]|И{bRV\_]^`flq|ВЙНОИldduЛСc^zРРГqa\[]a^awОЦДla^`a`\YYVRTZYWTWeoooonnlnopnkmkmjjjlmjkjf`VRPOPOQRUW^cfkjjmoqqqtwwwxyywy{{{z{{|}}ВЕИЗЗЙКМПТУХХЧЫЬабеймнн▒┤╢╢╢╗║╗║╜┬┬┬┬┼╟╚╚╔╠╦╠╠╠╧╬╧╬╟╖Уi=2)''2RБи╟╥╪┌┌█▐▀▀рссссттууттфцццчшщъщыыэюэюяЁЁЁєєєєЇїїїїЇЇїЇЇЇєЇєЄЄЄёЁёёЁюэюююэяююэээьььььъщчщъышцччщчччщшфцччцфффцххххцчччцчцчшщшшщшшччшшчччщщшчччъъщъщъщшшъшччшчшъщщъщщъщшшшчшчччччцхццццццццфт▀▌╘┤ЕlefpЛРФЧЬбзйо░┤╖║╝╝└└╜║╕╢╡╕╛├╟╔╠╧╧╠└┌               №п╢│нкмйгЯЩЧФФУПМИЙИЗДДБГВААА~|ААВВБГДЖИЙИЗЛЛМЛЙЙИЙД~xuroponlouy{ХЩПДГБunkkqyГЙЗ|rkikjonnqssj[ONWa[JM^cYJRdd[U[jnffkqq_Z`eb^_fg^]dml\Udk`W[mo\T_hh_\^difZXcie`bhj`]elkb^hplb_ktrb`ipo`_hpmdaahmmbZahmi_WWZaki_Z\^_abhmmgaaabeeefigfkrsmioz}qovБvkuББvpspjghmnie`\XTOPTTT`oupkf_]ZYVOC?AEGFEN\fnoi`ZUTSPOV[ZVOKJHFHLT`hid`^cgre]^bghhfba\UMGLV^\SJMX`fnvxuuvk`[Z]_WP[uЛГld``_]ZZmДПГeY_{ЙБk[\]^[UR_ВЛ{aRUZ^ZZZ\afr}ЖНОДlddvНРАe_}ФТГra\Y[_^`vСЩДk_[]a_\ZZWSSXZVSXenopppqopsutqpoponpqokjifaZXTVXZ]^`chmnnnostvw{}~АБВЖЖЖЙЗЕЖЗЙИЖЖЖКМЛЛНРУХШЫаеййлоо▒▓╡║╣╕╝┐┴┴├╞╟╟╞╟╩╩╩╠╠╧╨╨╤╥╙╙╘╙╓╙╙╤╧╚о~M7*'&,BpЭ╟╒▐срттффхццшщъъьььъыээьэяяяюяяёЁЁёЄЄЄєєєЇєЇїЇЄєЇєєЄЄЄЄєЁЄЄёяюээюыыьъыъъъъшчщчшшшшччцшшшчхцццфхцчхтуфуусутфуфххххцццххцшччччцччшчччччшшшцчшшщщщъъшшшшччшчщшщщшщщщъъшшшшшцхчччццццццццццттс▀╓│ИnhgqАЛРФЧЬгзло▒┤╖╗╜╝└║иЪЧЧал╡╝┬┼╩═╧═┼┤■               л│▒нйизвЭЩЧФУФСМКЙЖДББ~ААА~}АБВГВДЖЖЙЛИИКЛМЛКЙЗЖБАvrrqprsnns|АСХНБ|А|vqptzБГКСИonoppsxxviWLMV_ZJQ_cYJUabVU[ijeiorp^\`db[Zdk_[cmjZYej_U[lrZX_hj`\^ehd]Ycif^_hia^ekja`gnkdahqra]hpocaglkca`gnmc\\erh^WUX`fe`Z\^aa`fomeaefecccfjhiotqihnw|vrwБ{muЕЕwrupjfjqpib_\WSMOWYZdpxsmfa]VSTO?::?CECIVaini_VUUTRRSVXTMJNPLFLW`hgb]]_fmkgedfhhhdb^VLELX]ZRFLX_fnuxvsph_\Z]\TP^{СГkc^]\[Y\rЛЦДf[dБНВkY[]]ZUVdЗО}_RV\^\WUW[agrИЖjcdxТЧВgcАРСЕqd_Z]_\_vТЪЗm]XW]_^][WSTXYTQXhnqrstsrsvvvuusvttvvsqqpmiedcbccfhijouwy|~ГЕИЙМОПРСТТСРТУТУУТТУТТХЦШШЧЪЭагзм▒▓┤╕╣╗╜╛┴├─╞╔╩╦╦═╧╤╨╤╨╤╙╙╥╒╓╫╫╪┘┌┘┘┌┌▄▄▄┌╓┼УbB-'$)7ZТ╞┌хъыэююяяюяяяяЄЄЁЁяЁЁЁЁЁЄЄєЁЁёёЄяЁёёёЁЁЁЁяяЁяюяЁЁЁяюяяяюююьъъьщщччшччцшщшччшцццххххуххцфсфцхфххцфсууус▀сттууууфффхххухццчччццчччччцчшчшчччшшшшщщшшшшччшшшшшшшщшщщшшшшшщчцццчцццццухфхфутр▄╓╕ИpefqКРЦШЫбейо░┤╖╗╜┐╗зТКДЕКУг│╛┼╔╦╧╬╔╛т               жонкижеЯЪЩЦФРООЛЙЖЕВГДБГГААА}ААВГДЖИЗИЛЛКЛЛЛКЛЛМКБzpnnnpqpkmszБГММЙБАВА|wyzzz}ЙиаЛzoprryА|yeSKMV\UFQ_cVHVc^SQ\kmjquvo]Zceb]`ee]]die[Ydh_T[lr\V_gf^Z\che\Ycic]`gh^^dki`^fola_hrs`\gpnbagpnc`_ennbX]ckg_YW[emia\]_bbbhmmiceefeeccjjiorqljnyzuwzvowЖИytvqkgkoojfb]WRNSXTVetxsnic_YTRH;69=@@BIR_inf^SORUUTPT[]XPTURJJW`gh`ZX]gonifefgfgfa\UJJMX]XLFLY`fmrwwvuh^\Z]]QOaАТВib^[[WS_vРЧВdZfДПДhVZ[\YUWeКС{_QU\^\WSTXYajt~БwebdyПУДlgАУУЕra\W[^]atУЭИp_XX``_^^ZSV[ZRPZjptuvwxxz{{{||}|||}}|xwwwuwvy|{{}АВБВИММОРУФХЦЩЪЭЮЯгддгежидгбабЯЯааббдеийо▓╢╝╝╜┴─┼┼╚╩═╠╬╤╥╥╥╘╙╥╒╓╫┘┌▌▐▀ссурсуутуххууху╓╡БQ5+&(2MБ╛▀ыЁёЄєєЇЇЇЄЄЄёЇєЄёяяЁЁЁяяяюыэюяяюяюЁяюэюэээээьыьььъщъщыщыъщшшщчшцхххчфхцццуфтфстууфффуутсуффууууустфтр▌▀стттуустууффуфццхцччццчччцхчщччччцшчшшшшчшшшшшччшшшчшщщъшшшчччшццчцччццхффухцфуус▐╓┐КrhgoАКСХЫЮвейо░╢╕╗╜┐┤ЦЙА~}ЗХж╖┬╔╠╬╬═┼╕               екнкжгвЭЩЧЦФССОНКЖДБАААГГА}~БВЕЖДДЖЗИЛКЙЛЛЛККЖИЙБxnnnklrrlkpyАГЕЙД}{xrwxzxy{ГС┬╟дБurtu{}|waQKOY\RIT^_SHUa[OL]kkkx~{o_[bfc\_gi^\dieZ^ef]Yajg]Y_hh^QZdgb[YdjbZ\fia[dljb`fmhbajst__kqm_billea`fml`XZamf`[\aipkc\\_dbbhnojeefedeffiijorohhm}Дus|yrvГИ{vspjfhmnieb^XRNSWVXgx}wnif_ZULC;79<@DFKR]ioj^UOTWYUOYdcVTY[SMMUcif_VUX`jnjdbbcgge`ZPHGQ\^ULGNY^bktwrpnf_\Z\WPOgЕУia^]ZWW_{ФШВdZhЕРГfVXZ\XTWfЛРx]PV\\YTRTZ\[dkqsobbczУШЕplВССДq`YW[\]avХЮЖo_ZX]``_]YVW\ZUU_nu{|}~ВВВВВГДЕЖИЙЙЙЙЙКЙМОНОППСТУУХЬагдзлммнп▓▓│▓┤╡▓▒┤│┤▓░ополлккйкоп▒┤╕╝└─┼╚╔╚╩╦╬╨╥╓╪┌┌█▄▐▀▐▀рруушчъщьэюЁЁЁююяЁЁёЄЁщ╙вf>0()/Atл╫ъЁёЇїїїїєЄєёёёЁяььээььыээыщыьыыъщшщщщччъчшщшччщщщчччшъщъщшчфцхцфуттустццхутуфусууутусср▐ссууттуфтусс▀▐▀ссссусусууфффхфххфцчцхччччхчщшччхццхцшчччшчшчшшщччшччщчщшщшчшшшчччцчццццфуффхтттр▐╫┬Лsiho~МСХЫЯггйо▒╢╕╗╜╜зОГ~~|zЙЩп╝╟╦══╬╦╜▀              ╢ймкжбЮЪШХУСМНККЙЖЖВББАБВВ~|zБЕЖЖЖДЕЖЙМЛККНММЛЛКЙБwllpqnopllmvГГ~}}~vghlnqu|М└█┌┤Дyyvt{~ucQMSY\QHVdbOHXcYLM[korБГ~o^_bfb_bge`_bfcZ]el`Y_jh\Y`gfaWZcgcZWfh`[_fia]cklc_hpk`_jtsabjpm`\gold``ipn`Y\aheb]^enxn_Z\affcimmg_dffdeggjkmqwvihoyГАxqxywxГ~zvpifilojc`^[TTZZW]jy|wnhed]WMD<9:>DKPPU^imi_TNSX\]WUZ_[]a_VLKT_ig^VRSZekkgddfghe^XNHLT[]UJFNZ^blrtqolfa]\ZVPSkКУ}ia]][VUb}ЩЪБd\jИСБeWWYZVTUjНСvYNR\^WPRZcd_^cffda_czТЦЗuoЕХСВm]ZUZ]^byХЩЕm^[Y\_^^]ZTU][UUaryВЖИКММНПУТСПТУУФЦЦШШШЩШШЫЮбаббгзкйн░│┤╡╢╝╝║╗╛└┬┬├┬├┬┴┬┬└╛╝╣╣╢│▓░░оп▓│╡╕╜┼╚╬╤╘╪┘┌▄▐▀стухцчшшщъщыэяёЄЇїЎЎ°∙··°°ўЎЇїїїїёт╜zJ4*)-7bЪ╔уьюяёєєєЄЁёяюььыыъщшъшццчцсстцуууухуххцчццшчцхццхфффхцхццхфуфццтссстсуххутсрсссууфуттсрртуттссстссср▀▐▐▀▀сссттсртуфффуфффццццччччхчччччцццфхччшшшшццхшщччшшчшшшшщшчшчччццхцхххцффхххуутр▄╓┐ЛvjhqЙРЦЪЯвдйо╡╣╣╗╗╖ЧЛЕА{vwzВУз╕├╔╠══╠┬▓              ┼жккеЯЯЪЩЦФУРУНКЙЖГ}АБДБ}{ВЖЙЗЖЖЗЙЙККЛМНОММЗЙМДxnmnqooqppnqЗД|zywi^`chksГз╓щф┐Л|xrlsГ{cSNV][OLW`]MGXdYMM[imuЕЙАm^^bgc``ih^ZchcYZff`]bie[Y`fg^QWbfd[YfiaY]jm_Zdmmc_iqkdajtpaajmhaahkjd_`kpk_XZcmha]_foqjbZ[bfgbkpnidfghfiigghluwsihmwВБzu~wwАЙЕyrgbfimkfa^YQPX[Z^kz~vnjgc`\QE>:;@DNV[^alqj_TOSY^_[WV^adfbYNIPahf^UMNVcihffefhhc\XMGIU]^ULGP]_birupmjdba_ZSMTpЙО{hb^^]XXbАЬЫБe\lЛТcTTXXUTVlОРwWNUZYUTWlzoc^]_`^]YatМРЗААГРТБk^ZY\]^c{ЧЪДl]\Zaeb_\YTU\\VWd~КСЦЩЩЬЬЭЮЭбгжжиззлклкнпнмн▒┤│▒┤╡╢╖║╜┐┴┼┼╚╔╩╩╦═╬╨═╧═╧╬══╦╔┼──└╜║╗╕╣╖╣╜┬╞╔╧╥╫┌▄▀тчшыьЁЁёєєєєєЇЇЇЇЇЎў°ўўўў°°∙··∙ўўўЎЎїїЇЁц╦ЗW<-*+1L╡╪фъыьэээъыщшццчшчцхууттсус▐▐▀сс▀ррсттттуутххуфцчцфффффффуутухцусрсрсрсууутс▀тсстутссср▀▌стссртсссссс▐▄▐▌▀▀ссср▐▀ттууффхфффцтххчччхццчцччццхцччшшшшшцхчшшчшшшшщщъщшшшчцччцццхцццфффтуст▀▀▄╙╝ЛvkjsМСХЪавгйп│╕╣╗╗│ТМЙЕГ|zzАМЭ▒┐╞╚╦╧╬╟║ч             ╥икиеЫЬХЦТПОЛОИЙИЕЕВАБДДВА{ВЕИЙИЕЕИИКММНРРППЛРОЖynoppkkrtrkk|ЖДА}tlb\]cijtН╕уЇю╔САvniq~К{bXT[_[NKWa]MIZ`WLM]gioБД~l\_ced`che_]chdYZek_X^kiYY`fh_RWaieYYei`Z`hh^]dnnc\iqj_`kto_bini`]hmkc_`kpk]Y]bllc^^flukb]\aghbgnnf_eihgijgfipuvpgdjuГЙ~q~В~yАОНАxricckonfa^YPS]bXYjyyqnigeb_RB;;fЩ╩█руфхцууууууууухутсс▀▀▐р▄█┌█▌▄▄▀▀▀▀ртсрртттсуцфутуфууттсттутхфтт▀рр▀суутср▌ррсссттттсррсссрррсс▀рср▌▄▌▌▀▀рттс▀сууутууфууфхутфцччхццчцччццхцччшцччшццшщшччшшшшшщщшшчччцччччччццхххццтутр▄╥╛КwihsАМСЦЫавел░╢╣║╝╗░РКЙЕДА}{АЗЦл╝┼╔╠╨═╠┴▓             сдижвШЫЧЧФУУПОЙЙЖДБ~~АВВА}ААДИККНЛЙИЗЙКММММККЖЙКДypporooptrlkyБГwkd]Z^bgiuН┬ъЎё╨ЪВuidpЖvaUU[d[NNW_\ON\aWKN[dabp{{i_cgic[`kh[Zcha[_fe^Z_edYY`eh_UX`ecZYejbX]jj^Zenna\iphabkto``gkgabejia]_hoi\W^gsj`]^djpib\]aegdhlmf`bhhfijjlmszzpeehuЖНДs}АВАЕНМБzthbgikmfa]WRUZ`^^jy|rjgeddbOE=:?CFQ\dhkoph`VNQX\YVX]aeeedXJINYde_ULFLW`efgklmjb]UFEMX][RIIW``aituqnida_]WNLXsЛНxhb_\ZVTaЕЮЫ}d]qПУБ_QSY[XSUrСОqWOVZZWU^}ОЙrZWWXZYY]l}ДЖЕ~ИЧУБm`YW\\Y_xЦЧДj_]bmqga\WTW^]Y\oМЯ░╢║╜╜╛┴┴┴┴├╞╞╟┼╚╟╟╟╔╩═╬╠╦═╧╧╧╧╤╤╙╙╫╫╪┘▄▀ртуухццхчщщшщъъшчт▐┘╥╠╚─┬┴╚╤╫ррцщьюяЁЄЇїў°°∙ў°∙°ўїЇЇЇєєєЇєЄєєєЄЄЁЁюээъщщъщъщчс╘зvO4.*.5RЖ┤╧█тсууффтуррсрссс▀р▐▄▄▄▐▄┌┌▄█┌█▌▄██▌▐▐▀▀▀рр▀тууттууутрстусрссссс▀▀р▀сттстс▀ррсуссрсср▐▀сссррсср▀▀р▐▌▄▌▌▀▐▀ттр▐рссуууууууффхухцчхфцхццхцццццччшшщшщшччшшччщщшшшщщшшчцччшччшшчччффхццууус▌╙╝ЛwljtБНТЧЬвгем░╢╣╗╝║оОМКИИБ}}ГЗФи╣├╔╩═╧═╔╗ч            ыгзевЦЦУТРОПНЛЙИЕЕГА}ААБГБ}БДЗЙЙЛИЙЙЙКММНРПНМИДВxspnohjprpkkr~ДБuh`[W\`bguМ╛э·ї╫иВrddoГp_TV_e[LN\d[HK[cULOZc]Ycsvhaglkd_afc]]dhc[^gi^W^kgXX_ef\QV`hcUVei`Y]gh_]gmma[hqi]`kvm`agmka^dnjb[Zenh]Y_fnja[]djtjb]^ahhgkqod^ekgefllmow}yrhfhuЖОЖr|ОЙ|БТЦЗ{thcefgida]UPTXXUYi~~rideffbSF?@CEFR_gjnpng`VPU[\YWX]dffd^QIILZec]UMFGU]adehnljdZSGGQY\[PDKX^a`hsxspkc__[UOMYvТОtf`][YPPeИвЩ|b]uПП{^QSYZXTVtРЛoSMU\ZTUcАЦРoZVWX]]Z^ivББ~~ЛЩЦДrb[U\_]_wЧЫДl`atЖykcaXTZ]ZSZtТп┐┼╔╦╠═╧╨╧╬╨╥╥╤╥╥╥╤╤╥╥╥╥╓╫┘┌▄▐ртттфцчцчщэяЁЁёЄєєєЇїїЎ°°∙°ЎЄш▐╓╬╠╟╟┼╦╙┌▌▀фшъэюяЁёЄЄєєєЄЄЄёЁяЁЁяюэыыьъыъъщщччцффцтфуутсс▐╒╝ЗY;1++/@rЭ┬╓▌▌▀▀рсттрсс▀▀▀▐▌▌▄▄▄██╪╪┘┘╪╪┌█▄┌▄▌▌▐▀рррр▀▐ррррсссрсстустстсттстр▀рсррсрсс▀сттрр▀рр▀рсср▀рсср▀рр▐▌▄▐▐▀▐ртсррссссффууууфффтццчххччцхччццццччшчщщщцчшшшцшшшшчшщшшшччччшччшччхцххцццфхус▄╫╜КvkjuВПТШЫбдзн░▓╕╝╛╗нОЛЙЙЗДА|ВЙФе╕├╔╩═╧╤╠┴░            ЇагдЮЦЦФХУТТПЛИЕЕДГВБААВДББ~БДЙЛКЛЙЙЙИКОПМММММЖВ|ywtrptnlpttjjmxБГxc`WWZ^ahtМ╣э∙Ї┘йАl_`n~Аk_WW_cVMQ]c\HI\cULOZ^US]hkdeinmc\`he__eha[`ee_]agc[X_fi[RW_gcXWdk_UZhi]Zfnka]fnh^_kvo_agigc`cmmbXWdoi\V\fihaZ]agmld^^beiimomf^bgggilljkt~}rhggrГМЗw|ЛМВДУЬТ|uieefgkg_[TPWXRPYj~Бqidcef`VHAAGHJUagikpqgaXTWZ[ZZ[`egcaYKDFM[cbZTMEESZ^_bbgihbZNEEQ\^YPGLW\]_hrtnkic__[VOLZyНЛsd^ZYYURfКдЧ{e\vСРyZOQXXVSVwСКkQNVYXUTdГФМnYW]de^XZdow~БВМШХЗtdZX[]Z_yЦЩДlcfwКВna_WTZ][W^yШ╗═╥╒╫╫╪┌┌┘┘█┘██▌▀тстсуххцшъыэьюяёЄЇЇїїЇЎ°·№№№·√√∙√√·°°°°ўЇящс╫╬╬╩╔╚╔╨╓╪█▐туфушъыэьэээыъыъщшчцчцуутхссффутсссссрр▌▀▀▀▐▄┌╒╟Чf@2')*8`М┤╤┘▀▀▐▐ррср▐▌▌▌▄█┌█┌┌┌█┌┘┌┌┌┌┘┌█┌┌┌██▄▌▌▐▀▐▌▐рррррстртсттсрртттсст▀▀▐рр▀ссссссттр▀▀▀р▐ррсрррсррррр▀▌▄▐▐▐▌▀ссррсусстфууууффхфчцчххччццччццццччччшшчччшшшчшшщщшшщщчччшччшчцччшххххцфцхутт▐╓┐ЛvjkuВПТЦЫЮбзо▒╡║╝╛╗мОКИЛЛЗДАБЖУе╢└╚╦═╧╨═╞╡ч           ·ЮггЬФФФТРППОМКЗЖЕГА~БДДА}АБДЗЛКЛКЙКИКНПМПППОЖyutsqnomloqrnjkr|Г|kb[Z\_adtК│ъ°є┌з{h`cmy|f\Y\_aTLR^bXCL^bVMT_dTR[glfinqkd^_dc__agdY\fh`X_mdZX_fi]RVbgbUXfh_W\gg^]fnl^Ziqh]^jplbafkjb]dlkaXVdrk\X]eokaZ^ajnje_`cgigmqoc]ejhfimmjksyyrhffqГНИ||КЙ}ВХбЧВujfhggkmcYUR[ZTOXn||qha_ceaXJBDHJMV_fknpmg`WTVZZZZZaeea[QECHN]gcZQJBEMV[^__]ddaYNBDRZ\VMDM[\\_frvqoic^^]UNN]}ХКrd\YXWPQiНдЦw`^xТОvXPSWVTRV{СЙkPJPTVWWfЕЬРkUaoqqdWY`hqwДЙРЦСЕug[X^a^`zЪЭГl`ayМБoe^WU[^YU`|д═█ртхцщщъччщыээьэяяяЁёєєєЇЇЎў∙√√√··√··∙°∙··∙···∙°∙°·°°ўЎЇёыч▐╒╬╠╟╚╟╔═╨╙╙╓╫┌▌▐▀рстуттррсср▀▀ррр▐▐▐рур▄▐рр▀р▀▐▐▌▌▌▄┌█▄▌▄┌╘╦кtL7,+*5S~д╦╒▄▌▄▄▀▐р▐▐▌▌▌▄█▄▄┌┌┌█┌╪┘┘┘╪╓┌┘┘┘┌█┌▄▄▌▐▐▐▌р▀р▀▀▀ррсссссрссуусутт▀ррр▀▌▀▀рррттт▀р▀▀р▀стрссс▀▀▀ррр▐▄▌▀▐▌▌▐сссттусртууутухцхцчччххччцчщццццчччччшщчччшшшцшшшшшщщщччшшшчшчшцчцццчццчццфус▐╪┐МugjuВОУЦЪЯгзм▒┤╣╝╛╝оПЛЖЗИЖДААДРб╡┐╚╠╧╧╨╬╩╝п           ■ЭвЮЩФУТТПНМЛККЙЗЕБААА~АГБАБВЖЛНЛКККИКММПИКЛКМЗБvstsqnollmpsqlhm}ДАrhYZ]^cetК░щЎё╒бse`bmtua\]_a`PLU^]TJP\]UOXdeQQYbffluvob[^hc\]chc[^dda\^ec[X_fj_VX`c^VXgh^U^mjXXcmk[Yhpk]^jqka`ekid^cmn`WVdoh\X^kpmb\\`fnkb\]afhinqpc[chhfhmrnjqz{siedoАТУГ{ЖЙАРдЬДvifghghhd[TV\ZUU_n~~si`_deb\MCBKPLR^ekppof`VRU]]]ZY]de`WMDENZaed[TLCFMU\_^\_cd`XMDEV^]UMGO__]^fprokib`^]TLMaАРЙoc[XWWRRmСеФt`^{ТОuVPPWVTSW}УИiRORTWWVhЖЦОkXeЛАkZX[bfnzГЙИЖАxi\X\^]_}ЪЪВkbawМГpc_XUW]\YbВ│┌ъяЇЇЇЇЇїїЇїїїїїЎў°ў°∙°°°∙°ўЎЎў°°°°°°ЎїЎў°°Ўў°ўЎЎїЇЇЄёЄЁэшу▐╪╥╧╠╔╞┼╞╩═╧═╬╩╧╤╙╓╫┌┘┌▄█▄▌▐▀▌▌█▄▄▄┌┌█▄▌▄▌▐▐▄▄▄█▄████▄┘╪┌▄█┌╪╨╢БV:+,+3GnЫ┴╧┌▄▌▌▐▄▐▄▌▄▄▄█┌┌▄┌┘┘┌┌┘╪┘┘┘╪┌┘┘┘┘┌┌█┌█▄▌▌▄▌▌рррр▀р▀рсст▀сртссстс▀р▀▀▀▐рстрсстт▀р▀рррсссрссрсср▀▀▐▌▌▀▀▐▌▀▀рртсссттуфууфхффхцццфхцчццчхцццшшшчшщъшччшшчцчшшшщшшшччшшшшччччцхччццхфхухус▀╫┐ОxjkuГПУЧЪбезо▒┤║╝╛╝пУНЙЗЙЙЕ|АОа╡┴╔╠╬╬╨╧╦┬кў           ЪаЮЧПСУСППНЛККЙЗГААВББАГДЖЙКЙККЛККМРРЛЛЛМММЖtrssplolkhovtnhlwВГzo]^^_agtК░шєщ╩Цkb`dkooa[`fh_PIVa^QEQ`]RN[ihQP[fljpyxmb^^ba__cf`X^ee[V_id\X`ei_TVaf^SWfg`Y^hg\Wajg[Ygpg`ckoib_fnkc`fnk_UScme]\ahrmb\]_injd__bfhkosm`^cifdgnupnqwxrkffm~ТЧЖ{АЖВБМЫЪИwnlnighgc\VUZZX[doxyqhc``bc[LBCHPNR\eknplgaYSV]]ZY[`cd\PIDIXbdhd\QMEGLS\hkc\deaYNCJX[YSJGS^^\]frsnlha`^\PMOdИЩЕlb\YXVOSqУдУo^`УМrSRSTUTTW}НВgNJSWWVVhЖЬЛi[lДСЛn\X[`dglxВВВАyhYU^baa}ЮЩВkaaxЖАpb_XVX\ZYfК╡хёЇ∙·°∙∙°∙°ўўїїЇїЇЇЇїЇЇїїЇїїєєЇїїїЇЄЄяююяяэээююэюююэъщшшчу▐┌╓╨═╩╞─┐┐├╞╞╞╩╚═╬╧╥╥╓╫╫╫╪╪╫┘┌┘╪╪██┘╪╪███┌▄▌▐▄┘┘██┘┌┘╪┌╪┘┌█┌█╪╥╛Сe@-.).:ZМ╢╠╪┌┌█▌▄▌┌▄▌▌▌▌┌▄▄┌┘╪╪┘╪╪┘┘╫╫╪┘┘┘┘┌┌▄▄██▌▌▌▐▀▀▐▀▀▐▀▐ррсрррсрсссттрр▀▀▀▐ррр▀рстс▐ррср▀рссррр▀с▀р▐▐▄▄▀▀▀▐▐рр▀сссссттууууххфффччххфцчцццхццччшчцчщшччшцчччшшшшъъъччшщщчччччццччччччцццфус▐╫┐ПwjjuДОФШЬвжйо▓╡╣╝╛╝▓ФНККНМД}z|ЛЯ╡┴╔╠╬╧╨╧╦┼нї           ШЮЬЦРРТУПМККИЙЖЖЕАА~АААВЖЗИКЙЗКМККНПНЗЛМОУУЙuppqqmnonmouyrfkuАЕДwc_^^`fsЖосы█│Жdbadimj`afig^OKX_\TJPb\QN\mjPR[finyА|m`\]c`\^eg`[`db`[_dc^Z_ii_UUag`UXgh]U]ihVWagd[[gpe_`jqlc`cije]bli^TWdog]\`gljc\]agmk`[^cfhlqrn_\cmnigormlpvwslffl{ПЫЛ{ДРЙЖШЧЛynnqnigfa[UVYXW]fq{|qhc_^]^YLBDKMLR[bhmnkf`ZUW[\\YY[__VIGIR^ffhdZPLILLOZgopjfdaYOGLZ]YQIIU]]WZfpplid`^\VNHPjИТАi`ZYYXSVsФЮОo`cГФЛnQPSVVUTXСГcOOTVWVXkИХЛg^pКХОnYW\`bchms|}}vdYV^ghf~вШБlbaxОВpa\VUX\]\hЙ╣хЁєЇїЎЎїЇЇєЄЄёёёєєЄёЁЁЄЁяяюээьюяээыъщшчччшшчшчхуффус▀р▐▌▄┌╪╙╥╧╦╩╔╚─┬├─┼┬├─╞╟╔╬╧╨╤╥╒╫╓╓╓┘█┘┘┌┘╫╫╪┌┌╪╫┘┌█╪╪┘┘┘╪┘┘┌┘┌┌██┌┘╪╒╟жxJ,+&)2M{з╞╒┘┌┌██▄┌▄▄▄▄▄▄▄┌┘┘┘╪┌╪┘┘┘╪╫┘╪╪╪┘┘┘█┌▄▌▌▌▄▌▌▐▐▐▀▐с▀тсрр▀р▀срстртрр▀▀▀▐рср▀ртттрр▀▀▀▌▀рсррссусрр▀▐▄▀р▀▐▐▀▀ррссртссууууфхууфхчхфххццццфххцчшчцчшшччшчццчшшщшщшыщшшшшчшчччцшччччччццхттс▐╫╛РxkkrГНФЧЬгзйо░┤╖╗╛╝╖ЭОЛПОМВxtyИЯ┤└╔╬╬╧╧╬╦┬нЎ           нЬЪХТТУТРОМЛЙИЕДГАББВГВГЕЗЙМЛЛЛКККЛППЛМННПЧОwsqomloqmimuxsiks}ЕЗБkeb`adtДд╒▄├Сx_[`dinlfglnh]OMXa]NHSd\PN]ljPQ^kruВВn_\[bd^_dfaY_dd]Z^jeYZakj_SXci_TYfhZR[jfTU`hd[Zgof]`hmmd^bkka]bhh^X^iqg[\^fnka[_agljb^_cdgmrupaaeknmknrqopw{sgbflxКЩР|АРРГ}РШКwqutpiea]WRVYY[_hrxypgb^ZX]WJACKUQLW`elokea]WV\_]^ZY]]THIMXdkkkd\TOMLLMVclolkf_WLFOZ[XPHJW\[XZesvmhd`_[UMLRmОЩАi^YVYVOUtФЬЙj_hИЦКjOPSVXVT]АОА`LNRUVVXmМЭИg_rПЪПm[Y]`ab`ekruvrcWWakiiАдШ~h``{ИАmb\TQZZXZhИ╣уэяєєєЄєЄЁяююэыъьэьъььыщшчччццччщчуууур▀▄▀▌▐▐█▐▐▀▐▐▐▄┌██┘╫╓╥╧╠╔╟╟─┬╛╝╛╜╛└┴┼╞╞╩╧╨╨╥╘╓╒╙╒╒╫╓╓╪┘╫╫╫╪╪╫╪┌██┘╪┌┘╪╫╫╪╪╫╪┘╪╪┌┘┘╓═╕ИV2)%(-AjЪ╛╥╓┘┌▄▄█▄▄▄▄▄▄┌┌┌┘╪┘┘┌╓╪╪╪╪╪┘╓╪┘┌┌┌█┌▄▌▌▄▄▌▄▐▌▌▀▐▀▀рсс▀▐ррсрртутрр▀рр▐рср▀▀сст▀рср▐▌▀ррсср▀сср▀▀▀▐▀▀р▀▀ррррссрсртууууууутуххффхчцццххххцчччцшшшцчччшчшщщшшщщшшчшчшчшччччшчччччццццххс█╫┐РxkkuЕОФШЭвзйп▒┤╖║╛╜╗лУМОПНГxuyЛб╡┬╩╬╤╨╨═╦┬мЎ           ╜ЬЩЧУТФУРОКЛЙИЖДГ~|БГДЕЖЗЙЛОМЛНМЛЛНОМИЛООМЛАwurrpnnpolksyummqyБАtlfddhrАХ╡╞йГna``bikifkssk[OQZ^YMKW_ZKIZjdNRajlrБЖ~k_\`ea\]dea[`dc_[\fe[X_ig]V\dg^QZfjYS]ieQU_fcZ\hmcY\hqkc]bllbZalk_Y_mtg\\^dmkd]_`fni^Z^ceflrvrb_dinnnowuqqrtqighhsЗЦУГЖООГ|ЖМДvotАvhc^ZTRX[Z[`hq}ypeb^VT\XHACKTSNPX`homd`]YW[_^\[\b`WRSY^gijjc[TSVRKLS_mpljf`VMJR^]WNEKZ^[UWdppkiea^\XOMToМТ~c[WWYVORtУЩЕi_hКЧИhMMRVWUU`ЖТ^KNTVYUXoМЦЕe`tСЬПmX[dgc`]]cimolaXWcoutГеЩ~hb_|ПВla^XRW[Z[gГ╖▀шэээыщъшччччччхфхццуццтсрр▀▌▌▄▌▌┌▌█▌▄┌█┌███┌╪┘┌╪╪╪╫╒╓╓╓╘╙╙╧╬╔╟╞╞─┴╛╜╛╝╝┐┬┬┬╟╩═╬╧╥╙╙╘╥╫╓╫╒╒╪┘╫╫╪╪╪╪╫┌█┌╫╪┌┌┌┘┘╪╪┘┘┘╪╪╪╪╫╫╙─Ьe?/'',8WЙ╕═╘╪┘┘▄███┌▄█┘┌┌┌┘╪┌┌┌┘┘█┌╪╪┘╪╪╪┌█┌┘┘▄▄▄▄▄▄▐▐▌▌▐▀р▐рср▌▌ррр▀рттср▀рр▀▐рстр▀сср▀ррр▐▌▐рррсрртссрсс▀р▀р▀▐▀рсстстсрсууууутуууцхфухчцццххцхцчцшшшшшцчччшшшшшщшщшшшчщшщщщщшччцчччччцчфцчхт▀┘┬У{nmuЕОХЧЭгейо░╡╣╝╛╛╛┤ЮТПООЕ|v|Тж╣├╦╧╨╨╧═╩┬нЎ           ╬ЫЪЧФУФСРОКЙЙИЕДГААДДДЕЕЗЙМОРНМКЙКМППККМММИАyvqollmnnklnwxqosw|}|zuoifho}НШФИ|kbbcfloptwwvkZPQ\aZKHYaWIHTd^NSajhdlywhb`cea]^df`Yage]X]fbYX_ih^P[gg^PZfj\U`ieRS_hcY]fg_[`glja\ajja\ahk_W]mtg][]dnkb]^_dmh_\_ccgmswqbabiopno}|uqrsqkjklsДЬШ}УЧЗuГ}upr{xib^WTQZZZ]diowxnecaZWXTIA@GLKMNUZdhjea_XU\a^^ZZbl`W^acgkmjcZWX[XOHO\jqoie`XMKW^\VKFO]^[VUbrunhd`^]ZOMVuФХy^YVXXRMUuУЩГf^mЛШЗeOPSUWURbИНyZFIVZXTYqСЬВa^wСЭНkY]m{vd[Z]dfff_VYfrwxЕгШ}haazИk_]WSY\ZZdВ┤┌уцччфттуфуср▌▐▐▄▄▄┌▐▄▀▌▄┌┘┌┘┌┌▄▄┌███╪╓╪╪╪╙╓╓╓╫╓╫╓╫╓╓╓╓╙╨╥╨╧╬╚╚╞╞├┐╜╗╜╗╜┐┬──╚╦╬╧╧╤╥╙╨╥╙╒╒╥╓╫╪╫╫╪┘┌╫╫┘█┘╫╪╪┌┘┘┘╪┘╪╪╪┘┘┘╪╪┘╒╔лxN7+)(1Gsд╟╥╓┘╪┌┌┌┌███┌┌┌┘┘┘┌┌┘╫╪┌┘╪╪╪╪╪╪┌██┌┌▄▄▌▄▄▄▐▐▄▄▌▀▀▌▀р▐▄▌рср▀ррсс▐▀рр▐▌р▐р▀▀срр▌▀▀р▀▐▀рррсррр▀р▀рррссс▀сррстутттрсстттусууффхффццчццхххххццччшцццчщщшцшшшщшшщъщшшшщчшшчччччччччццхцчцур┘└ТzmntЖОФЩЭгжйо▒╡╣╝╛└┴╝иРООЛЙА{ВШп╜╚╠╧╨╨╧═╔├нЎ           ▐ЪЩЧФСФТСРЛЛЙИЗДВ~А|~ГЕДДЕЗЛННПНПОМЛКЛНКЛЛЛВzwsoqqnloqnlmuyxurtv|~|vnhjn{ДЛЛЗ}pgcbhopqtwwufXRU^^VMLXbYGGU^XNU`d`]bjmgacikb]`cfa\_fd_Y\c`YXahh^V]fh]QYghYU_hdUW_dcX[fk_Z^ini_]bij_Y_lk_U^mqe[Z]blj_X]_epk^\^cdhpvxqabeiopop~xrrtumkjlsДЬЫБ~ОЧЙsyА|rjp}{g^[VTR^][]chp|ymfd`[XZRHA?BHIJNRXajieb^\VY]`a``gh^[`dggikhb[X[_\UNOZhnnjf`YONXb`UIFQ[]WPR_msphb^\\[OIXxСПu[XVWWUOUwФШВg^nМХДdOQOSSQPcЗСyZLNTWWSXtРЦА_]vТЬЛjZ_vГyeXVZaccb^WZfxzЖжЦ|jaa|САj_\VRY_^YdА░╫▀рср▄▐█▄▄▄▄┘┘┘▄█████▄▐▄┌╪╫┘╒╓╓╫╫╘╫╫┘╫╓╒╫╪╓╫╫╫╫╓╫╙╒╥╥╙╙╥╨╧╬═╠╟╔╚╟─┬┐╜╜╗╝└└├├╟╦╬╬╧╤╨╥╤╤╘╒╘╙╫╫╪╫╫╫╫╪╓╫╫╪┘╪╪╪┌┌╪╪╪┌┌┘╪┘╪┘╪┘╪╒╧╖И^;+''+uЯ└╤╪▄▄┌┘┌┌┌┌┌┌┌┌┘┌┌┌┌┘┌┌█┘┘┌┌╪╒╫╪█┌┌██▌█▌▀▐▌▌▐▐▐▌▄▐▐▌▄▄▐▀▐▌▌▀▀▐▌▐рр▐▐с▀▀▀▀▀▐▀▌▐▐▐▌▐▀▌▀▀▀▀▀▐▌рр▐▀▀ссс▀▐▀рсрссс▐▀тттууууутуфхцфцхфуфхххфчцччччцччшшччшшщщшчщщъщщъщщшшшшщчччччцчччцчцхур╪├ТwlouЕНФШЯезнп┤╖║╛└┬╞╞┼╛┤зЫЩЭгн╝╞╩╦╬╧╧╧╬╧═─нЎ           ·ЩЪЦТМНМКЙЖИДГВБВАБ~}}БЖЙИКНООНРННМККЙКЛЛЛЛМВxssqonnoghnokgo{ГВ}|yuiciorwwxzxАФ─═вАnjmqnosz{wbSSX]^SEP_^RINX\TMR_cXQYaegkuzob]]cd^Z_geYV^eaXZdlkZQZei^T]dcXS^h_RV_hbX]ee`\^eoj_Zahi\Xall]Vcqnc\Z\dlj^Z`cikf__ehgfouwm`_`fmqrqzГАzwvslrАyАУШНЗКОЙ{wurjbgotkc[UTVTPT]djnsria`bb^XRKDB@BIRZ^_ahlfZOKLT[[^^]\`dgghhhhhfa^]aabZNIO\eikicZOV_^XNGES]ZNGL_nroid`\[UPTeЕЭМiZWUTUWOXwРСzb\uСФ}ZNQSVUQPpОМtVKQTUUS\xЪЪy^c|ХвЛhXauДgS[ikgaZVTYfvВЙХвСyf_cАРБl_ZTVZ\\\f}й╩╘╫╪╓╫┘┌┘╪╪╪╪╫╘╓╓╓╓╒╓╒╓╙╙╙╙╙╙╒╘╘╙╤╙╥╤╨╤╥╤╥╧╙╙╙╥╤╙╒╙╤╥╙╙╙╨╨╧╬╩╞╟╞┼┬╜╛╝╛╝╜╜└┬─╟╔╔╦═╬╨╨╨╤╤╤╥╤╘╓╓╓╓╫╪┘╓╫╪╪┘┘╪┘┘╫╪┘╪┌╪╪╪┘╫╓╪█┌╪╒╬╛УZ=0+(*9gФ╖╬╓▄▄┘┌┌┌█┌▄▄┌┌┌█┌█┘┘┘█┘╪┘╪╪╫╫┘┌█┌┌█▌▌▄▄▌▌▌▌▌▄▌▄▄▌▌▄█▄р▀▌▐▐▀▀▀▐▀▐▀▌▐рс▀▐▄▀▀▌▌▌▐▐▌▐▀▐ррррр▐▌ррр▀▀▐▐ср▐рссрсус▀▀стуууууутхцхфуцчхффххцххццчччшшшшшчшцчшшщшъшъщщщщщшшчшшччччцччшшшшчцу▀┘─УvlnwЗОХЩаейн░│╕╝┐└├╟╟╟┬╗╡▓м░╢║├╚╦═╨╨╨╨╧╧╠├лЎ           ■ЧЧУРРРОМКЗЗЕЖГА{|{|БЖЙИКМОРПФСРМККЛМОМЙИЙЙytsrqnqthinqojqxАВzsk_^adhjqrvП╡╫█нЗuknnigr}АxcVT[^[RKR__PENY\ROU][VRYahjozАpa\add^Z^ed^W]e_VXdjjZRZei]W_d_VV`h^TV_ebY[ej_VZfoh\Y`kj[Ublk]WcnpdZX^fnk_^aejoh]_gifensrlb_`fnsrowЖВwuxunsЖЙ~УдЦВЕТРБwvriegkolcXTVWURU\flpsqha`bcaXPJFEECIS]cegnkaYRNKP]^_^]^bcfgfffceeb^\`abXJEMV^egh`XSY`_UJCFX^\PJO`lsqid_Z]VPSgЖФКeWVUUXSJUwТСvd\yУТ{YJPSVUTRrСОrWOTUXUS[xЫЩw^e~ЦгЗfXas~|gVc|Гtd\WTX`ozЙУУЗteZ`АРБk`\TTY]\Yb|л╔╥╪╫╓╓╫╫╫╓╓╫╓╓╙╓╓╓╓╓╓╓╓╥╥╒╒╥╥╙╓╘╤╥╙╙╤╤╨╙╙╥╤╘╓╒╙╤╒╥╙╨╨╤╥╤╨╬╬══╚╚╟╞┬└┐└└╛┐┐╛┬├╟╞╔╩═╬╧╤╧╤╙╘╘╙╒╓╫╫╫╪╪╪╓╫╪╪┘╪╪╪╫╫╫┘┘╪╫╪╫╪╫╒╫┌┘╪╘╨╟бhH3(')1RЖн╩╒▄┌┘█┌┌█┌▌▌▄┌┌███┌███┘╪┘╪┘╪╫┘┌┌┘┌┌█▄┌▌▄█▌▌▐▐▐▄▄▄▄▌█▌▀▀▄▄▌▐р▐▐▐▐▀▌▀▀р▀▀▀▀▐▌▌▐▐▌▌▌▌▀рр▀рср▐▀▀с▀ррррр▀сс▀рсср▐▀тууффффуухцчуфччхффхцфхчччччцшшшщшшшччшшшшшцщщщщъъъщшшшчшччцчшшщшшчцур┌─ФylnwИРЦЩаеин░┤╕╝└├─╞╩╔╟├┐╛║╝└─╚╦╬╧╨╧╧╨╧╧╠┬зї            ЧЧФСННЛКЗДЕГЖДБААБГИКЙКЛННКПОНММЛЛМЛЛКСЦЗzuxspppqjjoqnhnrГАykb\[]bcdjkvИе═щу╡МxqpjaetАv`XW[^\QJTa]MEN]dRLU]aUOZeiny~mb_`dd\X_cb]Z_a^XZcjjYR]dd\X`d`WS^j_PS_da[^de_ZYfpi]Y`ii^Ydnj[Vbjha\[ahjf_]_ejpj``fkhgmsskedegntsrvАВyyxqjqЕЙГ~НаЫЖБОХЗvtribckqk`YXVYTRW[dknsrhbbdfe]QIDDFEIU_fejnmc[VSQS[^_^]^bceffedacd`]]^`_UHBESZbhf`XS[b^QGEHX^[QMPartmhc`[[VRVmНЯЕ`UUTUUSMWwРНs]^}УРxYOTVWVUUvСЛpSLTYXUS]{ЯЧv`eЦвЖfYbtЕАfTiГОГgZTQU[gs}ЖИpc^_~РГnb[TTY[[\c|й╔╤╒╓╓╫╓╫╫╫╪╫╫╙╙╘╒╒╒╘╓╓╘╨╙╒╓╥╤╙╘╘╤╙╙╤╙╨╨╥╥╤╤╙╘╘╥╥╒╒╙╤╤╥╥╤╧╨╧═╩╞┼─├└╛╝╝╛╜└┬├├─╟╩╦╩╠╬╧╤╧╨╥╙╥╤╘╙╫╫╪┘┌┘╓╫╪╪╪╫╫╪╪╓╓┘╪╪╒╓╫╪╫╒╪┘╪╫╓╘╠░yS8+)(.ArЮ├╤┌┌┘█┌███▄▄▄█┌█▄▄┌███┌┘┘╪┘╪╪┌┌┌┌┌┌█┌█▌▄▌▌▌▌▄▌█▄██▌█▌▀▌▄▌▐▐▀▐▀▐▐▀▐▀▐▀▀▐▀▀▐▌▐▐▐▐▄▌▀▀▀▀ррр▐р▀▀▀▌▀▀р▐▀рсрр▀ссс▐▀тууфххфууфцчффчцхффхчцхччччшшшшшъщшшшшшчшшшшъщщъъщшшшшччччшшчшшщшшчцур█├УymnwИПФЪажкм░┤╕╝┴┬╟╟╔╩╩╟╞╞├╚╔╔╦═╨╧╨╨╨╤╨╨╠┴зї            ЦЦУПМММКИЖЕДДГБА}ААБДИЙККНПРНССПНЛМММЛКИИКИzyxurpprmlospkmnwААtc_YZ\_cdhmzО╖▌яч╝НzqngbdsАs^YX[_ZQMW^YKDN^dNMU][TS]hnuГВzl`^addZX_ec\V^d]X[bjjXU\fh[S_c^XY_bZTT]cd[]ej_SWflg\Yakl[XemkXS`ijc[Zahlg]Z]blqk`afifgnqslbcfjnvwsxwuwuhlВНЕ{ЗЭЮКГНФКwvrhcdhmi^VVXWTUZ`inpsqhcbdcc_UFCGHEIWadglple^ZWTW_bb_]]bffec`]\agc]]_a\RD>DLW_dd_XU]a[ODDIX\YLGQbqsnib_Y[VPZuТЬВ[VUUVVSHWxПКo_aФРtTKTWVWVVwЧНnSQVZXSSbГжЩv_gЧгЗfYaq||gThЛХЙk[SOQW_gqzymbY^ПДqf]USZ\ZXa|й╞╨╒╫╘╒╒╓╓╓╓╓╓╙╙╘╒╒╘╫╫╫╒╙╘╓╓╙╨╙╥╥╨╤╤╤╨╤╤╥╙╤╤╘╓╘╥╤╥╓╙╨╤╥╥╨╨╨╧═╔╞─┼├└┐┐╜╜╝└┬┬┬├╟╩╩╔╦╠╧╤╨╨╥╙╨╥╒╫╓╫╓╫╫╪╫╫╪╪╫╓╫╪╪╪╫╪┌┘╒╫╫╫╫╓┌┘┘╪╓╪╘╜Йa=//+..)+-?fТ╗╧╙╪┌┌██┌▄▄█┘┌▌▄┌┘┌┌┌┌╪┌┘┘╫╫╪╪┘╪┘┘┌██▄█▄█▄▄▄█┘▄▄▐▄▄▄▐▐▐▐▐▐▐▌▌▐▐▄█▌▐▌▄▄▀▀▀▌▌▀▀▌▄▐▀рр▐▀рр▌▀▀▀▐▌▀▀▀▐▌▐▀▀▐▀ррррс▀сттстутуффхфхфхххццццччцччшшшшшчшшцшщъщчшшщшшщъъшъщшъщщщчччщщшшшщшчфр▄╠ЩtnuГОЦЫавин░│╢╗┐├╞╚╩╦══╬╧╧╧╧╨╨╤╤╥╥╤╥╤╥╙╬├нў            █УТРЛЛККИДГГДЕГА}АБАВЕЖИЛОРРОЛОТУСРМКЙЕЖЗДztuyywuqnppnjnsuqiknzГlYYX[__ciuК▒хїю╥еЗwcW_cnspcZafh^RLOZ^THHWbZILTYYTU]c`XWckgbcff`YYaeb[\gh_V]djaWW_daYV\b`YX]c^WU\dcUW`e]WU_idXVbohTZkthUX^ehbY[cinh^\^hpqg`_bhffmuvnenxrx~tzГГ{wvhh}СТ~ТЯУНХАuqib^^^\VTV\Z\`bcdegprf\]ffdaUJFHJHLV_eglomfa`d_UV]aa^^ada]VKFN[_`]ZXVNFDHNONU`c^Z\a]SKEJU][RFGVgruoge`[ULPgДЩСkOMSTROJEZyЗzd\lМЧЗgNT_^YWT\xЕtZOW\\VSUiАНЛjYgГЦЫ|\X`n}xaStЦЫЖh^UORWYXW\`aaZU\qАЙЙzcZV^^[YbБп─╧╘╓╙╫╒╓╒╙╓╙╓╙╙╙╙╘╙╥╓╫╓╒╒╒╘╥╙╘╒╙╤╙╘╘╨╨╤╨╙╥╙╙╘╘╥╙╥╙╥╥╥╥╙╤╨╨╧═╚╩╟╟├└┐╛╛╝╛┐┐└╛┴─╟╚╔═╬╨╧╧╥╥╤╤╥╘╒╓╓╓╫╫╓╓╓╫╒╒╓╫╫╒╫╫╓╪╓╓┘┘╫╓╫╪┘┘╓╓╓╓╘╩аmH2-+,8VВ░╩╙╓┘╪┘┌┌▄▄┌┌┌▄▄█┘█┌██┌┌┌╪╪╪╪╪╪╫╪┘┘┘█▄▄▄▄▄▄▄▄┌▌▐▐█▄▌▌▐▐▐▌▄▌█▄▀▐▌▄▌▐▌▄▌▐▀▐▌▌▀▀▐▌▀▀ррр▀с▀▌▌▀▀▌▄▐▀р▐▐р▀▀▐р▀рсрсррссттутууффххффуфххххччччцшшшшшшчшчшщщччшщщшщъъъщщщшщщщщшшшщшщшщщшчфс▐╬ЬАwquГНХЪадимп▓╢╗╛┴┼╟╔╦╬╬╧╧╨╧╧╨╨╥╤╤╤╤╤╧╥╙╬┬о№            ъУТРМЛКЙЙЖБГДЕДААБГЕГДДЖЗЙМООРПТФСПОЛЛКИЙЛКzuxxwuuokpsmjmrtqmilvАВwi`\]^_cdsИнуєэ╫кИtbY^binldbhje]RNR\]SHKWbYFGR[YOQ\^ZVW_hhhhihaX[dfa]_ff\V[hkcWY`c^XW^c_WS_k^UU^ebUV`f^TT_kaWWepgU[nqdSW^dfbYWdgle_[^hlqg]\ajfhlssnkr}ztyГЗy{ГД~wtefzПФБ{ЛЬУГБИОБwqhb_`^ZUTX\\^aabcehsqf]]`eebUHFIKILS]agjonf`bd_UZ_cda`ba_XOEFQZ``\YYRIDISWURX^c`ZZ_]UKJMU\XLDJWfrrmhb^YSKQjИЫПgMNSSSSPL]yЖya[oПЧЖdNWb_ZWU[s{jVLS]ZVTVgГТГf^d|ТТtZW^p|ub]yЦЪДh^TSTVSPV[^a^ZTYnzВВw`ZY\^^\cЕ░┼╨╓╓╓╓╒╒╘╘╘╒╒╘╙╥╥╘╥╒╒╓╒╙╒╘╙╥╙╓╓╘╤╙╘╘╨╧╨╨╙╤╥╙╙╘╤╙╘╘╥╙╘╙╒╥╤╤╧╠╚╟┼─┴┴└┐╛╗╜└┐└└─╟╟╩╦╬╧╤╧╨╥╤╤╨╙╘╘╓╓╓╫╪╓╓╓╒╒╘╘╓╫╒╒╓╓╫╘╘╫╫╫╓╪╫╪┘╪╓╓╓╓╬▒~V;0**2Cpа─╨╒╪╪╪╪┌▄▄┌┘┌██┘┘┌▄▄█┌┌┌┘╪┘┘┘╪╪┘╪╪┘┘┘┌▄█▄▄▄┌┌▄▄▌▄▄▌▄▐▌▌▌▀▐▄▐▀р▄█▐▌▄█▌р▀▌▄▄▐▀▌▌▀▐рр▀рс▐▄▌▌▌▌▄▌▐р▀▀▀▀рррррсрсрсстттутутфффхххххцхххчццчцчччшшшщщшшъшщчщщшшъъщъщшщщщшъщщщщъъъщщщшхут▐╬ЫГtmtГНФЪаджн▒┤╢║╛┬┼┼╔╩═╬╨╧╤╨╧╨╥╥╤╥╥╙╙╨╤╤═├н№            єУУПЛЙЙЙИЙДЕЕЕЕААВГДГДЕЖЗКМНОННТХФУРЛКЙЖМОИywxyxuvsnorqnlpvtpllwДД}se\[\_aepГеуєь╫йЖn_Z^cjnkdhnpj[OLV_]SHKYcVFJQUUOS[]XRT^gginpkaX[cfaY^ik]W]gkcVV^daUW]a_YW]d]WW`hbTX`a]VU_i_UYhpfRZkpdSXafibXZchmf]Y^fmmga^`lmilrukeqЖБxzЖОv{ЖЛБutcevЗОДyЖЪЧЖ|ВОГzqha\]YWSTY]Z]bbdegnsqf]]_bd_RFFILSPOW^dinnf`afcVV^accaba\UJEJVce`ZWVLFELU[VOU^c_YY]]ZSOS[]VKBHVfrsngbZVRKRnНЬКcMPUTSRJG[xЕta]tСЦГbO[gd\XU[oxfTMU]ZXTUfВО|aV`rААlZX^l{t[VwЧЩГg^PNTZXNRZaa^WQYjxАt`YW__]YfЙ▓┼╨╓╫╘╒╙╙╥╥╙╙╒╙╙╙╙╒╘╒╓╓╘╘╒╘╙╥╥╓╓╙╨╥╒╒╤╧╤╥╘╥╙╙╙╘╤╘╙╙╤╤╥╥╘╤╤╨╧═╩╚╞┼├┬┬└└╝╗╜└└╛├╞╟╩╦╬╧╨╬╨╥╥╙╥╘╘╒╘╒╓╓╫╓╒╘╒╘╙╘╫╒╓╓╫╫╓╒╓╫╫╪╪╪╫╫╪╪╫╫╫╪╨╛Пf@4/*+:^С╣╠╙╓╪╪╪┘▄▄┌┘┌█▄┌█▄▄▄█┌┌┌┌╪╫┘╪╓╓╪╪╪╪┌┌▄█┌┌▄▌█┌▄▄▐▌▄▄▄▌▄▄▐▌▌█▐рр▐▐▐▐▌▄▌▐р▄┌▌▐▐▌▌▌▌▀▀▐▀р▐▌▐▐▌▄▄▐▐рр▀р▀р▀рррррсрттууфуттуффухфхффччцццччччшччччшщщчшъщщчщшшщшщщщшшшшъщъщщщшщшщщщщшцус▐╬аБrovГНФЫвдйо▒┤╢╗┐├┼╟╩╠╬╧╨╤╤╨╤╤╤╥╤╤╤╥╥╨╤╨═┬н№            ·УТПОЙИЖДЗГЕДДЕВБББВГДЕЕЖКППРРССУРППКМЛЖКЛЗxxxyxuvupoqpmnouyumlt|ЕБ{m_]]_afpВв▀ьц╧аАj_]`dklklqtskZQNW`]QHNZbTEIQYTOUZZURUaginsrlaX[bc_Z^gi^W[in_TX`c_XU[a`WS^g]SW`ibUV_e`UTbk^U[iofOXiobQWbgibY[egkg_Y\dmrh`_`ijjmrqlioГЕА|БКy|ЕНЕxrcfuВМЗ~БХЫМ{{ОИ|rh`]]ZXTTXZZ\__cdgnupf\[[^`\OFFHLSRQRY^fole_agdWW]baa[_a\UNHP]de`[WQFCFQUYTQW_`_YZ_`cb\W[\UKDIXirsngbXUSKUsРЮЗ_MTWTTRLJ[uВr\]uРФ^O_lg]WVYjmaPHU\ZYWUgГКu`Yarzh[WZjxp\]{ЧЩgZPSTWTM[hfeaZTXetБt_XU^`_]gЙ│╞╤╒╘╘╫╓╫╘╙╒╓╒╘╒╒╒╒╘╫╓╓╒╙╘╒╘╥╙╫╫╘╤╥╒╙╥╨╤╥╙╤╥╥╥╘╥╙╥╙╤╥╓╓╘╙╥╤╨╧╔╟─╞├┬┴┐╛║║╝└└└├╟╟╩╦╬╧╨═╧╥╥╤╨╘╒╘╘╘╒╓╫╒╒╘╒╘╙╙╒╓╒╒╘╒╓╒╒╓╓╓╪╪╪╪╪╪╪╪╫┘╒╔вvF60,(1QГй┼╥╒╪┘╫╪┌▄█┌┌▄▄┌┘┌┌█┌┌┌┌┘╫╫╪╪╓┘╪╪┘┘┌┌┌┌┘┌▄▄┌┌▌▌▌▌▌█▄▌▄▌▐▀▌▌▌▀▀▌▌▐▐▐▌▐▌▐▄▄▌▐▐▌▌▀▐▐▌▀▀▀▄▌▌▌▌▄▐▐▐рр▀▀▀▀▀рррр▀срстууутсуууфффххххччцхччччцщчшчччшшчшщщщщщщъъщъщщшшшчщщъщъъъщъъъъъшчхт▐╬ЮВrlwГОХЫвдйп▓┤╖╝╛├─╟╩╦╬╧╤╤╤╨╤╥╤╙╥╥╥╥╥╨╥╨═┬м№            ■ФТПОЛЙЙЗИЖДДЕГАВАВВВЕЗЖДКОРРСЦФЦУССЙКККМОЕuvsttuvunmoppoou{xpmrxБГАsgb_acgqБб┌ы▐┬Цwe]\^dkptxzxwlZOPX^[QKP]cSFIPTQOT[ZTORcjiozxmb[]be`Y]ij]W]hk]SW_gbVTX^_ZX^c_VT]kcTW`d_WYdjbVYkucOYhl`SVagib[\chng^Y[bllf`]^ijjlrulel}Б}zАЗ||ЗПКzqbepГСЛy~УЬР||ЙКrhc[]]ZUTSQSV]`cdgotnc]ZY]b\OFEFJIKLOTZajjc_afdUU_edb_^_b]SSZaggb[TLBAMU[^XQV\^^Y[_efd_\a]RFCIYjrpjc]VTOMYxУЮВYLSVVURIHZpwm^^wТХ}ZOdph\VQTbh[NJW[ZXVVgЕr\W_vВАkZUWgunUV|ШЧfZRPU[VRdБ~oeXRYan{~rbVU]`\ZdЙ┤╚╤╓╘╥╘╘╓╙╥╙╘╓╒╒╘╒╒╘╓╓╓╘╥╙╓╥╤╙╓╓╙╨╒╓╒╥╥╤╥╙╥╙╙╙╙╨╘╘╘╥╥╥╥╘╥╥╥╤╧╦╩╟╞┼├┬┴╛║╝╜└└╛├─╟╟╩═╧╧╧╨╤╙╘╤╘╫╓╘╒╓╓╓╓╓╒╒╘╙╙╓╘╘╒╒╓╓╒╒╪╪╪╓╫╪╪╪╪┘┌┘┘╓╨╣ЖR<1/+/CqЭ└═╒╪┘╫┘▄┌┌┌█┌▄┌┌▄▄▄┌█┌┌┌╫╪╪╪╘╫╫╫╪╫┘┘█┌┌█▄▄█▄▌▌▌▌▌▄┌██▌▐▀▌█▌▀▐▌▐▀▐▌▌▐▀▀▌▌▐▌▌█▄▀▐▌▌▌▌▐▌▌▐▐▌▌▄▐▐▀▀▐▀▀▀▀с▀▀▀▀рсстттфустууфффхчццчцчццччшчшшчшшчшшчшщщъшщщъщщщъщшшшшщъщщъъъъщъщщщщчхт▄╠ЫГtoxВОЦЬвдйн░│╖╝└──╟╦╬╬╧╥╤╥╨╤╥╤╥╥╥╤╤╥╤╥╨╩┐и√             ФФРМЙЗЖВЖГВДДЕВЕДЗДДЕЙКЕЙПУРНСПСПРСНЛЛКЙЙГzzuuttutqhlqrplv}{tprx|ГzoiddagpБЭ╙╘╔оЙna^`chqvzАБzxk[SSZ_[OJR^eQDHSZRMR[XTQUckjwДВobZ\ba^Z`hg]V\hm]RX_c^WRV\]VU`f^ST]f_SVag`VXelbUYltbPZhm`RXbhibXXafji`XZajoh_]`flpnqrmhj{ГАyБМГ~ЕТПБqbbnНН|{ОЭХ|uИПГtkc][YVVVVOOSZ_cdflrob][\]\[QFDDCFHIKPVajic``baVS_gfda_ji`VY]`ggbWMHBCNZ\^ZTTY_\X\eike\[^ZNDAK[gqpje^TSNO^~ЦЮАSLRWWSQKJZqyjY_}ХХ{XQjsh[TNQV\UMN]c^WUWf{Аo`X_wЖiXRWcmi[]}ШЦ}hZSSUUSSmКПБm[QTYbszq`SU_c]XeМ│╟╤╘╙╥╒╓╘╥╥╓╓╒╘╒╘╘╙╙╓╓╓╘╘╒╒╘╤╙╓╓╙╤╙╓╘╙╥╥╤╤╨╥╤╤╨╨╘╘╘╥╙╘╓╒╥╤╨╨╬╦╩╟┼┼├┴┐╛╗╜╛┬└┐┴╟╚╦╠╧╧╧╬╨╨╙╙╨╘╒╓╘╙╘╒╫╒╒╓╓╘╙╘╒╒╘╒╒╓╫╒╓╫╪╪╫╪╪╪┘┘┌┌╪╪╫╘─Т]D3.*-<\С╖╩╘╪┘┘┌┌┘┘┌▄▄▄┌┌██▄┌┌┌┌┌┘┘╪┌╓╪╪╪╪╫╪┘┌┘┘█┘▄▄▄┌█▄█▄▄▄▄▄▌▌▐▌▐▀▀▌▄▄▐▐▐▌▐▐▀▐▐▐▐▐▌▌▀▐▐▌▌▌▌▄▌▌▌▌▌▌▐▀р▀▀▀▀р▀▀рр▀▀ррутттутссуууфххфффчцфцчццчччцччшшшшшшъщъщщъщъшщщщшшшщшъшъъщъъъщщъщщчфс▄╠ЬГsnxВРЧЭвжйм░╡╣╜└├─╟╩═╬╧╨╨╥╥╥╥╥╙╥╥╙╙╙╥╥╨╩╛з√             ХФРНККИДВВВДЖЕБВБГВДЗККЕЙОУУРУРУТРПНЛКИЖГ|rvstututpmnqqnlsАwrtv||~}yqhgcfqАХ╛╚░Уzg`_`dmwАГЙД{wiZSX_`ZNJR_cMFLPUQORZXSPVejl~ПНr`Y[bd\T]ff[U\fh]TW_f`VSX^_YU[c]UT]f^RWcf_VUgoaSZmq]T[ff^W[djhbZ]egkh`Y[bjlia^_gopoqrkglyВБ|ВМЖБЗСТЖqabk}МНА|ИФУАqДТЗtjbZYWVYXUPOV\^bbbgola[[Z\YVNIECACHOOPWbjhb^_a\TU_inog^cb\[^_cgg^QLGBKU[^_ZRS[^[X^dgdZVZ^XNCCNZhrqha]QQNPbВШЩ|RKSWVRMJI[lod[cБЦУyTSotg\UNPXXQKQ_d\UTXg{l[V^rxfXSVaqhPZ~ЩХ}g[TSVYVSpПХЙt^TQV^elm_UY^^WWgН▓╞╤╥╤╙╓╓╙╥╙╫╫╙╙╘╒╒╙╙╓╫╘╘╘╓╒╘╤╘╘╘╥╙╘╒╘╙╥╥╙╙╤╙╥╥╙╥╘╘╙╤╥╙╥╥╤╨╤╨═╩╩╟╟├┴┴└└╝╗╝┐└╛├╞╟╟╦╬╧╧╧╨╤╙╥╤╓╫╒╙╘╘╒╓╒╓╒╓╘╙╘╙╒╘╘╫╫╪╓╓╓╫╓╫╪╫╫╪╪┌┌┘╫╫╒╔вnJ5/)+4NАм╞╥╪╪╓┌┌┌╪╪┌┌▄┌┌██▄┌█┌┌┌┌┌┌┘╓╪╪╪╫╓╫╪┘┘┘███▄█┌┌▄█▄┌┌┌█▌▐▐▌▐р▀▐▄▌р▀▌▌▐▌▀▐▐▐▐▐▌▐▄▌▌▌▌▄▌▌▌▐▌▐▐▀▀рр▐▐ррррсср▐▀рссссуутсууфуфццффцччфхчццчшшшшчщшшшшщчшщщъъщшшщъъшшшшщшшъщшщъъъшъщщчфу▌═бВtpxГРШЯвжйк░┤╕╜┬├┼╔╦╬╬╬╤╤╤╥╥╥╤╥╤╥╙╙╤╤╨╧╚╛з√             зТПМЕДДГГВВДЖДДЕЕЕЖИЛОМДИОРПНПНССРРНЙЙЖГ}wswsstssurkkprnls{ДБzzyxwux|wkidhp}МЧЭОЖqd`aeht}ИОИА{ugZY\_bXLKUbbMGOY[PNT[XSRVdklЕЦЛr`Z]baZV[ebYTYdf[VX]b_XRYb_YW]`\UV_hbSVej_PUjn`TZjn\S]il_UZchi`SWbgjg^WZbjni_[_hqtpppnbeyЗЖz~МЗ}ДЧЪЛta`gxНФАtЗШЦАpДРЙwjd[YWVZZVRVY`cebdjpla]\\\ZVNIGGECITWUSakg`][ZYSVainso\UX[`dabff\PJFEPZ^`^[RQ[^ZVYa]VRUX[SLCDQ_iqqja]USNQgЕЩХuONW[WQLIJZmqaYgВЦТwRVptg[UQQ[^TKRej_ZUZi||j[W`r}vcYTXajcV]ВЩФzcWSRSUSStРЦЛv_RQV\bdg`WX^_YUfН▒╞╤╙╥╙╫╓╘╙╘╫╫╒╒╘╒╒╥╥╒╒╒╥╘╙╫╘╥╒╓╙╙╘╒╒╙╥╥╥╤╤╤╤╥╙╤╙╒╓╥╥╙╘╙╥╤╥╤╤╬╠╦╚┼├┬└┐┐╛╗╝┬╛└├╟╚╩╦═╬╧╬╤╤╤╥╤╘╒╒╙╙╘╒╓╒╓╒╓╒╙╥╙╘╘╒╓╫╪╫╫╪╪╓╒╫┘╪╪┘┌┌┌┘╪╓═▒~W5-**.>nЮ╛╧╓┘╪┌┌┌┘┌┘┌▄┌▄▌▌█┌┌┘┌┌██┌┘╪╪╪╪╪╫╫╪┘┘╪┌┘█┌▄▄▄▄█▌▌▄▄█▌▐▐▄▌▀▐▌█▌р▀▌▄▌▐▌▄▌▀▀▐▌▌▐▌▌▌▌▄▌▌▌▐▐▐▐▐▐▀▀▐р▐р▀▀рсс▐▀рсттуфутуфффууфффхцччххчццчцщшшщщшшчшщшъщъъъщщщъъщшшшшшчшщшшъыыъщщщщчху▌╬бГqqxГРШЯвжйо░┤╣╜┬─╞╔═╬╧╬╤╨╤╨╤╥╤╥╤╙╙╘╙╤╥╬╩╜е√             ╜ТОЛЗЕЕЖЗДДДЕГГДДЖЖЙЛОЛДЗМРСПТТФСНННЛКЙВ|uqssstrpruihlpnmpxБА{yqimpw|wmjkr{ГЛМЙАsgcaflwВВ~~vcXWZ_^WLLVcaKIUa]OOT[[UPVeehtБ~nb]_dd]V]hdYU[bdXUY`c_RPZbbZV]c\TS`jdVYdh_TZgk^QYhoZR\fh^VXagf^VW`gkh]VW`hkg_Y^grwvspjcevКЛ~ИКЕЕФЫРvc`gtЙХЕtГШЪВrПЛ{la[[YZZZTT[]dehfcgqk`[\\[YUMJGGDBIY]\Z`lg`XVRMKQajie`XX[^accfgg]PJFGS[__]UJNZ]ZWY^[TPSY[QFBFVcmrpfa]WSOWkИЩТpMPY\VRNIJZff\TeЖЧРrRYrug[VT\bdXNUgb\ZW\kБ}jYUas}wcYUVajcO]ВЩУyaWQPSVUUuТЦМv_WRVY]`a\UX]]YVgН▓╚╥╘╙╘╫╒╙╥╙╫╓╙╙╒╒╒╙╘╓╫╘╥╙╙╓╙╥╘╘╘╙╙╘╘╥╤╥╘╥╥╥╙╘╓╥╥╓╫╙╥╥╒╒╥╤╥╨╨╬╠╩╔╚──┴┴┐┐┐┐┐╛┐├╞╚╔╩═╬╬╬╤╥╥╙╥╘╘╘╘╙╙╒╒╒╓╓╓╓╘╘╘╒╘╓╫╫╒╓╫╫╪╓╒╫┘╪╪╪┘┌┘╪┘╪╤╛ПcB0)*.7YФ│╠╒╓╫┌┌┌┘┌┌▄▄┌┌▄▄▄█▄███┌┌┘┌╒╫╫╫╫╓╫╫╪╪┘███┌▄▄▄┌┌▄█▌▄▌█▄▌▄▌▀▐▄▄▐▐▀▌▌▐▐▌█▄▐▐▐▄▐▄▄█▌▌▌▌▌▐▀▀▐▌▐▀▀▐▐▐▌▀▀▀сср▀▀рсттууфтутфутфхфффхчцфхцчццчшшчшчшщчшщщщщщъъщщъъъшшщщщщшшъшшъъыъшшшшцфу▌╨гДusxГПЧЭвдкп░┤║╜└─╟╦═╬╧╨╥╤╥╥╥╤╨╤╨╙╙╥╤╨╥╧╩╜е√             ╬СОКДДГВБАБВЕЖЕЕЗИИЗКПМЖЙМПННСУФУОНМЙЛОЕ{tuxtsqrponikmoonnrДАxnha`elr{vortzГЙМЛЕ~thcfpyxts{БАwbVX[`_TIJWc_IL[d_OKT\YTQV`bdehlifcegaZW^ddZW^efXV\_a_TRZc`ZV_d\ST^icSYgj^MVhk]QXho[R[eh]SW_gi^NS`gjfZSV^hkfb^_fqxwspkadvМН}}ЙОЖЕСХОvb_esЗЦЖvГЦЪЖy~ЖЖyl`ZYWVZ[VU\`efeefjph^Z[[\\VLEFGBBKZ`__gnj^WRPKJN]jld^ZZ\^abeehg`SMJNX^__YPINY^[Z^b^OMW]XOEBIWemsof`\VSOWpЛШОiKT`_XSPJJZffYTiЛЧНoR\qsf[WXepjYO[rybXW_rДk_[dxБzcXUW`fcV`ЕЩТyeWTNQRQUyСШНv`WVZ]__^^TV]_\ViП│╟╤╘╙╓╓╘╥╙╘╫╫╓╓╓╓╓╘╓╒╓╙╤╙╘╫╙╙╒╫╒╙╘╘╙╙╤╙╒╓╥╤╥╙╘╥╙╒╓╙╙╙╒╒╙╥╙╥╨╬╦╔╔╟─├├┴┐╜┴┬└╛┐┼─╞╚╠╬╧╬╧╤╥╥╥╤╙╙╘╙╙╘╒╘╘╒╒╓╫╙╥╙╒╒╓╓╪╪╫╪╪╫╒╓╪╪╪┘╪┌┌┌┘┌┘╙╔мwI8**,4MВи╟╘╓┘┌███┌┌▄▄┌┌▄█┌┘█┌█┌┌┌██┘┘╪┘╫╓╪╪╪╪╪┌█┌╪┌▄┌┌┌▄▌▌▌▌▌▌▌█▌▀▌▄▄▌▄▌▄█▌▌▌█▄▐▐▐▌▐▐▄▌▐▐▌▌▌▌▐▐▌▄▀▀▀▀▀р▀▀▀рррр▐ссрссттусттфутфцхфххччффхччцчъщшцчшъшъъъыщъъъщшшщщшшщъъшъшщщщъъъщщщщшцфу▌╤еДrqwВПЦЬвжмо░┤╕╗┐┬┼╚╦╧╧╤╤╥╤╤╥╨╤╥╤╥╙╙╤╥╙╧╩╜з√             ▌ТПЛИЖДВБААГДЗЖЖЗЗЖИЛММЙИЛТУРТПОПОММЙИЛЕ|srtsqpqqqsnlnoqppozГВseaZY]cipyxxxzВЖОаеУ}kejpplknyЕВw`TW^f_TKKWaZGL]f_NNR[YRQX`_ZZ^bgegjmgYS`icXW^edYTYbc`WUYa`WP`dZRT`kcS[ee^QUik]QZglYV]bd]RV`if^ST^dfe\TX^fhf`\_bp{yspibfxМС|yЛУДzЖХПtc_cpБТИyРЪИxz~}vm`[YX[[\WZ\addddafjg_\\\^\VLIJJFCMYbaagok^XUQOLS\ejh_\]__adfhji`UOPV\_a`ZLDM[^ZYbgdXQW[VMEAJXcmroe^[VROXsМЦИcRZdeZQMJLY`_URmПШКjP^pnd\Y[m}p[Qb{|eZWcxЙЕj[YkБ|dYTV_faPaЕЧОvdXRPSXVW{УШМu_Y^```_]ZRV^a`^lС▒╞╨╙╙╓╓╘╥╤╘╒╫╒╫╓╓╘╘╓╓╒╘╥╘╘╘╥╤╒╓╒╙╒╓╒╘╙╘╓╓╙╥╙╘╘╙╒╒╘╙╒╓╙╓╙╥╙╥╨═╦╔╩╟╞─├├┐╛└└└└└┼─╚╚╩╬╬╬╬╥╥╙╥╥╘╘╙╙╘╒╘╘╘╓╒╓╓╘╙╘╫╓╓╫╫╫╫╪╪╫╒╓┘┌┌┘┘┌┌╫╪┌┌╒╧╣ЙW:++,.BoЪ╛╬╓┘┘┘┌┌┌┘┌┌┌█▌▌▄┌▄▄█┌┌██┌╓╫┘┘╫╓╪╪╪╫╫╪▄▄┘┌██┌┌▄▄█┌▄▌▌▌┌█▐▐▄▄▐▌▐▌▄▌▌▌▄▌▐▌▐▄▐▄▄▄▐▀▄▌▌▌▐▐▀▌ррр▀▐▐▌▐▐▀ррр▀рсррсууутффхусуххффцфцххцччцчщшччшщъшшъыъшщчшчшшшщшщыыъщъшщшщъщъщщщшшчху▌╨еДtquВНЧЬадмо▓┤╖║╛┬┼╚╠╬╨╤╤╥╥╤╥╥╥╥╤╙╙╙╤╥╙╨╩╜и√             шТПЛЖДГГБАВДЕИИЗИЙИКМПОКЖЙНННППССПЛМЙКСИ{tqsusonnppqmknqqlmt}xh_YXZ^cgmssrx~Лн╛╣вЖnckusgdlyЖБq\TY]a^QJOZ_WHM_i_OQW_[USY`^WT[bfhnrrh[X`f_WT\d`XV]ad_US[`_XV^aXSU_kbQ[hh[MWhj[RZehZT[fg]PV_jh]PV^fif]V[`jkf_\bbpy{wtl^dwЗЙ}yКУГyООrb_bk}ЙЕ}~ГИИxtxyuk_]ZWY\\[\aaccdcchje_]]^_]WLIKPJGNZ`_ciok^ZZXTRS\flkb]^`abddfii`TRU[`__[VKEN[_XWetl_]_\TJECLYckpne_YTPO\wКРГ]N]jg[RNJKW_]QRpРЧИeN^mkaYW\pypZSd{b[Xb{ОЖj`^qМФАgZSU]a]VcЕЦМq`XSPSUUZХЪМs_X`tre][WOU^d^YmТ│╞╨╤╥╒╓╒╙╘╘╘╒╓╘╒╒╘╥╓╒╒╘╘╙╘╘╙╙╓╫╒╙╘╒╘╘╘╘╒╘╤╥╙╙╙╨╒╒╓╙╓╫╓╒╘╙╥╙╤╠╦╩╚╟─┼├┬╛╜└└└└┬┼╞╟╚╠═╧═╬╨╤╤╨╤╙╘╙╙╘╓╒╒╘╒╒╓╓╒╒╒╫╫╫╓╫╫╫┘┘╫╒╒╪┌┌┘┘┘┘╪┌┌┌╫╘├ФcC.(*,7YМ┤╦╙╪╫╪┘┘┌┌██┘▄█▄█┌▄▄▄┌┌▌▄┌╪┘╪┘╪╫╫╪╫╫╪┘┌┌╪██▄█┌▌▌▌▄▄▌▌▄█▄▐▐▌▄▄█▄▄▄▌▌▌▄▐р▀▌▄▐▐▀▌▌▀▐▌▄▌▌▐▌▌рср▀▌▐▐▀▐▐▀рр▀ррсссууутффцууухфххццчххццчцшщшшчшшщшшъыыъыщщшшшшъшъъъъщъшшъъъщыъъъщшчху▌╨кИrqrНЦЭвжко│┤╖╗╛└┼╟╩╬╤╤╤╤╨╨╥╥╘╙╙╙╙╙╙╙╙╥╦╛и√             ЇССМЖДВГВВГГГИИЙКИЗККОМКИЙСУСРРРТТННКККЕ|rqttsooqqqpnmmqqlkqz|yoaZVUX[acgknxЖв╟╓═┤Пocoypc`kxАzjXSY`c^TMR]aXIRdlbPWhf_WU]g^QRZehlvxvi[U`e]ST\dcXT[ae`UT\e`VTbdXPT`i_U^gf\R[ghYRYddWV]ce^RU`if^UV]fih^U[agli_\bapz}ytkahtИОГzИУЕx~ЗКqd_biwНН}vЛКxqsvriXXWVZ\\Z^`bccbbaghd^^^``_UMJJOKJR[bbchnh^Z[]ZWVZemjb__bcdgffhg`WUW]`a^ZPECO]^[Wbspeaa[TG?CO\flpmc]WTQP^yПУ|\Tbmj[OLILTYVMSsРШДaO_mi_WV\jukYSf~vbYXf}ОДi[]uСШЖf[TT[bYNeЖХКo\VSRTXUZБЧЫЛr^^ftwk]ZUPU]da_nХ┤╚╤╤╥╓╓╓╙╙╙╥╒╘╒╓╓╓╘╓╓╒╘╘╘╘╘╘╘╒╒╘╥╘╓╒╘╘╘╘╒╘╥╙╘╙╥╒╓╫╓╒╓╫╘╥╥╥╤╨╬╠╦╩╟╞─├─└┐┐└┐╜┴┼╞╟╚╦═╧╧╨╤╤╥╤╥╥╘╙╥╘╓╒╘╓╓╫╓╓╫╓╒╓╓╓╫╫╫╫╪┘╪╘╓┘┘┘╪╪┌┌┌┌▄█┌╫╬оvN5-+-3Gxе├╨╪╪╪╪╪┘┌▄┌█▄▌▄█┌▌▌██┌▄┌┌╫┘╪╫╪╓╫╫╓╫╪┌██┌▄▄▄▄█▄▌▌▄▄▄▄▄┌█▄▄▌▄▌▄▄▄▄▌▐▐▌▌▐▐▌▄▐р▀▐▐▀▀▌▄▌▐▐▀▐рр▀▀▌▐▌▐▀▐▐▀рррссстууутуухууууфффцчцхцчцчцшшшшшщщщшшъъъщъщъъшщшщъъъъъшъшшщщъщыъъыщшчцу▌╨лИsosНХЪвжм░│╡╣╗┐└┼╚╦╬╧╤╤╥╤╨╥╥╙╙╘╙╙╙╙╙╙╤═└и№             ·ОПКЕДВГВВГЕДЕИЙЛММОНПМКИЗНРСТУРРСННКИЗБ}vvwxwnooqqqnjnttjhmt~xfYWUUY]addkwН▒█шс╞Уtirvm^]iw}ugWVZ__ZUPXegVGUfn`MTrtbVW\`\RQ[cin||wk]W`f^VV]caVWZ_b_US\b]VYbbXQTai]P]jhYNYfgYU\elYT]ef]SV]ih^PW\ejh]V\`jmhb`ggpГ}vm^dtЙТЛАЕРИ{{ГДpb`eltЙПДvxИНynqrpfXWTTX^`[_`aaaccdfid]_ababXLGJPMIO[_cdkme_\\^_^[]ejg`_`ccccbbgfaXW]`ab_XKBFR^^YVamnkfa]THCHT]cknmg_XUQRa{МПyWPgslZPLIKRUSJUxФХВ`PaoiaXUYejdUQcvpaYYgЛ~f]^vРХГcZTUV]XShЙХЗn[VSOQVU\ГЩЯЙp]ZiА~n_[UMVcic^rЧ╢╚╧╥╥╒╓╓╘╘╒╒╒╘╓╓╓╒╙╙╘╘╥╥╙╘╘╘╘╓╓╒╘╒╒╓╘╘╘╘╘╥╙╙╘╙╥╒╓╓╒╓╓╘╘╙╥╤╨╨╠╠╔╔┼─┼─├╛┐└┐└┐┴─╟╟╚╩╠╬╧╨╨╥╙╥╥╓╓╙╙╒╒╓╫╓╫╒╫╓╓╓╓╓╓╫╪╪╫╫┘┘╪╒╓┘┘╪╪┘┌┌┌┌█▌▄╪╤╛К^=2/-.3/-2AcТ╗╦╒╪╪╪╪┘▄┌▄▄▄█┌┌┌▄██▌▄┌┘┘┌┌╫╒╒╫╪╪╪┘╪┘╪╪┌┌█┌▄┌┌┌┌┌┌┌┌██▄▄█▄▌▐▌▌▐▌▐▌▀▌▌▀▀ррр▐▀▀▀р▐▄▌▐▀▀▀▌▌▌▌▄▐▐▀▐р▀▀▐▀рссррттсстхууухчхфхццччцццччшшшццчщъшщщщщщщшщшъщъъщъщъшшъщъъъыыъщыьышццт█═кЗrrsДОЧЩбйнп▓┤╣╜┐┬┼╦╠╬╬╥╥╥╥╨╤╤╙╙╘╙╙╙╤╥╤╨╔╝м√              вЛЖДДББАБГДЕДЗККЛЛМОРУСЛЙМРСССННТПМЛЗ|zwsqspmnrslnrqoowzyqmsАЖ~seYTUW\`ahvЙйсщч╥д{wth\RRXcifcbgkh_UIKU^_GDOW[OGNWZVOOX\WQR\flxИИxd^]deZPS`d]UTW^cYPR\`ZSZc`YOWgkZR^iiUNZbbYT^ifYS[ef_UXckhXNQWbif[XbgiihabgjqАИГyiZaj{ЛФЕЛСИzxwjdnwxu}ОМzr{ЙДqopkbWSVYYURT]ed___dfgf`[[`ee^WKEDJSTTTY^fkld`_baaa]Zanpgc`___YTV`b\T[``_\QGDES_e_TUW_hjkkiuveY[\^hnkd^XQT]sЗНДePeАДr[SLGFKQLGeКЩСtPTo~rd[TSQQNLQhwk_[Zfwzi_V^wЙГn^VTSVYRQjЙСАeVRONRUO`ЖЩЮЖlYTh~В}tj\OXeg[[wЩ╕╔╧╧╤╙╙╘╘╙╙╒╒╙╘╒╙╙╙╘╥╘╥╥╙╒╓╓╓╓╓╘╘╫╫╓╙╙╓╘╘╥╘╒╒╒╙╫╒╫╓╒╓╫╘╥╘╘╥╧═╬═╚┼├┼┼┴╛┬┬┬┬└┬╞╟╔╩═╧╨╤╥╙╥╙╥╙╥╘╘╘╓╫╫╓╫┘┘╪╫╫╓╓╫╫╪┘╪╒╓╫╪╫╓┘┘╪╪╪╪┌┌┘┘┌█┘┌╪╫╞ФjH62-09TГп╟╒┘╪┘┌┌┌╪┌███┌▄┌▄┌█▌▄┌┘┘█┘┘╫╫╪┘╫╪╪╫╪╒╪╪┘┌┌▄┌██┘┌┌█┌████┌▄▌▐▌▄▐▌▐▌▐▌▌▌▐▀р▀▀▀р▀р▌▄▐▐▀▀▐▐▐▌▄▌▐▀▐▐▀ср▐▀сссррссрртффуууцффхццчччццццчччццчщъщщщщщъъщщшшшшъшщъъшшъъъыыыыыщыыышчцу▌╧мЗsqsГОХЪвйн▒▓╡╣╝└┬╟╦╠╬╬╤╤╤╤╨╤╤╙╙╒╘╘╘╥╙╤╨╔╝и√              ║КЗЗЕДДВВДЕЕДЗЙКЛМКМСУУЛЙМРФСФПЛННКЛЗ}{yvroppnmruppqqpou{~qlr{АВzi^VQW[^ajvЖе▀шч╘дxogZVW^diiikonk^RLNV_[EEQXVMIOVZUMNY[UOS^ddklnnc\`hfYOS_f]TSY`dVOOX`ZMVcbVOWfiYT`kgSMYecYW`ec[W[ch[PVckjWNSV`hg[Xdhlmh_`jnq{ЖДxgZ^hyНШЖyЙЦОxqqkhmБИ~{ЙМ|tyЕГqmmmaWTUYZVTX_dfc``dfgg`YZ^ejdVKHFJUTSRU[cggb^]a``_[Zannie`_]ZWTU\_]WY_`_YMDFJV_c_TRU]ehiihjd]Z[Z^fljd]WRVavКС~aQiБЕsZQJEFILLIkНЪПqQZyВwfZROOOLHRgph`YZfwwh[V_wДЖm]VSSXZNQmКТВfUQOQRRNaЖЫЮДk\Wf|ЕБyn[QZhjb_zЩ╕╩╨╨╨╤╤╙╙╙╒╘╙╙╒╫╓╥╘╒╒╒╘╘╫╓╘╒╓╓╒╥╙╫╫╘╙╒╓╫╘╙╫╓╓╘╙╓╫╓╓╒╓╒╘╤╙╙╤╧═╧╬╔┼┼╚╞─└┴┬┬├┴╞╞╚╚╔╠╧╨╨╥╙╙╘╥╒╒╫╒╘╓╫╪╫╪┘┌╪╓╓╓╓╫╫╓┌┘╓╫╪╪╓╓┌┘┘╫╪┘┌██▄┌█┘┌┘╫╦зyQ78//2Itг└╥╪╪┘┌┌┌┌┌█▄█┌█┌▌┌┌█▄┌┘┘┌┘╫╓╫╪╪╫╪╪╪┘╫╪┌┌┌┌█┌┌┘┘▄▄█┘█▄███▌▐▌▌▌▌▐▀▌▐▄▐▀▌▀▐▐▐▐▀▀▀▌▐▐р▀▀▌▌▄█▐▌▐▐▌▐▀рр▌▐▀ср▀рссссууфуфхчфххччцччччцччшшшшшшшшшщщщъъъъшъъъщшъъщчъъыъъъыыыъьыщцццу▌╥оИsorАЛХШазмп░╡╣╝└─╟╩╠╬╨╙╥╙╥╥╙╥╘╙╘╘╘╘╥╥╥╧╔╝и√              ╧ИЕГБВГБДЖЗЖЕИКЛМООРХУРИЗМРРООНМПНЙЕДААxupnooprslossolwАuorx{Б~pe\TW[`afqЕг█шч╘жДga[Y[ajjlprrqo]TMQW_XIKR\[KGQXWTNN[]WQT^bYY_efcbgjhZPU^b\UV[`cVNOY`YTXa]VSZghWR`kfRO]db[X^jgYT\eiYNUbmkVORWaieXYfilkh`bknpv}А{g[^dvЛЪИyЗЦР{uujckАКВ{ВЖxtw~ulkkbTSY_[TTZ`eea__accd^XW\becXLGEITTRRUX_gd`]]``a`][anslgb_]\YNU]`YV[_`[SKDGO\be^RPQY_efda[YXZ]\[fola[VWYg{ЗЕx\VrЙЙs[QIBBJOJIpРЫНoRaВКzf[TQRSNKRhsg]XZfrre[V^qБАgYUPPTWQTqНУВgVRMLPSO`ЖЬЮДjYSfxЕЖ}o[OWcc\`|Ы║╦╨╨╥╥╥╥╥╙╙╙╤╙╒╓╒╤╥╥╥╥╥╙╫╓╘╘╓╓╫╙╘╓╓╘╘╫╫╫╘╥╒╓╓╘╙╓╫╫╙╘╓╘╥╤╙╥╤╬═╬╠╚┼┼─┼┴└┴├├──╟╚╔╔╦╧╧╨╤╤╥╥╥╥╓╓╫╘╓╫╪╪╫╪┘┘╪╓╫╫╫╪╪┘┌╫╫╪╪┘╫╓┌┌╪╪╪┘┌┌┌┌┌██┌┌┘╬╖ЙZ55/.1BeЦ╗╥╒╫╪╪┘┌┘┌┌█┘╪█▄▄┌┌┌█┌┘┘┌█┌╪┌╪╪╫╫╪┘╪╘╓┘┌┌┌█┌┌┘┌▄▄█┌█▄▄▄█▌▄▌██▌▄▐▌▌▄▐▐▐▐▀▐▌▐▐▐▌▄▌▐▀▀▄▌▄▄▌▐▀▀р▀▐рр▀▌▐▀рррстттуссутфцчфцччцфцччччцшчшшшщщшчшщщщщъъщшщыъшшъыщчщъъщъъыыыыыъъщццс▄╤▓ЙvqsАОЦЫвзмп│╡╗╛┐─╟╔╠╬╨╥╥╥╤╤╥╙╙╙╒╘╘╥╥╙╥╬╔╛к√              ▀ЕГГГГДГГЖЗЖЕЙММОППРСПОЙЙМУФСТПММОКДГБ{zurmoqpnqunmrurotАВztuy}Б~xnaX[]_`dqЕв┘хх╘жГv`]YZ_ekiovzxvs\UPSY`TEIUZUKIQWWQMP]]RNT]]USZbhfgmokZPTZc\SU^cbYQR\aYQXd`TP[iiUT`hcSS^gcZX_ed]X^fiXLSbmkWQUX_fbVWgorpgZ]komr|ze[]dtКЪЙ{ИХУ|sskbf}НВuВНДvqw{upnjaXV[][UV[bee`\]`bfd\XW]`c`XNEAFKOPSVTYdha\]^`b`]]`jnmjbaee]PU]_[X\_]WMDAJS\ac]QNOU]dhc\SNRY\[^fihb[UW\lБПИpYXzМКs[SIDAEJLNwУЬКl[jЙП}hZWWVTMMVijbZVZepoeXV]nzwbWTSTSULUtННБeVOLLOPOcЕЬЯГj\VcvВВznZPPUY[`~Э╛╠╨╨╤╥╥╥╥╥╙╥╙╘╘╓╘╙╘╘╘╘╒╒╒╫╙╘╒╒╒╥╒╒╘╘╙╫╓╫╙╙╘╫╓╘╘╓╫╫╘╘╒╘╤╤╤╨╤╧╬═╩╔┼╞╞┼┬└┬├─┬├╟╔╟╚╦╬╧╤╤╙╙╘╓╘╫╫╫╫╓╓╫╪╫╫╫╫╓╓╫╫╫╫╫┘╪╫╫╫┘┘╪╪┘┌┌┘╪┌█┘┘┘┌┌┌┌┌┘╙┬Щj=3110:[Зп╠╥╒╪┘┌┌╪┌┌┌█┌▄▌▄█┌██▄┘┌█┌┌╪┘┘┌╪╪┌╪╪╫╪┌┌┌┌┌┘┌┘┘┌┌┌╪┘█▄█▄▄▌▄▄▄▄▄▐▌▌▐▐▌▌▌▐▐▌▌▐▀▌▄▌▀▀▀▌▐▌▄▌▌▄▐▀▐ррср▀▀рсрссттттууусухфухцццххччччцшшшшщшщччшшщшъщщшшщъъшщъъышъщъщщщъыыыыъщщччт▄╤╡КwptГПЦЫгймп▒╖╗╛┐├╞╔╠╧╨╤╘╙╤╥╥╥╘╙╙╙╥╤╤╙╥╨╔╝з√              эЖГБАБББГЕИИЖЙМПРСРРРСРЛКНРРОМПНОНЙЕБ~zvsprpomopnorrqqu}ДАzw|~~|{l^__a`eqЕг╪фх╥в}o^ZY^ajokt{|yupZTRV\]TGMW^WHGRYWQMP[[RNSZ^QQXbgilwvk[PTY^YUX]cdXPT]_YSXa]TQ[imUS`heSU^dbWV\id[W]eiZOTblhWTUXagcUWfprnf\]kqnoyА}e\]crЕУКИЦХ~utk`avНЙy~КЗzlr}wqmkbVW^a[YY]cfeda__deb[VV[_dc[PECDGIKQTVW^db^^``a^\Z_munhdcjhYRZdc[V\`]SHDEMW_de]UOMQXbjm`ONUZ^Z[eojbZUW^rИПБhV\УМsYQKDCHJLTxФЩЕdRoРУАj\W\^\SOXfmcYV[gojbXU^mvr_WSSRVYSYxРРАcTNKLSUPeЗЭЭВjZSbtГЖzlZQPPQR]АЯ╛╠╤╤╤╥╘╒╘╘╘╒╘╒╓╓╘╥╙╙╙╥╥╘╙╘╥╘╒╓╓╙╒╒╒╘╙╓╙╓╙╥╙╓╓╥╘╘╓╫╫╫╘╘╥╤╨╤╧╧╠╦╩╔╞╞─├┴└└┴├┬├╞╚╚╚╦╧╨╨╨╤╘╘╘╓╫┘╪╪╪╓╫╒╒╓╓╓╓╒╓╪╫╫╫╪╪╓╫╪┘╪╓╫╪┌┘╪┘┘█▄┌┌┌┘┘┘█╪╒╦оxJ:2206Ksб╞╧╒╪█┌┘╪┘┌┌█┌▄█▌▄┌▄▄▄██▄▄▄┘┘╪╪╪╪┘╪╪╓╫╪┌┌┌┌╪┌┌┌┘┌┌╪┘█▄█┌▄▄▄█▄▌▐▐▄▌▐▐▌▌▐▐▐▐▌▐▐▌█▌▀▀▀▐▐▐▐▐▐▐р▀▀рррр▀▀▀р▀▀ссссстттстхфууфццхцччччшшччшшшшччшщшшшщъшшъщышщшъшшъщъъъыыыыыыыъшчцт▐╥╡ЙyqsГПЦЬдймо▓╢╝┐└┼╚╩╠╬╤╥╤╥╤╙╥╙╙╙╘╙╙╤╤╙╤╧╔╛е√              ўЖДДГБГДДГЕЙЙЛННООНПРТУПННУХРННННЛЕБ|yyuusprronnrppqsrqu{БДБzwt|А~vjc``aisЕж╘р▌┼Цxh\Z[_ekmjt{{zwmVNQW__PBLZ^VIKRXWOKRY[ONSY\QOWdiksАnZRU[bYQU^``UQT^aYQWe_RO[hlUTbkdQQ_gbXX\dd]W]fiZOUbjgUTUXdjbPUennnfU[lomnuА}eZZapДШСЗИФХАvti[^rММ|~ЖДyoqvvqnjaZY\\Z\]`bedcb``afd[SVZ_ab\PHECFJNSTUV^c`\[_``_^\]jtpliea^ZX_ddZUZ^XNECGS[_de_VNMMU`nwlUTY\ZW]ehhbZVV`yПТ}cUaГФНrXQKEEGHIWyУХАc[tЦЧГm]Y^`]OLWbc`YV[ejh`QQ]krmZVSRRWVOZzРПbURNNRSPhЙЭЩ~i[Tas}~ylWPQPNR\Ба└╬╨╤╙╙╘╘╘╙╥╘╤╘╓╓╙╙╘╙╘╘╥╙╙╘╥╒╒╓╘╥╘╓╓╥╙╘╘╓╘╘╘╫╫╙╙╘╫╫╫╙╥╥╨╧╨╨╧═╠══╩╚╚╟─┴┐┴┬├┴├╞╚╚╔╬╧╨╤╤╥╘╓╓╫╪┘┘╪╪╒╒╒╒╓╓╒╘╒╫╫╫╫╪╪╪╪╓╫╫╫╫╪┘┌╪╪╪┘┌┌╪┌┌┌┌┘█┌╫╨╣ЙY?52.1=\У┴═╒╪┘┌┌┘┌█▄█┌▌▌▄┌┌█▄▄┌▄█┌┌┘┌╪╪╫╫┌┌╪╓╪┘┌┌█┌╪╪┘┘┌┘╪╫┌┌██┌▄▌▄██▌▐▌▄▌▌▐▌▌▌▄▌▄▌▐▐▌▄▌ррр▐▐▌▐▐▐р▀сс▀▐▐▀с▀рссрстсссттттууусуфххххччччччшшшшшшчшшщшшшчшшшъъыъыыыыъыъъъъыыыыыыъъччцт▐╙┤ЙxqsАОЦЫгзмп▒╢╜└┬╞╔╦══╤╙╙╥╥╙╥╘╙╤╥╥╙╥╥╥╤╬╚╛д√              ¤ДББББГГЕЕЕЖЙМПСТУРУУУУОМЛПУСРПММЛД|zxxzwsrsrmkpponqrssvВИЗyslnw}ztjbb_gsЖд╔═╚лЗmda^_`holeny{{ymVQRZ`^NEMZ^UGJRXUNKOWYPMSZYNNXbhq~И~lZUZ\^XUW\c_URV__YTYb^TR\ikUVbibOR_daZU[idXS[efYOV`heSUW[ekcOVbknmeY\luppxБa[[aoГЬЬЛЗПХГwrf\[oМРvvГЙ|ilqonnncYY]^\\`bcdc_b_``cc\UUX]cc[PIGEEJOSSSW[`^[[]__^]YYhruqg\XYVXaebYUZ\SFCDMV[_de_VOLMP]p}rb]\\ZVXenjaYSVeБЦХza\hЙЩОqYQICDIIHXyССz\T{ЪЫЕn]X_d]OKQVX[YW]gkf^US\msgYTSORTXS^~ХТcSNLMQRPiКЫХ~hYVarxwvlWSUUTP_Дв┬╬╥╤╙╙╘╒╘╘╙╥╤╙╓╫╙╤╘╤╙╥╤╤╤╘╥╒╒╒╘╙╓╓╓╘╙╘╙╫╙╘╓╓╘╥╘╘╫╓╫╒╘╙╥╥╙╙╤╠╧╬╬╦╟╞─├└┴├├─├├╞╟╚╩╬╨╤╥╘╘╒╓╓╫╫╫╫╫╫╒╓╘╒╒╓╒╒╒╫╪╫╫╫╫╪╪╪┘┘╫╫╪┌┘╪╫╪┘┌█┌▄┌┌┘┘█┌╪╙┴ЭoE42/06OБ░╟╙╪┘┌┌┘┌┌┌┌┘███┌┌█▄▄█▄┌┌┌██┌┌╪╫╪╪╪╫╪╪╪┘┘┌┘┌┌┌┌┌┌┘┌█┌┌┌██┌┘┌▌▐▄█▌▌▌▌▌▐▐▐▌▌▐▐▐▄▌▐▐▐▄▐▌▐▐▐▀рр▀▀▀▀рр▐рсррстсссуфтттуууфхххххччччццччцшщщчшшшшшшшшшшшшъчшъъщщыыыыыыыьыыыыъщчхт▐╘╕Й{psАЛФЫбзмп▒╢╜┐└─╟╟╠═╧╨╥╤╥╥╤╥╥╥╙╙╙╤╙╙╥═╚╝д√               ЕДБББГЕЖЖИКМОООООСРСУТПМРУПМНМОТЕ}|zyuwutrqqmkmpprtuvst~КИ|tjcelv~{rjgdhrГЩ╕╣мТxgb__]bntkakv|~zjVQS[_^ODP]^SHMRWVLIQ\WNMRWVOMXemuА}lZV]_aXSW^d`VRV__VQ\e^SS`kiTUcg^QRafaYU\dbYSZddXNV`hdRPUZfjaOVbkombR\ioopv|}c[^cnВЪЮПЕЙПИxpfVWlИПxvЗ~finpomic\[\\]^bb`deddd``dc\UVZ]\\WLFGHGKOUVTX_b_XYXXYZXWTerunaUVXZ\bdaXTWWOCAEQZ]`ee]UONLOXj}zib_\VSZcki`XUWiКЮШx\YoНЮРsZRJEEHFHXyОКs\^ЭЬИo^Yag^OLQTXXWY^jnj]QQ\ilfWSTQQRRO_АФР}bQNLNRNQkКШТ|h[P`nwyul[VWZZWaИз─╨╥╤╥╤╙╙╥╘╥╥╤╙╘╒╙╤╥╙╘╙╥╙╤╘╙╙╘╒╙╥╒╓╓╘╥╙╓╒╙╒╫╫╓╙╘╘╓╓╘╒╙╘╤╥╨╤╨╬╬╧╬╦╟╞┼├┴┬├┬─┬─┼╞╟╠╬╨╤╤╙╒╓╓╫╪╫╪╓╫╒╒╓╙╒╒╓╒╘╒╫╫╓╫╫╫╫╫╫╫╓╫╫╪┌┌╪╓╫╫┘┘╪┌┌┌╪╪┘┌┌╒╠░ВR92--0?tб└╨╒┘┌┌┌█████▄▄▄██▄█┌┘█┌┌┌┌██┌╫╓╫╪╫╒╫┘╪┘╪┘┘┌┘╪┌┌╪╫┌██┌┌█▄█┌█▌▌██▄▌▌▌┌▄▄▐▌▌▀▐▐▌▐рр▀▄▄▀▀▐▐▀▀▀р▀▀▀ррррсссстсртффустссрухххфххцчччччцшщщшччшшччшшшшшшшыъыъъщшъъыъъыыыъъььъшчфу▀╙╣К}suБЛФЪбзнп░╢║╜└─╟╚╦╠╨╨╧╨╥╥╤╥╥╙╥╥╙╥╘╙╙╬╔╗г■               ДВВББЕДЖИЗЙЛНРПРРСУРРТСОНРФРНММОСЗ{{|yxwutqpkkoonnswuppzГЖ~pe`adkuytrkdhqПЦЦРЖsga`b`epvg]hvВИБfUTU[_]NJQ\]PGLTYUNLRXWNKQYXNNYglsЙПyj^X^_]XUX^e_TRX`_US]f^UUbmdRWci_UXaebZT^ieYU[cdZPV`gcRRV]ei`OTbnqn`P\gooot}zdaciqАЧвРДИУМwpeZ[nЗСzu|Ж~hlprpokeZWVYZ\ac__cedba]``\STZZ[WSLGJJJMSWYZ]`b_XTTOMNPOPaoska[Z\]_dfaURUSKBBLV[^add]TOOLKThrvpgb\WRXhoi`YVZlНдЩt\]qФжТr[QKEGIIJ_ОДmTXГбвЛp^ZckaPMRX[[XY_kqg_VPYdd^WRSPNTXQ]ДШТ}aSNJLQPSlЗХОzf\U`r}}wkZUXZUScЙи─╧╤╤╥╘╙╒╥╘╘╘╥╘╘╘╥╤╥╨╙╥╥╥╥╙╙╙╙╒╘╙╒╒╘╘╥╘╘╘╤╘╒╓╘╘╘╘╒╒╒╒╘╘╥╤╙╥╤╧╧╬╬╔╞╞├┬┐┬├┬┼─╟╟╟╦╠╧╨╥╥╙╒╒╓╓╓╫╓╒╓╓╒╘╘╒╓╫╒╘╒╫╪╓╫╪╪╫╒╓╫╫╫╫╪┘┘┘╫╪╪┌┘┘┌▄█┌┌┌█╪╒╨├Ф_@<0,,7bФ╖╠╒┘┘┘┌┌┌┌┘┌▄██┌┌▄██┌┌███┌██┘╓╓╪╪╓╘╪╪╪┘╪┘┌┌┘╪┌┌┌┘┌┌┌┌┌┌┌┌┌█▌▄▌▄▄▌▌▌▄▄▄▄▌▐▐▌▌▌▌▌▌▄▄▐▀▀▄▐▐▀р▀▀рррр▐▀ссрстсстффусттттухххффххччцццццшшшчшшшшшщщщшччщщщщщщщшщщыыъыыыыььыъшцу▀▌╙╖Л}ruАОХЩбйлм▒╢╗╜┴─╟╦╠╦╧╧╨╥╤╤╥╥╙╥╙╙╙╙╘╙╙╧╟╗в■               ЦВГБГДЕЖИЙЗКЛОММНОРРСФСННСРПМНМОСГ}z{zwuuuqopnnnqsqruxqou~Б~vf_]^dlvxxwsmr{ЖЙЙКЗwkb__cittc^j{ЙК~cTUV]_YLHT^\MCNWXUKJW]TLMSZVNO\hmryyh\\`d`XUW_c\SR[b_SQbk^UUckcRWdh`RScidXV^ifWQWdeYNX`faRPV^fh`OUcqtp_N\forqryyb_gmq|ТЮУГЕРОzqeVYoДНАv{ЕВlimooolf[TRQRX]`^^`bcb]^ba\URWZZXTMILNKMTZY[_ed]VUUMJLLLL^sslb^]___cfcWQRNEBGUZ^`abc\RPROMQaourkd\VU\dkiaVVZpСзШsX\xХзФr[OFCDDGKhИБjW`ИжгКn]ZirdQP^da^YX`hjh\RPXdngWTSQQSSRcЗШТ|_USMLOQVlАЙЕufXN`uypg_TRV[XUdЛй┼╧╤╤╙╘╒╥╥╘╘╘╥╘╙╙╙╥╥╙╘╙╙╘╘╒╥╙╒╒╘╥╘╒╒╥╙╘╓╘╙╘╫╫╘╙╙╘╒╘╙╒╘╙╤╤╤╤╥╨╨╬╬╩╟╟┼┬└┴├├┼├─╞╟╚╦╧╧╥╥╘╒╒╓╓╓╓╓╓╓╓╒╓╘╒╓╓╒╘╒╫╓╓╓╫╪╪╒╫╫╫╫╪╪┘┘╪╪╪╪╪╫╪┌▄█┌▄█┌┘╓╘╦йpJ;4/,3PГй╚╙┘┌┌┘┌█┌┘┌███┌┌█▄┌┌┌████▄█┘╪╫╫┘╪╫╫┘┌╫╪┘┌┌╪┘█┌┘╫┌┌┌┌██┌┌┌┌▄▄▄█▌▄▌██▌▐▐▐▐▀▀▐▌▐▐▐▐▌▐▀▐▄▄▐р▐▐▐▀▀р▐▀▀рсрстустуусстсттухфхфцххфхццццччшщчччшшчщщщшшшшщщщщщшцщщъъъыыьъьыыщшшхс▌╙╡ЛyqvБПХЪвзлл▒╡╗╛└─╟╦╠═╨╨╥╥╤╨╨╥╤╥╥╥╙╤╘╤╤╧╔║д■               мГББГВЕЖЖЗЙЛОТТРУСУРРФХСНООПМЛКЛОБ{z|}wtutqnonnloppqvwsqrzВГ~i_]^cgltwwyxuw|БЖИЙЖud``fmrp_]k{ГДx^RV[__ULLV`ZLBOZ[UNLTYUNOT]VNR]efgpqof`bggaYWW^d\QS\b^SUah^TSblcRVad\WW_fdZT^ifXRXacVOYad_SPU]df\PVdu{u_OXfqroqvuc`lqqvПЬЦЕЕНМsfTUiВЙД{z|}rkknppndWSTOMQ[`^^__aa^\`bYQPVZ]YTNLPQOOSY\]_`b^WWUQNOPOS]svld``c`aegcUOLFBDMX]__`a`[WUSOMR\httle`ZX_kpkbYT\rХйЧq_c~ЭнФnYLDCCEIMpОНБlTbПзбИo][oweQRh|vd\Zbmqh`UWg|ГnXTQNNSTVjМЫФ{]PMJLRZ`m{}tfVP\incWRPSYYSRhПм╚╧╤╥╘╙╥╥╘╘╘╘╙╒╘╙╙╥╤╧╙╙╙╙╘╙╙╙╒╓╫╘╒╘╒╥╙╘╓╘╙╙╒╒╘╤╙╙╒╙╥╘╓╘╥╙╙╘╙╤╤╧╬╔╟╞┼├╛┴┴┬┼├╞╟╩╦╠╬╨╙╙╘╒╙╒╥╫╓╓╘╒╓╓╒╘╘╫╫╓╒╓╫╪╫╫╫╪╪╘╓╓╓╫┘╪┘┘╪╪┘┘┘╫╪┘▄█┌██┌┘╓╒═╖~W=2/-/DpЬ╛╧╪┌┘╪┌▄┌╪┌┌██┌██▄▄▄▐▐▐▄▄▄▄┘╫╫╪╪╒╓┘┌╪╫╪┌┌┌┘┌█┌╫╪╪┘┌┘┌┌┌┘┘┌█▄▌▄▌▌▐▄▄▌▐▌▐▀▀▐▌▌▌▌▌▐▐▀▀▐▌▌▀▀▐▌▐▀▀▀▀▀рстттттссссссттттстффффццффццччччшшшчщщшшщщъшшщщшшшшшчцщъъыыыььыьыыщшчтр▄╥╕МypuГОЧЭгжйм▒╢╗╗└┼╟╩╠╦╬╧╤╤╤╨╨╥╥╙╙╙╥╥╘╥╤╬╟╜е■               ─ВБГЗДЗИИЗЗЛМРППССТТУФЧФРПРУСПМЙЖ|{{zwvusnlnpnkprnnsxtqrvЙДkaYY_cacjosvqnu{ИЫЯЦ}e`benrj[\lzВqXQW^``WJMZ`[JGR[[TMLUZTORV]VNR`fcZ^ghc`ejmcWTY_aZPS\b]RSfl^STdmcSXch^SV`gd\V]jeWOXfeUNYag_PLT^ef]PVbr~w^NWeqspqvqcbp}yxКаЧ|НТДseQRh~ОИwt~АvkinopmcWRNMNQYa_^_ab``^bbYOPX][UPKKRUQNSY\[_aa\WVVUUUVSS^uvofa`c``eecTNKDBER[___]__\WTTRNOXaqtnidaggkliaVV\tЧиХjWdЗвоТnWLD??CFOxХЩЙkZkТжЭЖm]^rvcQYs{yl_ZgzЗwbVazКЛqXQPOMQRSmНЫХx[ONLLUbinw{yrfUL[gfYRPPRVZUTiОп╟╧╨╥╙╥╙╥╘╘╘╘╥╘╓╙╙╙╙╨╙╙╙╙╥╥╥╘╓╓╫╘╘╙╙╙╥╒╫╘╘╘╘╒╘╘╘╒╒╙╥╙╓╙╤╙╥╥╥╤╤╤╧╩╟╟╞─┴┬┴┬─├┼╟╩╩╦╧╨╥╥╘╙╒╒╘╫╓╫╘╘╓╓╒╘╒╓╓╓╒╫╫╫╫╫╓╫╫╒╪╫╫╪┘┘┘┘╪┘┘╪┌┘┌███┌┌┘┌╪╫╓╥┴МfE42,07]О┤╩╓╪┘┌▄┌┘┘██▄▄█▄▄▄┌█▄▐▐▄▄█┌┌╫╪╪╪╪┘┘█┌╪┘╪┌┘┘┌╪╪╫╪┌┌┌┘┌┌┌┌┌█▄▌▌▄▄▌▌█▄▌▐▌▐▀рр▌▌▌▐▐▐▐▐▐▌▄▌рр▐▐▀▀рр▀▀▀сстуттсссуссууссуфффхффхфхчччччцшшчшщшшшщшшшщщъщщщъщшшъъъыыыьэььыщщччфс▄╤╣НxqwГОЧЮдилп│╖╗╝╛╞╟╦╦╦╬╨╨╨╨╤╨╤╤╥╤╤╤╨╥╙╥╬╔╛д■               ┘ДББДГЖЖЗЗЗЛНРСПСУФУФХЦТППППМЛЛЕД|z{||yuusnlnroiortppwvqns}ЖИpaXY]_^\cghijovГб╕╗жАkegkqpeZ\kzykUTZ`baULO[d\GHT][QJLUZVNRY`UMS`c^WTaiffkmlbWUX_f[NS^b]UWch^UWeo`U[cd^VX^fdZU_keXT]feWPYcd\RPV_gg\QS`mwt_PUcorssvqbbp|xuЗЭШВ|ЛФЙueVWgyЙЙ{syБyjfjnmjaUPONRVZ_```a_^^]bbXOQY][VNKLQTQNPW]__bb]VUYZ\\ZXV[syphb^``bdc_UOKFFNW\_^_^]]ZUTVRPPU_oqpmjlyjklh_WW\uЧжРdWmМемОjWIDBCFIRЬЬИhQfУдЫБhYatr_R_~ТЗsb]kИПzg`iЗШСr[RPONTUSoТЭУz]QNLNXchnx{zuiVPW_\WVUOOSUNQiП▓╟╧╨╥╘╘╒╘╘╘╘╘╘╘╙╥╤╥╤╤╤╤╙╥╥╥╤╘╓╓╘╒╒╒╒╘╥╒╫╘╥╙╙╘╘╙╒╘╘╙╥╙╒╙╙╒╘╘╥╤╤╨╬╔╚╟╞├┴┬├─╞┼╟╚╩╩╠╧╨╤╤╙╥╙╙╙╓╓╓╘╘╒╒╒╘╒╫╪╫╓╓╓╓╓╒╫╫╫╒╓╪╪╪╫┘┘┘╪┘┌┌┌┘┘┌██┘┘╪┘╪╪╪╫╚бuO:6/05L}е─╒╓╫┘██┘╪┌┌██▄▌▄▌▄█▄▐▐▌▌▄█┘╫┘╪╪╓╫┘█┘╪╪╪┘┘┘┌┌┌╪┌┌┌┌┘┌┌┌████▄█▌▄▄▌█▌▐▐▐▐▀▀р▌▌▄▄▄▄▌▌▌▄▄▀▀▀▐▀▀▀рр▀▐▀сссссссссссссссстфхфффцхфхццччцччшшшщщшщъъшшшшшщчщшщшъъъъыыыыыьььъшшцус▄╙╣ОxowГПЦаеймп│╖╣╛┐─╟╚╩╠╧╧╨╧╨╤╥╥╥╙╥╥╥╥╙╙╥╬╚╗ж■               шГБГЕЕИЙЙЙИЛМПССУФУТУХФУРУСФПЛКЕАzz{zzxsqqnmnrrlmrtrrxxupp{ГБvi[[^^YXaceehozХ╝═─▒Еgdijnj^Y_jw~tg[[^abaTJQ]cXEJW][PGM[[QLRZ]SLT`d[RTcgejrxweXSY_b[ST_d\QWij^TZgo_V[di^PQ_gcXUbkfWQ[hgTNXdf_SPWaii]QU^mws^QW_ltrpurdbtЖАuЕЫШД}МЧНweUWeuВЙxx{wnhklli`QMMMT[_bc_^_`^[_`bXNOY[ZURKKRWSOPW]_beb[VV]^^_]ZX[ospjb^_`aed_UNKILS\__]]XX\YRTWVRPT]jqrprqnfili`VW^xШаЙ^WqПжзКfXFB>AHKWИЭЮЕhYlСЮУ{eZcuu`TeЙТКvc_oНСye_oНаЦs[RSQKPOSpСЪУ{`VUQPXejs{ВДyoSNZa\WWWPMQTROiР│╔╧╤╥╘╒╘╙╘╘╘╙╙╘╒╒╤╥╙╘╥╙╘╙╙╥╥╘╓╓╙╥╘╘╥╙╘╘╘╘╙╘╘╘╙╘╘╘╘╥╥╥╘╒╘╙╙╥╥╥╨╧╧╠╩╩╟┼─┼─├┼╞╚╟╔╟╩╬╧╨╤╥╥╙╘╙╓╓╓╘╒╒╓╘╙╓╫╫╫╫╓╫╫╪╪╫╫╫╫╪╪╪╪╫┘┘┘┘╪┘╪┌╪╪╪┌┌╪╪┘┘╪╪┘╓╦▓ЖZ>6111FqЫ╜╘╓╪┌▄█┌┘┌┌██▄▄▄▄┌█▌▐▌▄▄▄█┘┘┌┘╪╫┘┌┌┌╪┘╪┘┘┘┘┘┘╪┌┌┘┌┘┌██┌┌┌┌▄█▄▄▄▄▄▌▐▐▌▌▐▐р▌▌▐▌▐▐▌▐▌▄▌рр▀▐▀рррр▀▐рстсстсссссссссстффхффхцхухцчччшчччшшшшшшщщшчшшщъыыщщъъъъыъыъыььыыщшчцу▀┌╙╗ОzrwВРЧагил░▓╕╣╗╜┴╟╚╩╠╨╧╧═╧╨╙╙╤╥╥╥╥╤╥╤╤╬╞╣з■               єДББГДИЙКККМОРСССХУТФХХУОПООНММИzzz|zxtssqnptphnrtpnvyyqqxБИpc^^_YTY]aacqГа╩█╒╕ЖigjnocYX_iopod\^_`_^QMV__VDJZ`ZPONVVPMR]^QLU``XPWegglwАeYWZ_d[OVae[QXfh\R[in]V^dc\VT\daTUcjeZUYfgRLXcf_URXdkj]SR\isr^OS]jwwoplfgrАВ|ГТЦКАЙЧТ{eQUbnАМqrxzngiihi^OMPSW\cgd_]^cb_^abVLQ[^YUPKKQ[ZRTZ]`cca\WX^____\W[mvrnf]aabda[RMLNQW^`_]XTTXWTTVXTOQYdmopnlkiili`UW_yЩЬY[sСигДeXFDACGM\ОаЬДfVqРЩЛubYdrr]TjПЬОwecsОСufctУиЦpYQSQNRQTrУЫР}i_XUSXeowБИЙzmWQalhYYVROQSNPlТ┤╦╨╤╤╙╘╘╘╘╒╒╘╥╥╓╓╥╙╘╘╥╤╘╒╒╙╙╓╓╒╙╘╓╓╙╙╘╘╘╙╙╘╘╒╙╙╙╙╙╥╙╘╘╘╒╫╓╒╙╤╨╬╬╩╔╟╟╞├───┼╞╔╔╔╚╦╧╬╨╨╥╥╥╥╙╫╓╓╘╒╒╓╒╙╒╫╫╓╫╫╓╫╪╫╫╓╫╫╪╫╫╓╓╪╪┘╪╫┘┘┌┘┘┘┌┘╪╪╪╫╫╫╪╓═╜ТcF9022;aП╡╧╙╓┘██┘╫┌┌┘╪┘█▄▄┌█▌▌▌▄▄▄█┘╪┘╪╪╫╫╪█┘╪╪╫╪╪╪┘┘┘┘┌┌┌┘┘┌██┘┘┌┌█┌▄▄▐▌▌▐▐▐▌▌▐р▐▄▌▌▌▐▀▐▐▐▌▐р▀р▀р▀рррр▀ссссссррсстстусстхцхффчццфхцччччцчччччччшшшччшшщщщщщщъъщъъыыьэььыъъччхт▀┌╙╗РzruАПШагйм░│╕╗╗╜┬┼╟╔╦╧╧══╧╤╤╥╥╥╥╥╤╨╤╤╤╧╟╗з■               √ДГБДЖЙЙЙКИКНПУФЦЦТСУУХТРРРТОМЛЗz{zyytropqnnrtjlrsqlqzzrqx}ГЗ{haca\UX\^_euГж╤с┘╛Йkjnql\XY_foqlcadeeb[QNXbcSDKY]YQNPWWNKS]]UMU^`UHVgikrАГАdXUZ`aZRXbe[NWijYQ[im]V[de\ST_f_STclfYS[ggQNYel`ONXcmm^VR]hpo\SV]kxxqupd_nДИ~}МУНЕИСТДhQUal}ИБqnv{ndbdeh]NLRWZ]dgdc`_^_`_baVOOY_]WQJJR[ZSUY\_cfbZVX]____\\^issmfcb`aeb\TRPTV[_`^ZVOQWVRTVUMJJS`imnhc[Xfmi]PU_|ШЧxU^wПЮУ|aSFA<@HPeФЯЫАd^vХХЕt`XcpnZVoФЦРwdasДЖp^`wУдСiZUQNLNMXrМСМ~umaVRZgow}}undUVhslWWUNMQTSRpХ╖╠╨╤╤╙╙╙╙╘╙╒╙╥╙╓╓╥╘╘╙╥╙╒╓╒╙╙╒╓╒╙╙╘╓╙╤╘╫╘╘╙╒╒╒╥╘╘╓╥╥╙╥╒╓╒╘╘╙╥╤╤╨╧═╩╟╚┼─╞╞╞┼┼╞╚╟╚╦═╠╬╧╙╙╙╙╘╫╓╒╘╒╓╒╘╘╒╫╫╫╒╫╫╫╓╓╓╪╪╫╪╫╫╫╓╫╪┘╫╫╪╪┌┌┘╫┘┘╪╪╪╪╫╫╪╓╥╞гqL8/1/7O}л╠╤╓┌┌▄┘┘█▄█┌███▄┌▄▌▐▄┌▄▄▄┌┘┘┘┘╪┘╪╪┘╪╪╫╪╪╫┘┘┘╪┘┌┘┘┘█┌┌┌┌┌┌┌┌▄▌▐▄▄▌▌▌▌▌▐▐▌▄▄▀▀▀▀рр▐▌▌▐▀▀▀▀▀▀рр▀рссстсутссттссууттхцхххцццффхцччцццчшшшшччшчччшшщщщщщъъъщщчщыъьььъщъччхт▀┌╙╗ОzsvНШЭгйло│╖╗╗┐├┼╟╦═╧╧╬═╨╤╤╤╨╨╨╤╤╤╤╨╨╬╔╜й■                ДБВВДКМЛЛКЛНПТУФЧЦТУУТПММЛМКЛМЗАА{xxvqrponpolmsrnlqyzyuvyЗЕshfc\SW]_`fsДз╫т▌┼ОkjqqhXZY^ejlkhegfecZOPXa_SEMZ]WOMPWVOKT^]SLR\]TOWglozИДx`ZXZaeYNYbcZQ[hfXS^ln\X]bb\WX^f`TTckf[W[eePP\ed_RLU`hg[RR[fll[TW]ky}opnf`iВПАxЛШОАТФЕhQVdn{ЖАrqrungbceg[OMU[\^deedb```_`caVKOZ^\WRLHMVVQQW]acecXUW^`_`_\Y[guumfa`_`b`[UTTXZ^_^\VQMOUUUTTTLDEOZekjd\TYglf\PU`|ЦУqSb{ТЧНu[OC>?DJQmЪбЦ{^YАЩЧДn^W`lhUWvХЬМva^jtnfaexУгЛdYTPOOTUYqГЕЗzveWY]isvsoh`ZVYmvlWVRKKPSORtЧ╕╠╤╤╙╙╘╥╙╘╒╒╘╒╓╓╘╥╙╙╘╥╙╘╓╒╥╒╓╒╒╥╘╓╫╘╙╘╫╓╙╙╘╘╘╤╙╥╓╘╙╘╘╘╒╙╘╓╙╤╤╥╨╬╩╔╚╟├├╞╞╞╞┼╞╟╚╔╠╧╧╬╧╥╙╙╙╥╓╓╒╘╘╫╓╘╘╓╓╓╓╓╓╓╪╓╪╪╪╫╓╪╫╫╫╫┘┘┘╪╪╪┌┘╪┘╪╪╪╫┘╪╫╓╓╪╫╘═│ВX<6625EkЫ┼╧╒┌┌┌╪╫┌██┌█▄▄█┌█▌▐▌▄█▄▄┌┌┘╪┘╓╫╪╪╫╪┌╪╪╪╪┌┌█╪┘┌┌┌█┌┘██▄┌┌┌┌▄▐▐▌▄▌▌▐▄▌▐▄▌█▄▌▌▐▐рр▐▄▄▐▐р▀▀▀▀ррсрсссстс▀сттттсууууффуффццхххфчччцхцчцццццшшшчцшчшъщшшщщъъыъыьыээьыыщччфт▌┌╥╗ПxruМЧЭгйло│╖╗╜╛┬┼╚╩╠╧╨╧═╧╤╤╤╤╤╥╙╥╤╥╥╨╧╔╝м■                ДДЕЕЗКММЛЛЛОСФФСТСПТУФСРПНМММЛЙВАz{xvspqrpnqsomqvqlry~yvux}ВД~shd\SV[^`gqГв╘т▀╩УnproaWZY_ejklnnnljdXQQ[c_PFN]^TLKRYVLKS\ZMJQ\]SKZilq~КДr^ZY\aaXPXbdYN]jgXR_ll[V[ceYRY^e`VVdmeVT^idPQ\df_LMV_kkZQSYbie[XY`ny~rspd[f~ЛГ{ЕУТВzКСЖeQXfnvВБuppunhbbef[MMV^`]aegfdb^_^cecVJP^a\WSJJLSUUSTW^be`VQV]_``_]\Zftvmd__^^ac\RQY\^``^YRLGNWVQRUOFABLWcmogZT\hmg\UU`|ФОjRfДФФЕlYNB@=BIUrЮзШw]aИвЮЖm^V]h_SXyЦХЛq^[bhiaY_vЛПДaTUSOMUZbmy|~БВ}o]W]joponh\[VYnykVVRKKTWRTuХ╕╬╤╤╙╙╘╤╥╙╙╓╫╓╘╘╒╒╒╙╥╙╙╘╓╫╒╒╓╒╥╨╙╙╘╤╤╙╙╘╥╘╘╒╘╥╙╒╓╘╘╒╒╘╘╙╓╒╙╤╤╤╨╧═╦╩╟┼┼╟┼╞┼╞╚╚╟╟╩═╬═╧╤╘╘╘╥╓╫╒╘╓╓╫╘╘╒╒╓╒╘╫╫╫╫╪┘┘╪╪╪┘╪╪╪┘╪╫╓╓╪╪╪┘┘╪╪╪╪┘┘╪╫╪╪╫╒╤┐СiB35229[П╗╬╒┘┌▄┌┌▄▄██▄▌▄█┌█▄▌▄▄▄▌▄█┌┌┘┌╫╫╪╪┘╪┘┘╪╪╫┌┘╪╪┘┌┌┌┌┌┌┌▄▄█┌██▄▐▐▄┌▄▐▌▄▌▌▄▐▄▄▄▄▄▌▐▐▐▄▄▌▀▀▀▀▀рррссррстттрттттртсуууууфххццххцццччцхчччццццчччцццчщъъщщщъщщыыщыъыьыъщшччфт▀┌╙║СyquАОЧЬгзк░╡╣╗╜╛┴╞╔╦╧╨╨╧═╧╤╤╥╙╤╤╥╤╤╤╥╥╧╔╜м■                МБВДЖЙЛММЛМПРУФФЦТТТТТООННППНЛИБАА~yxwqrrsnnqqnnstpryzvvzДБznf[OW\^^eqБв╥уу╬Цstqj_Y[\bjljlqsqnlcWPT\a]OEQ\^SLMRXUKKT\YKHOZ[SO[lim}ЗВq^[[^dcVPZdcYQ[jiXR_kn[Y]`_YW\af`XWciaWU`jeNR\dd^NMV_gh\RQWbkj]S[eqy~tpnaYc}СЗxГППГ|ГЙЕfSZlnr{~xomrpi``ccXLNW_d__ehfda^_^afeUJU\^\XRLHJRWVVUV[^d`VOV]_`a_\]Xaqunea__`^^YRUZ^_^__WNHINWWQOOKE>CJT`oxs`R]ilg[UU^zНЕcRpЛМЛ~iWMB>>BIUxажУr[gРлЯЕn^W]b\S[xФЦГl]Xbhh[X]qЕИ|]VTTQQ\biosvАСТЙt^T[dksyuje_WZmwiUQNKLQRPUwЦ╗╬╧╨╥╙╥╤╥╙╙╓╒╫╒╙╙╥╘╙╘╙╙╒╓╓╓╓╒╒╙╤╙╓╘╥╤╥╥╘╤╥╘╙╘╙╘╓╫╘╘╒╒╓╘╓╓╓╥╤╤╨╤╨═╩╟╟┼╞╟╟╞┼╟╟╟╔╔╩═╧╬╧╨╘╘╥╥╫╫╘╘╓╫╓╘╘╘╫╓╘╫╫╫╪╪╪┘╪╓╒╪╪╪╪┘╪╫╫╫╓╪╪╪╪┘┘┘╪┘╪┘╫╓╓╓╓╫╙╚зxI77527J|л╚╙╪┌┌┘┘██┌┌▄▌▐▄▄▄▌▌▌▐▐▌▄█┌┘╪┘╪╪╪╪╪╪┘╪╪┘╪┘╪╪╪┌┌█┌┘╪╪┘┌█┌┌█┌▄▐▐▄┌▌▀▐▌▄▌▄▄▌▐▀▀▌█▀с▀▐▄▄▐ррр▀▀ррсссрссссрсстттттууууффххччхфцццччцхчцчцчшчшшшчцччщъъччшшшъъыъъьььыъъщчхтс▌┌╙╝УztvАОХЭгзк░╡╕╗╜╛┴─╚╦╬╧╤╬═╨╤╤╤╥╙╤╥╥╥╥╥╤╧╩╜н■                дГГЖЗЙККМЛМОПРССУРСУФФСОМНООЛЙЖА|~}ztsqprrqonqpnoruuvx~ВАzyvzГЖql]SVZ\afmБе╨сф╥Ъwtnd[Y]]cmolu|xusnaSOR]c]KDQ][SLLU\TILU\XMIS\\OK^mhdnywn\X]beaWR[ecUL[kfXU^ii\X]ddYR\de`WWcj`RQakcLR[ee]OOWakh]SQX`gf\\bhqzАyro_Wa{ФНs|СХЕq~ДАfX_rno{~wllqphb_cfXHLV\a_`eihb__a^_b`WKS]\^[TLJJNSUXXWZ]`]UOV^```_\\W^pwpid_`_eaYPU[^^^_^RHBCLVUOPNGC>DIQ^nwumb`kpfZTT_xД|\TwЩЬР{dVKB>:BJX}ЯдОn[lЧпЮДl]U[`YNWvЗБwh[Yfqm\T_qБwga^XSPaknrt{ЙЬЪРrXOUZfyЕДve^TZnxgRPNJLSSNU|Ъ┐╬╧╨╤╥╥╤╤╥╥╘╙╘╥╥╙╙╥╘╒╒╒╒╘╫╒╓╘╙╥╤╙╒╙╙╤╙╥╙╥╙╙╘╒╙╘╫╓╘╘╘╘╒╥╘╘╙╥╨╤╨╤╨╬╦╩╚┼╞╟╟╞┼╟╩╩╚╔╩═╧╧╨╥╘╘╙╘╫╫╓╒╓╓╓╘╓╓╓╓╘╓╫╪╫╪╪┘╪╒╓╫┘┘╪╪╪╫╪╫╪╪╫╫╪┘┘┘╫┘╪┘╪╪╪┘┌┘╒╬╣ЙS;:501CkЫ┐╬╓┌▄┌┌┌█┌┌┌▄▌▄┌█▌▌█▐▌▌█┌┌┌┘┘╪┌┘┘╪╪┘╪╪╪╫┘┘╫╓┘█▄┌╪┌┘┌┌┌███┌▌▐▄▄█▌▐▐▄▌▌▄▐▐▀▐▐▄▄▐р▀▌▌▐рр▀▀▀▀р▀ррсррстсрссстсссссуффххххххфццшчччцчцччцшчшшшччшщщъщъъщшщъщщъыььыыъъщчфтр▌█╘╜ТystМХЬгимп╡╢╗╝└┬┼╚╠╧╨╤╧╧╬╨╤╧╤╤╤╤╨╥╤╤╧╬╚╝и■                ┐ДЖЗЙЙЛКММЛОРСФФЧУПРРРПННОНМЙДА|}~xxtqnqqkmssnlrwvsv}ГВ}zsmr}БysaXW[]ahmАа╠▐х╓Юuh^ZZ\`fopnpxzusp^PMT]_YIBO\[SMNVXRMMX\WKHRZYRM]lf`_irk]^^cfaUQ]d_UP[idVS_jf\X]``]V[eh`VXeh`UUbkaKQ^ee\OJWagg^QRWbih\Tgswy}to_U_}ФРtyНХИpz{dXd|vov{xngpqkb_daWILRX[^_fheb_^][^a`UKUZ[[ZVMLIJLOVZXU[_]SNV[_``^]]Y^nvrle^`gibXSW[^_^^ZLEBDPWUOMKDA=BK^ЖжвИjYrЬ░ЯГl[V[^WNWozrmcZ\gsm`^brББxurng[XcpustxЙО~gUNOTaБХТg^RZoueSUOIMPQOX}Ю┴═╨╧╤╙╤╤╤╥╙╙╙╙╙╙╙╥╘╙╒╒╥╙╥╓╒╫╓╓╙╥╥╙╘╙╥╙╥╘╥╙╘╘╒╥╓╓╫╘╘╘╫╒╘╒╫╫╙╤╤╨╤╬╠╠╟╚┼╞╟╟╚╟╟╩╩╩╦══╧╧╨╥╥╙╥╒╫╫╓╒╓╓╓╘╓╫╓╓╘╫╪┘┘╪┘╪╪╓╫╪╪╪╪╪┘┘╪╪┘┌┘╪┘┌┌┌╫╫╪╫╪╪╓╫╪┘╓╥┼ЪdD:740>\О╖╠╒┌┌╫╪┌┌┌┌█▄▌██▄▌▐▐▐▐▌▄┌┌┌┌╪╫╪╪┘╓╓┘┘╪╓┘╪┌┘╪╪██╪┘┌┌┌┌┌┘┌┌┌▄▄▌█┌▌▄▄▌▌▄▌▐▐▐▐▄▄▌▐рр▌▐▐▀с▀▀▐▐▀рсрсррссррс▀▀ссссууфхффхххххфччччцчццчшшчшшъщшшшшщщшщшчшшъщщшъыыыыыъъшцфтр▄┌╫╛РztuНЧЮдим░╡╡╣╝└┬┼╔╦╧╨╬╬╬╧╨╨╨╤╥╤╥╤╙╤╤╧═╞╗л■                ╤ЕЖЗИКЛММПЛОНОСРХУСРПРПННОПРНБ}{{~}zsvsrpqqnmprqqtxwst}ЕД|sbbkuД~fZZ]`bil~Щ╠▐ф╪вДte]Z][_irojpvyxwp\RQT_cWC@O\YOJNZ[OGMW\TFGR[YML]icYYclg`adih`WU_f_TN]hcPR_geYV\bc[S\fkaVWgl`QUbk`NS_kl[OQZaff]QRY`gf_`jqsyГАsp^Wa{ХТtyЛЦЙowzuaYkЖБuuxxrnppld^bcVAFKS]`_cfgda_\[_b`VGQ\^\]VLJHILOSVWX^`[PLUZ^_`__\V\mvrnf_ije_XLV\`_`^WGCDKUZVOMHDBCJLMVep{ujhopfVRQ^ntiSYЗжмЩ}bWIA97DMaМиаЕgXtЯ▓ЭАi[SZ\TLTksjb\V\eplcdjv}~{~БАw^Sdprolkjllh]RMLPcЖЩЦ}i]N[ntdSTOIJSTMY~Я┬╨╨╧╤╥╤╤╤╤╥╙╙╘╘╓╘╙╘╘╘╒╘╓╒╫╫╫╓╙╥╤╤╥╘╙╥╘╙╙╥╙╘╒╓╘╓╓╓╙╥╘╒╘╥╙╒╓╙╤╙╤╤╨╬╬╠╩╞╞╚╚╟╞╟╚╚╚╔╩═╧╧╨╥╥╙╤╒╓╫╓╘╓╫╒╘╒╫╓╓╒╫╪╪╓╪╪╪╪╓╫╪╪╫╫╪┘┌╪┘┌██┘╪┘╪┘╪╫╪╫╫╒╓╓╪╪╪╒╠йrM;6/.7M~к┼╙┘┘┘┘┌┌┌┌▄▌████▄▄█▄▐▌▄┌█▄▄┌┘┌┘┘╒╫╪┘╫╓╓╓╫╪╪┘┘┌┘┘▄█┘┘┘██┌┘┌▄▄█┌▄▄▌▌▌█▄▄▄▀▐▌▄▌рр▀▌▌▐▐▀▀▌▌▌▐▐ррссссттрсррсстууууффффхфхххццчччццчцццчшчщщшчшшщъшщщщшшъъъщъъъыщщщщшцхс▀▌┌╘╜РxquНЧЫгело│╡╕╝└─╟╩╠╧╨╧╧╧╨╨╨╧╤╤╥╨╨╤╤╨╧╠╟╗м■                уЕЗЕЗИЙКМПНПРСФФЦУСРППППНННПМ~z||}|xusuqpqoppqoptzyttyБД|na^cmwБЖqd`^^`hk~Ч╟┌▐╤ЭГrc]\_]alrk_iv{|{p[TVY^_TD@P[XOLPWVOLNW\SEHRXVPN]g_ST_gdahlmlaUW`d_TR^i`QS`idYWZ_b^V\hjaVYejbVWdl_OR`ij`OMW`eh^QSZaij]YhusvАВyp_S]zУРvyКЦОvuvr_XnКЖru}{pipqje`baWIKOT[`_beeeca][`d`UIP[]^]XJFGHJMQSUUY^[OLSY\]][\YWZkxwuoc^^]\WPU\_`^ZSEDFP[\XNJC?BHKNOU_ltunknneUOO\jqbN`ПйлХz_UF>:?MVY]^aaUJLMRW\ZULFIR^inqqo^JFIMNLPnЪ╖зКo^WN@76=RpРвЯЬЫЭжп┤│еТ}ebqКШШЩЫЩФВjZWWXSOORV[XMJUXUNLNZxРХЗfJKMIDDLRyЫбКl_OLZd_WTTKFKVUSlП╡╦╬╤╙╙╘╙╙╥╤╙╥╙╘╘╒╘╓╫╓╒╒╒╒╘╥╥╥╥╥╥╓╫╓╘╘╓╓╓╥╘╒╒╒╙╒╫╘╘╘╫╓╫╓╫╫╫╫╥╘╙╥╨╧╬══╚╟╩╩╔╔╚╚╚╟╟╚╔╠═╬╤╤╥╨╥╘╒╘╘╘╘╘╙╘╘╓╓╒╓╪╪╪╓╫╪╪╪┘┘╪┌╪┘██┌┘┘█┘┘┘┌┌┌╪╪┘┘┌┘┌┌█╪╪┘┘╪╫╤╛Пa?:810=eЦ╜╨╫┘┌┌┘┘┌┌█┘┌▄▌▄▄▌▌▌▄▄▄▄█┌██┘╫╫┘┌┘╫╪┘┘╪╒╫╪┘╪╓╪╪╪╓┘┘┌┘╫┘┌┌█┌▄▄▌█▄▌▌▌▄▄▄▄▄▌▐▐▀▀▀▀рр▌▐▐▐рррр▀▀р▐▀рр▀сср▀стсссуфцуухххухххххццццччччцччччшъъщшшшшшшщъъъъщщъъыщщшчфст▀█╪╘┼ЦБuu|ЙУЪвжйо▒╡╖╗╛┴╞╔╦═╧╨╨╨╨╤╨╤╙╤╤╧╨╥╤╨╧╦╞╗е■                 ╠ЗЗИКЛММОСПРОСЧХФУПНЙКККСРЖ}Б~}||yzvsrrqqqpooprqrv{{ww}ГИБnbcimi`XZ`eehsГЩ╛╥╙╢Зiacirwl[WX_jsric]^__`\VNJOTPGGR]ULJPW[TGENVVKKVa^ONYdd\`fikhb`dhbVOVbcVPWdi`VUXabVU`ecYQXheYQYejYTZbfi[P^efgg^Uar}xl\UawЛЗsК~^OYckВМszЙПzrj`XZhyЖyonnkf^XTWbfMKU^`dghha[_db^^be`NMVZZZWMHJQROPUYZ^cd\MLV[\\]\]\\Y_mzxibbbc`PHKJFBAISY\__a^SKMNSWZXPFBDN\emrro]KGJNOOUvа╡ЬДrk^O>65?WwЦо║└╟╧╫█╪╩║ЮВh^kДНОМЛЗАqaWVWRMMQXaaYPNU\WMKN]zРФИdJKOKBCJV~ЭаЙi]ON[ifVRSLHMSUTnТ║═╧╨╙╘╘╘╘╒╙╘╙╙╙╙╙╘╓╫╫╘╘╒╙╙╤╥╙╙╘╥╥╫╫╘╘╒╓╓╥╓╒╒╘╥╘╘╘╘╘╓╫╓╒╫╪╫╓╙╒╥╙╧╬╬═╦╟╟╔╩╔╔╔╔╚╟╚╩╦╠╠╠╨╤╤╨╨╙╘╥╥╘╘╘╘╘╓╓╫╙╓╫╪┘╫╪┘┘┘┘╪╪╪╪┘█▄┘┘┌▄▄█┘┌┌┌╪┘┘┘┘╪┘██╪╪┘┘╪╫╥╟аpH98428XЙп╦╪┘┌╪╪┌┌┌█┌▄▌▄▄▄▌▌█████┘┘┌┌┌╪╪┘┘┘╪╪┘█╪╫╓╫╪╪╓╪╓╪╓╪╪╪╪╫┘┌┌▄▄▄▄▄┌▄▐▄▄┌▌▐▐▐▄▐█▀▀▐▀р▀▌▐▐▐▀▀рр▀▐▀р▀ррссссртссстухтуфуффухххххцчццчччччцчшшчшъщшшчшшшшъъъъщъыъыщщщчфсс▐▄┘╥╞ФБss}ИФЫагкп▓╢╕╗╛└─╟╔╦═╧╨╨╨╤╤╥╥╙╙╨╙╥╥╤╬╦┼╜д■                 сЕДЗЛММРССНОППУРСРПРМЙЙМПРКВГБ~|{zwwrqrqpmstqnpsrtvz}~zuw}ВВzndimh_WW]fhhtЕз╦┌╫┐ЛiacjvvgWSV]hpohb_becc^WLMRUQGGUaZHGPZ\TGFPZUIGV`[NNZdbWU[dgcadhmfVMWecUOYdh^SRY__WXafdXOZhgZU\bcXTX`hdWV^ffff]Q^qyvm]O_vЖВu|Бy^PZdkМАvyЙОzrj_UXiwБ{nllld^WSWegLHT]__gihea]a`_aef`NIY^\XTNJINRONQY[\_b\OMVY[\\]\]\X\mywkb`ce`SKIGCABPXZ]``a^OMNRVZ\UME?BL[bjorm\OJLQOMYАЬбСБ{reO?86?[Н┐▄щёЇўЎЎЇэ├ЭБb[`juwrrpmf]VSUVPMTakrgQPY\TLMPbzКРЗdIILIEGLXАЯЯЖg\RR]c_WTQJIOVSSnФ╛╠╧╨╤╘╒╘╘╙╙╘╤╙╒╙╘╘╫╫╫╓╒╓╘╘╤╥╙╙╥╤╘╓╒╘╙╒╒╫╒╓╘╒╒╙╘╘╒╘╘╒╓╫╙╓╫╫╘╙╙╙╥╨╧╧═╔╟╩╩╩╩╚╦╩╩╟╟╟╔╦╦═╧╨╤╧╤╥╘╘╙╙╘╘╘╘╓╓╓╒╒┘┘╪╪┘┘┘┘┌┌┌╪╪┘██┌╪┌█▄┘█┌┌┌╪┘┌┌┌┘┘█┌╪╪┘┘┘╫╥═┤{R?:604Lyб╟╘╫┌╪╪┘┌┌┌┌┌┌▄▄█████████┘█▄█╪┘┘╫╪╪╪┘╪╫╫╫╫╪╫╓╪┘╫╫╪┌┘╪╫┘┌┌┌█▄▄▄┌▄▌▌▄┌▌▐▀р▐▐▌▐▐▐▀▀▌█▐▀▀р▀рр▀▀▀ссрррсссстсссттххуфууфффхццццчццчцчччццчччшщщчшшшшшщщщщшъщыщщщщщчфсс▐▄┘╥╞ХВtu}ЙФЩвжмп▓╢╢╝└┬╞╟╦═╬╧╨╨╤╤╨╤╙╙╤╧╤╧╤╤╧═┼╜е                  юДДИЛММРРСРСФСФРФТРМММЛМРСЛЕДА}|{xyvppqqmptrnlnstsyАА{txyВЗГzkkmh_WV\ccfsЗл╤▀▌├НiejpurcWUW\djifegjhjh\SLMTVQIIWaTILQWZRHKRVSJLW`YNOYb]TRV]gggjnphVMYebUNZhg^TRYdbWVajfXOZedYS]feXVZckjZP^klheZP]r~{p^QZqБxzu\RZgj|ИЕzxДП~tk`VWfvywsnkje^VRZjgLHVadabhheaaa`^ade_PLZ]][TMEIOSTSSW[]`bZLNUXZ\]][\[Z[i}zlfabb`RHFECCLX\]^`b`[OLOVY\\SG@=BMU^fopl\MJLMNQ_ЙЯЪИ~|xhTB:8Aaк▄Є∙···°Їъ╘╖РrZUUW]fmvtmcZUW[YUS^rБГnUR\aVJIRfГЧЫЗcJKMICDK[ВбЯДg\QO[idUQQLHLTRTqЦ╛═╬╨╤╥╘╓╫╒╘╘╥╙╘╒╒╙╒╒╓╙╙╘╙╙╨╙╘╘╥╥╒╓╘╙╙╘╓╫╘╓╓╒╒╨╘╙╘╘╘╫╫╒╘╒╫╫╓╙╙╙╥╤╬╬╦╦╚╩╩╩╩╚╔╟╦╟╟╚╔╩╦═╨╧╨╧╤╥╙╙╥╙╘╒╘╓╫╓╫╘╫┘╪╫╪┘┌┘╪┘┌┌┌┘┌╪┘╪╪┌█▄┘┌┘┘┌╪┘█┌╪╪┘┘┘╪┘┘┌┘╪╒╥└Л]D;<2/BkЧ┐╧╫┘╪╪┘┌█┌┌▄▌▌███▌▄█┌┌┌┘┘▄▄┌┘┘╪╪╪╫╫╪╪╫╘╓╫╫╓╫╪┘╫╫╪┘┌╪╫┘┌┌┌█▄▄▄┌▄▐▄▄┌▄▌▀▌▌▐▄▄▄▄рр▐▄▀ррр▀ррр▌▀срр▀сттсрттсстуфхуууууффхццццхххчччччцччшшщшшцчшшшшъщъщщъъыыъщщшчхрр▀▄┘╤├ХГutЛХЪгжн░│┤╖╗└┬╞╟╦╠═╧╧╨╬╤╨╤╙╙╙╨╥╤╤╤╧╬╞╝е                  ўЖИЙМПМСПСОПОНТСФФСНММЛКЛНЛЕЕББ}{zwwusprqnptuqortutw~В|ruxАЙЛГqonh^RS[`bdrЕе╧█▀┼Рlilpsl_WVW[ejjjjlnlkeYPIOYYNFKYaQFHS[ZOHMTWQHM[`YNOY`]SOV]ccjvzvjVLZc]SSZfi]ST[a_WXaheXQ\b^TS_hd[VZclh]V_fkkfZM]s~{qZKXkЕ{uyq[S^ikyЖЖАz}ЗВuk_TWepzxrmnmc\TT_mgNJV``abehfeb``\]bc^PP[b`\VMHKPZ[VSVZ[``YHIUWZ\\[]][WXfz{ngeba`OGFFHMTX]^____YOMPV[\ZOB==DLQ\ckpl\LGKMPVjРеТЕАБ{mUD:8FnЯ▄эЁяьу╬╖дУИubTMKJRjВЕВudXW\b^QSjГНМrTT]aVLLPiИЪЮЕ_IKKECEG\ДбЮБj^QR[b`WURJHQVQUtШ└╬╧╤╥╙╘╙╒╓╘╥╤╙╙╘╘╘╓╓╓╙╙╓╓╘╤╤╥╙╤╨╙╘╘╥╙╙╒╫╘╓╓╒╘╙╒╙╒╘╘╓╓╒╙╘╓╫╫╓╓╙╙╤╨╬╬╠╩╦╦╩╔╔╩╔╟╟╟╔╚╔╔╦╨╧╨╤╙╘╘╒╘╒╘╓╒╓╫╫╒╘╫┘┘╪╪╪╪╪╪┘┌┌┌┘┘╪╪╫┘┌█┌╫╪██╪╪┌█┌┘╪┘┌┌╪┘╪┌┘╪╫╫╚ФiJ:<50;]Л╢╠╓┘┘╪┘┌█┘█┌┌█┌┌█▄██┌┌█┌████┌┌┘┘╫╫╪╪╪╓╘╫╪╪╒╫╪┘╓╓╪┌┘╪╫┘┌┌┌┌█▌██▄▄▄▄▄▐▐▀▀▀▐▐▌▐▄▀▀▌▌▀▀▀ррсср▐▐▀ррртттсрттсртууттуууффххцччццххчцчччцчшшшшшщшшшшшшщщшщщъщъщъщщчцхт▀▌▄╪╨┬ХГwuЛЦЫгжл░▒╡╡╗└┬┼╚╦══╠═╬╬╨╨╥╥╥╨╧╥╥╥╨╧═╚╗е                  ¤ЕЗЙЛММППРРПРОСППРСНМЛЛЙКЙЖАГБ}|wuusrsqmpsrnlruurv|А|wvv~ЖМИwqpl_UUZ]`doЕб╬▄р╚Рmlt{rdZWWY^gkklmqrppeYPLRXWOGL[aOFLTXZQINWXQJN[`XKNYb\SOV_fip~Г}kVOZeaSP]gf]SS[e^UWbjfWP[dbWS_kf[WYcljZP_knmhZOZoБВqYNXhzЕ~vxn[TclkuЗК~r{КЗwk_TWcmtxsmjib[UWbneLLW`babfggdb]^Z`df]PNZcc\TLFJOY^XTWXY`aXLLTVY]^][\\XWc|~nhbba_ODFGLSY^_`__][ZKKRW[ZWJBABGNRYainl\JGLMOWrШиУГ|ААkTD;:EdЛк╖пЬРКЖД}skbXOJKKVqРЯОxeWQ\g^RYtОЫФqXW`dWIJPiМЮвГ[KNNICFI_ЙвЭ~j\KKZg`VTPJFPVRUuЫ┬╬╧╥╥╘╓╒╒╒╫╘╥╙╙╙╙╙╘╙╘╙╙╓╒╙╨╙╓╘╙╙╓╒╙╥╥╙╓╒╥╘╙╙╙╥╒╙╘╙╙╓╓╫╒╫╓╓╓╓╒╥╙╤╨╬╠╠╔╩╩╩╔╔╦╩╦╚╟╟╚╔╩╦╬╬╨╨╤╥╒╒╘╒╘╒╒╒╓╪╓╒╫╪┘╪╪╓╓┘╪┘┘┌┌┘╪┌┘┘╪┘█┌╪┘┌┌┌┘██┘┘╪┘╪┘╓╫┌┌┘╪╫╓╠мuQ@@54:N{м┼╘╪┌█┌┌┌┘██▄█┌█┌██┌┌┘┘┘█┌┌┘╪┘╫┘╪╪╪╫╪╓╒╪╪╫╒╓╪╪╫╫╪┌╪╪┘┘┌┌┌┌▌▄██▄▄▌▄▄▌▄▌▀▐▌▄▐▐▐▀▀▌▌▐рррррр▐▌▐▐▀ррстусрттррсфхфтуууффхххххццхфцччччцчшшшшшшшчччччщщшшшщъъыыыъшхфтр▌┌╫╤├ЦВvtЛФЪгжн░▒╡╢╗└┬┼╟╦╬═╬═╬═╧╨╨╥╘╥╨╥╥╥╨╧═╟╗г                   ЗЛЛМОМПППОММКНМПССНКЙЙКИЕВББ~|{zytssrooqqpsrpnpuxtv{}{vuprw}ГАwokbWVZ^_doДг╦█р╚Пorz{k_YY[\`hmos{usrocUNJP[YNGN\aOFIUYXJHQY]SIN_bSJOYb[PNV`fkzЕЖ}iTS]cZSU]ef\UW]a\VXbieUS\`]VV_hd[VXdigZUaouplYMZj{БrWLWfwЖsulZWivtvГКВuxКМ~m]SU_irvplki`ZUXcmbKJW_baabfgedaa_dgh^NLW^c^WMFDLSVXW\YX]^WKOWY\_^^^^]WWcy}pkhca]RIIJPX^^^^_^ZUUKHQX[YSB?AELPUZ`hnk[MHMOR[~Я░ШВsrqeOE<:CXlvБyqou|Б~o`YRLFEGWwЪбПxcVQ[h\P[yТвУoX[cfVKKQpПЬаZLNMICFJaКдЫ}gXNPZ`]USNIIOSPVwЬ┼╨╤╥╙╘╒╒╓╓╒╙╥╙╘╙╙╙╙╙╘╘╘╫╒╥╤╙╙╘╘╘╘╘╘╙╙╘╓╫╓╓╒╘╥╥╒╘╙╥╘╒╓╒╘╓╫╫╓╘╙╙╥╨╨╧╬╠╔╔╩╦╩╔╩╔╚╟╞╟╟╚╔╦╬╬╧╤╤╘╒╓╫╒╘╘╘╘╫╫╫╒╪╪┘╪╪╪╪╪╫╪┌█┘┘┘┌┌┘┘┌█┌╪┘┌┌▄┘▄██╪╪╪╪┌╫╪┘┌┘╫┘╫╧╖ГX<@733ClЮ└╥╫┘┌┌┌┌┘┌┌┘┌██┌█┌┌┌┌┌┘┘██┌╪┘╫┘╫╫╫╪╪╓╫╪╪╫╒╫╪╪╫╫╪┘╪╪┘┌┌┌╪┘▄█┌┌▄▄▄█▄▌▐▐▐▐▐▐▐▌▐▀▀▐▌▐▐▐▀▀рр▐▌▐▀▀▀▀рутссттррууфусуухуффхххххххфчччччччччччшщччшшчшъшшшшшщъшъщщчхфс▀▄┌╫╙┼ЧВwt}КЦЩбжм░▒╡╣╗└┬─╟╩╠═╬╬╬═╧╧╨╥╙╤╧╤╤╥╨╬╠╞╗г                   ККМНООРРСПМНМНЛНРСОЛЙКИЖДББАА{{yvuuurpsrrssnnqqutttx|ywmilt{ДБqi_ZYZ]]anДб╩▄с╩Уuvzxc[[ZZ[djnpt{yutn`RLLOVXMKR\`KINUXVHIS[]TLP\^UKN[aYTPU`flГОИygSR\f]SQ\gf^UV\d]UWcjeVU]d`XW_lgXRXdkfUOaquqlYOYhsxpWLUewДВysiXWmАwtАЙЕxyГМБn]SS^gourgde]WU[ej]KKYbedebfef`_a_ceg^NIU\`aZLEDINNORW\]^^VHOVY\_`^_^\XVavyrjfdb^RFMSY\^a``]ZWUUGHQX[WL;;AJSVUY^fni[MLNRVdИв│Ш|kgb]MC:9CXjt{pdhuИЧКmWTPKGEGZ|ЬбНu`TRZaYQ_|ФзХnW\giWJIUsФбЯ~YMNOJBHLfМвЩzdWLMW`[RRMIHOUTXxа╞╧╤╥╘╘╘╘╘╓╓╙╙╘╒╘╙╙╙╙╤╤╒╙╒╙╙╙╥╫╫╓╫╓╘╘╘╒╓╓╓╓╒╙╤╤╘╥╥╥╘╓╫╫╘╫╫╫╓╥╥╙╥╨╧╧═╦╩╦╔╩╩╔╩╩╔╟╟╟╔╩╔╩╠╧╧╤╤╙╘╒╒╒╘╙╙╘╘╓╫╒╪╪┘╫╓╪╪╪╫╪█┌╪╫┘┘┘╪╪┌█┌┘┘█┌┌┘▄█▄┘╪╪╪┌╪┘┘┘┘╪┘╪╤└Пd>>662>cЧ╗╤╒┘┌┌┌┌┘▄▌▄▄█▌██┘█┘┘┌╪┌┌█┘╪┌┘┘╪┘┘╪╫╓╫╪╪╪╓╪╓╫╫╫╪┘┘╫╪█┌┘╪╪▄███▄▄▄██▌▐▐▀▐▄▌▐▐▀▀▀▌▌▀▐▐▐рср▀▀р▀рсссутртсссрсууттфуууухххфхххххчшшччшшшшшшщчцшшччшшшъшщъъыыыъшцхуу▀▄┘╫╘┼ШВuu}МЧЪвейо▒╡╖╗╛┬╟╟╦╦═╠╠╠╠╧╨╥╙╥╨╨╥╤╥╨╧╧╞╗д                   ЮЛОПОППРППНМОККНРПМЛЛПФЛГВ}z{xstsrmossqqusssuwutsu{|w`]`iuВvlb[Y[_^`nВЯ╔▐т═Ш}А}p[XYZ[_hmnosy|yup_RMLR[WKKT^_IHPZ]SEKS\ZQGO_^RJO[aWRPVcgkАОЗufTT^c\PU\eeZRTZ`ZTXaidUT[b^ZZ`eeZRXcidVS_oztmWPXfr|qVOVbsЕЗ{uhXVnЕyo~МИtqЗСЖo]PU^dkqrlfc_ZW^im^OQ[ceebafedb_^`cef]NKSZ_`\QECILLNRTX\^^THOVY[Z]\_^\YYavБtofba\SJPVZ___]][URPTHHQY\UF;JT[ZXY^fokYOKQT^wЪп│Фo[[[XHA75A]ГЫСn\hМелОhQOMFDJNeЛлвЕoZPQUYTShЖа▓ХgXcqnWGIYzЧаЦvTNQQE>GMjТдХubVNLU]YOROGFOUSZ~и╟═╤╙╙╘╘╘╓╓╫╘╘╘╘╘╥╙╙╙╥╤╙╘╓╓╘╘╘╓╫╫╫╓╒╘╓╓╓╒╒╓╓╒╥╥╒╘╘╘╓╫╫╫╫╪╫╫╓╒╙╙╤╨╨╧╧╠╦╦╩╠╩╚╩╔╚╚╚╩╚╟╚╔╬╧╨╨╤╤╥╥╘╒╒╘╘╒╓╓╒╒╪┌┘╪╫┘┘╫╓╪▄▄┘┘█▄┌╪┘┌▄┌█┌┌┘╪╪┌╪┌╪┘┘╪┘╫┌┌┌┘┘┘┘╒═░{L=<839Ryи╩╘╪┘┌┌┌┘┌▄▄▄█▄██┘┘███┘┌┌┌┌┘┌┌┌╪╫╫╫╪╫╪┘┘╪╫╫╓╫╫╫┘┌┌╫╪┌┌┘╪██┌┘██▄▄█▄▌▌▄▄▐▐▐▄▌▐▀▐▌▐▀▀р▀рсср▐ррррссстррттсстсттуухфуутфффхцчццчцццчшшчшшшшчцшъшхцшщщщъъыыъъъшхфус▐▌┌╫╥┼ЧВvv}ЛЦЫаекн▓╖╣╗╛┴╞╚╚╔╠══╠══╬╨╤╥╨╨╥╤╤╤╨╠╞╣г                   ╠КМННМОРПНННЛКМНССНМНФУЛЕДА|z{{zwusqqooqsnmsuuqrvytop}И~l`TXcq|Аui`\]__bnАХ─█р╔ЮИ~qcZZ\_`dkkedl|ЗК}lXONOW]UJMX_ZFLT[YPFLV\VMHPb\MKS^_TPOW_c_gilka[`df[TX_ddYTU]`]UYcgaQV[_]XZ_ef]UYdicON[nxyoUPWamunPP\bmБОysgXWlЕ{oxЗИtqЖВraNX_bfnphb]XVU^gl]PQ\fjhdbaehf`]]_ef]PLQW\\[QDFKLKLUYWX]]TJLRUXZ[\^^\XV\qА~xkb`ZOHPX\^`^\WQLIKMIHQUTMB:ANY\YVS[eifZLENVc~Я▒нЙeRX`ZJ@43C`ИЯРjYmТлйЛbKLLHDISnФ▓вВlWOOSYSUoРл╡РeZiwpYMJ]}ЧЮФtONTOFBFOmФдФr`UNMSXWOQMGHORO\Ак╔╬╤╙╙╘╘╙╫╫╘╙╘╒╒╙╙╙╙╙╥╥╘╘╓╓╫╘╘╘╥╓╫╓╘╒╓╓╫╘╒╓╫╓╙╘╫╒╘╘╓╫╫╫╫╓╓╒╙╘╙╥╤╨╤╨╧╠╦═══╩╩╩╩╚╚╚╚╚╟╔╠╬╨╨╤╥╥╘╘╓╓╓╘╘╘╓╓╘╒╪┘╫╫╪┘┌╪╫╫┘█┌┌▄▄┌┘┌▄▄███┌╪╪┘╪╪┘┘┘┘┘┌╪╪╪╪┘┌┌┘╪╤╣ЗX@=;67GkЬ─╥╓┘█▄┌┘┌▄▌█┌▄▄┌┘┘▄▌▄██┌┌┌┌█┌┘╫╓╫╓╪╒╓┘┘╪╓╓╫╪╫╪┘┌┌╪┌┌┌┘╪██┌█┘┌█▄┌▄▄▌▄▐▀▀▐▌▌▐▀▌▌▐▀▀▀▀ррс▀▀сст▀рссссрстрссрттуфхфуффххфхчццччцчцшчшчшъщшччшшщччщшшшъъыъъъщшффус▀▌▄╪╙╞ЩГwv}ЛХШадим▒╡║╝╛┬┼╚╔╔╠═╬═╠╧╬╨╨╤╤╨╨╨╥╥╨═╞║д                   рИКЛКЛНРОНОММЛЛНРТМККМЛЙЖЖГ}zz{zyzwwvqqswpjswuqqy{wonwГГueVU^erxph_\_`dl~У╝╙╫┴ЪДxi_\]]]_cjjb^i~КО}gTMQSV[TLMZ_UFLUYVNGKW\UMFP_ZLGV_]ROOV^_XU^iia^dgi\RV`gdYUW_e[OWag^RU[a_XX`id[W[emdNO^m{~qTPVakoiWW`em~Нzth\^lД~vvАЖwoyГВt`R[abglnhe\XUW]bg\MLWcilfbaefda]]^ad^OJQYZYVQJJKMKNUYZZZZTLKNPSUXZZ[ZVWXl|{tof`YKGPY]^a`]VLEGNNHKPRPJ<9ERZ\ZTOUbjf[JDKVfДапкА\O\j\H?57DaЙЮЛcXrЧпйЕ\KNPJHKVuЫ╕дhVLLRVOUvЦ░╢О`\n|qVHK`ВЬбТnMNVSE=IOqЧбРo^TLKRYXNPMFGPUW_Е░╔═╤╥╘╘╘╘╒╓╓╥╘╒╓╙╙╙╘╓╙╒╘╥╓╒╓╓╒╓╓╓╫╫╓╘╫╓╒╘╘╙╙╙╥╘╓╒╙╘╓╫┘╫╫╓╫╫╘╘╙╥╤╨╧╧╬╩╦╠╠═╔╩╦╦╩╔╔╔╚╟╚╦╬╧╧╤╥╙╘╘╫╫╓╒╒╓╫╓╘╘╪┘╪╪╪┘┘╪╪╪╪┌┘┌██┌█┌▄┌┌▄┌┘┌┘┘┌┌┘┘┘╪┘█┘┘╪╪┘┌┘┌┘╥┴ТeGB>73=[Ф╛╠╒┘██┌┌█▌▌▌█▌▄█┘┘▄▄▄█┌┘┘█┌┌╪╪╪╪╫╪╫╘╪┘┘╫╫╫╫╓╓╫┘┘╪╪┘╪╪╪╪┌┌█┘┘┌▄▄┌▄▄█▄▄▐▄▄▌▌▀▀▄▌▐рр▀▐▀рр▀сс▀р▐▀рссррттррстууухфутфццххцччхччцчцчшчцчшшщцчшшшшшшщшшшщъъъъъшхуттс▐█╫╘╞ЫГwwzКХЪЯдйн▒╡╗╛┐┴┴┼╟╩╦═══╧╧╨╨╤╥╤╥╤╨╤╤╧╠┼╗и                   юЙКМКМПРООНЛЛКЙНСТОННОЛЖДЕИАzzyxuurqsqpqusorwxtqxxont|Б~kTSZ^kx~|ungabdlyО▒╔╦░С|k`_\]]_bgmg\ZjАКВycPMOSZ\SJMY^SHNV\VIEMX\WHCO\XLJU_\RKOY_]QOXfhdbhlgYSXagfWUZabZRWbf^RW[_][Z^fdXSYeldNR^mw|oTQW^hqhOXglnwК|wh[Zh~vvzzstwyr_P[iggmojg\VVZ_``[QNU_hifbacfda^\^bc]QLRXZVOMIKLNLMVZ[]^[TJIJLMORRTTSRQShxxqib_XKGPZ_^__ZRFDFPRLHNSNC=>IU\\XNJR^gfZFCLXkКвнЫuSNbo^KA46DbКЬВ_YxЬ░е~WINLHGMZ{д║а|fULKOTNVzЪ╡│Й^_s}pWMMcЖЫЯПjNOUPDAFRxЩбНl]RMJPUUORNFHPSO`Й▓╦╨╤╥╙╘╘╘╒╓╘╤╘╓╫╙╙╘╒╓╓╓╒╘╒╒╘╒╓╒╘╫┘╫╥╥╙╒╒╘╙╓╫╓╘╫╓╘╘╘╓╫╫╓╫╓╫╫╘╒╥╥╨╨╨╤╨══╬═╠╚╔╩╩╔╟╚╚╚╔╔╠╠╧╬╤╘╒╘╘╓╓╫╒╓╓╓╒╙╘╪╪╪╪╪╪╪╪┘┌┌█┌┌┌██┘┌███┌┘┘┌┘┘┌┌┌█┌┌▄██┌┌┘┘┘┘█┘╒╔дuJ>A:58RЕ▓╩╙╫┌┘┘┘┌▄▄▄█▄█┌╪┌█▄█┌┌┌┌┌█┌┘┘╪╪╪╫╒╘╫╪╪╪╓╫╫╫╫╫╪╪┘╫┘╪╪╫╫┘┘█┘┘███┌█▄▄▄█▄▄▄▄▄▌▀▐▌▐рр▀▐▀рссссрр▌▀рсттсутсстсусутуутцччхццччхцчччхчшшччщщщцчшщщшщшшшщъщъщщщшчххттр▌┌╫╘╞бДvuyЙФЪЯдйл▒┤╗╛┐┴┬╞╚╩╠╠╧╬╧╬╨╨╤╥╨╤╤╤╨╨╤═┼╗л                   ўИЛММОРРРРМЛЛЛМПРСММЛКЕАВЗЗА}zzyvussqqqquqmsxwrtw{zros|БАt^XZ_hs{А|rjecdiwИЯмеХАpf_\[[[_chibWXhЙАp`TQRTYXRJQ^bPCNWYUKFNY\THCO[WJJX_]QMOW][POXdgeiopfXPWaebYUZefYPXee^RV^d^WXahbWRXelcOW_iv}mSRW`gniX^fopsЙБxi`]e{АwtzГ}qqvyp_Q]klijljg^YY]a^cZOMT[egfbaadec\\^aa_LKSYYWOJIKOQNOSX[^]\TJHHLLKMLNMNOPPe|~shcbYJFOX\^^XUKDCHRVNHLKE?8>MX\ZWMJP^ihYFCLYoОЮаНkOPlv_LB78DbЕТzZ[~Я░аySINLEEM]Гм╗ЭxeTLKMPMY}Ю╣▓Г]`upXIMgЛадМdNUZVD>FVzЫбКi[RLJRYQIQMDENTUbМ╢╦╬╤╤╥╙╙╙╒╓╒╥╘╒╘╙╥╘╘╫╒╒╒╘╒╓╓╒╓╓╒╫┘╪╒╘╒╒╒╙╙╙╙╒╙╓╓╫╘╘╓╫┘╫╫╓╫╪╒╘╥╥╨╨╨╧╧╦╬╬╬╦╩╔╔╚╟╟╟╚╚╚╩╩╦═╧╨╘╒╘╘╘╙╒╒╓╓╓╒╘╒╫┘┘╪┘┘┘╪┘┘┌┌╪┌┌┌┌┘██▄┌┌┌┘┘╪┘┌┌┌╪┘╪┌┌┌┌┌┌┘┌█┌┌╓╬╕ДO=?;86Gxз─╙╪┘┌┘┌█▌▌▌▌▄▄┘╪┘██┘┘┌┘┘┌██┌┘╪╫╪╪╫╒╪╪┘╓╫╓╫╒╒╫┘┌╪╓╪╫╪╫╫┌┘┌┘┘┌┌┌┌█┌┌█┌▄▌█┌▄▌▐▐▐р▀▀▀▐▀рссррр▀▌▀сстсссутстуутуфуфухчхуфццхфцчччцшшщшшщщшчччшщшщшшшшъъъъъъщшчхтр▀▄┘╓╥─ЯЕvuxЙУЩЯжйн│╡║╛┴┴┬─╞╩════╧╧╨╨╨╤╨╤╤╨╧╨╤═╟╜л                   ¤ЙКММОСРПНМЙЛИКЛНПНОСПИГВДЕА~}{zstpqqqpmsroptxurw{{wtr{ГЖxh^Z`houx{yunjinxДМТТЗug^]\][[_gnh]TXi{Вxj]QPRV\XNMU_aQCLZ]SGFOWYRC@NXSGKYb]PKPX\XPPZdgfktwlYSZadbZX]bbYSYef]RX_b\Z[_fcVQYeibV\bhqxkQRX^ireS_twppИИxi[Xcu~yuw~tmqvo^R]llikkii]VY__]_YQOS]egfea`bde_\]aa_NKSYYVTLJLSQNQV[]^^\VHFKMOMKMNMNOOQb|~ugab[IEOX]]\VOF@DMUWLFFHC<8BQ[\ZTJFN[efVBAM\qЛЪШВdRYtz_MA77C`ЗПrV\Вб░ШrRLNLFEMaЖ▒╝ЪuaSKJLML\ГЯ╗▒А[`xГrWHMkНЮгИaKT[SI@EW|ЮбИhYQKINUTMPJCFORQeН╖╠╬╥╥╥╥╥╙╒╓╙╤╙╓╘╥╥╙╓╫╒╘╒╒╓╫╫╫╫╓╘╫╪╫╘╘╘╓╒╥╘╙╒╓╒╓╒╘╘╒╓╓╫╓╓╫╫╓╙╘╙╙╤╤╤╨╬╦═╬╬╠╔╦╔╩╟╞╟╚╚╟╚╩╔═╬╥╒╘╘╘╘╒╒╘╒╫╫╒╙╫╫┘╪╪╪┘┘╪╪┌┌┌┌┌██┌┘┌┘┌╪┘┌┌┘╫┘┌▄┌┌┘█┌┌┌┌┌┌┘┌┌┌┘╪╨┬ТXBB=86;iЪ╝╬╒┘┌┘┌┌█▄██┌┌╪┘┘▄▄┌╪┌██┘┘█┌╫╫╪╪╪╓╓╫┘╪╓╫╫╫╒╒╫┘┘╪╪┘┘╪╓╫┘┘┘╪┘┌┌┌┌██┌█┌▄██┌▄▌▐▐▌▐▌▌▐▌▐▐сррр▀▀▐сстустстссуутсуххфухцхххччффуччцхшчччщшщщцчшшшчччшчшщщщщъщшчцхср▌▄┌╓╤┬ЯДwuzКУЩадйо│╖║╛└└┬╚╚╠╠╠╬╬╬╬╨╤╤╤╬╤╨╧╧╨╤╬╔╜и                    ЙЛММНОУУРРМОКЛММНМНЫЧЙАБГГ~}}~xyvssrrmqrqoqttstz|{wszАЖБrc\`flosuwtvrqtzБКМЛЗzk`_^][\aikaZVXgy~tf[TTVY]WKMX`^KDO\\PHFNWWPCBKWSJMXaZOLOV\XMM[ehjqz|q]W\ehbZV\egVNYff[SYae^XZahbXTZek^O[cipwjURX_hmdO]yЕwqГКk\Y_s|tt{}wprrn^L]qogfifcYWZ_]]c\ONU[elifb_bdd`_^`b^NMSYZVRMKMSTNPVY[]^[UIIMRSRORQOPPQQ_z}uhee[HFOY]^[RIBAGQZWOIGD?<;FU]\XPHCMZfgSBAK]oЖИЗvYL\x|aO@87B_БГiR^ЙбкРmNMSNEENdЛ╡╗Цq\OFGKLMbИе╛о{Xb}ЗtVHNkТгеЖ^KW^VC22@\vt_VkУджЖ_LQXOEGTpХ╗┤Кl[NEBJHIeОк└еrWhГКsVHRtЧжеА]S_fWA>H`ИвЬВfWOJKSVQQRKCISUTjХ╝╦╨╤╙╙╤╤╙╒╙╙╙╒╒╒╙╥╒╒╓╘╙╓╓╓╙╓╫╓╘╙╓╓╓╘╙╫╓╫╘╘╒╒╘╙╓╙╓╘╘╒╒╓╓╓╫╫╓╘╘╙╘╤╤╧╧╠╦╬═╧╩╟╚╚╔╟╔╔╔╚╟╩═╬╬╬╥╘╘╙╙╒╒╒╙╘╓╓╓╘╫╪┘╪╪┘┌╪╒╪╪╪┘╪█┘█┘█▄┌┘┘┌┌┌┌┘┌┘██┌██┌┘┘┌┌┌┘┌█▄█┘╫╥╗yWHFD6;IwЯ└═╘╓╓┘▄▄█┌██┌┘┘┌█┌╪┘██┌┘┌╪┘┘╪┘╫╪╓╫╪╫╪╓╫╫╫╒╒╫╓╓╘╒╪┌┘╪┘┘┘┌┌┌┘┌┌┌┌┌█▄┌█┌┘┘┌▄▄▌▐▐▐▐▌▐р▐▀▀р▀р▀ртттсстсттууууфуууффхууууфуутууффхчччччччцхчшшцчччшшшщщщщъъщчхус▐▄█╪╙╬├аДwsxКФЫЯжкп│╢╣╝┐└┼╔╩╦╠╠╠═╠═╧╧╧╨═╨╤╤╤╤╤╬╚║е                    ╣НМКООПНЛКЙМЙКННОМОПРКЕДВД{|zxruxsooqprttqqtyyqt|Г~qqrzГИГohdginmd^adhko{Т┤╝╜г|\\^_`fmogXRTV_kmc`dfe_^YTOSZ^THJU_[JBGU\WK@DSWKEMX_VONPVXQLO]fktАД}jZW^be]RT_gbUQ\fgXR[de^WXcjf]_jqm[QcturuhX]fkmrbP^qyqk|ОЗn[TZoВЖwrzЖ}mnnhSLYjmjedd]SVYZX\haRLQY`fihc`_ab```aa]RKRWVUQKIMUUMKUZ]^b^RFJSYZXXYYXWWWUYr}ukhc[DEQVWSK>AHPY^^ZNECA?BNU[\WND:AO^efQ>CMV_ggeTIK\pmXL=14>YvnWTqЧжв}^STYSIJWvЪ╗нДhYNFDIHJjУн╛аlUhЖМsWJVyЧва}XUbdVA=HbКвЫ~eWPIHMTSQRKDIQQTmЦ╛═╨╥╘╘╥╤╙╙╘╙╥╓╓╘╙╙╓╒╒╘╘╓╓╫╒╒╓╫╘╓╓╒╒╙╫╒╫╓╓╓╓╓╒╓╓╓╒╘╘╓╓╒╒╫╪╫╘╙╙╙╥╤╥╤╤╧╠═╬╬╦╔╔╟╟╞┼╚╞╚╚╩═╬╧╧╤╙╙╙╙╙╒╘╘╘╓╓╓╒╫╫╪╪╫┘┘╪╓╪┌┌┌┘┘┌┌┘┘┌┘┌┘┘┘┌┘┘┌┘█┌█┌┌┌┘┘┌┌┘╪█▄█┘┘╫╙└З]DCG<:BmЩ║╦╘╒╘╪┌█┌╪┌┘┘┘┘┌█┌┘██▄┌┘┌╫┘╪╓╫╫╫╘╫╫╪╪╫╓╫╓╫╫╪╫╪╘╒┘┘┘╓╪┘┘┌┌┘╫┘┘┌┌┌█┌┌██┌┌▄▐▄▌▄▌▀▌▄▐рр▀▀▀р▀▀рстсррсссссууттттуфхфууфхчхссттууццччццццччччшччцшшшшщщшщщшшцфтс▐▄▄┌╫╧├вДxtyЙУШажмп│╢╗╝╛┴╞╩╠═╠╬═══╠╬╬╬══╨╤╤╤╤╤═╞║з                    ═КНМОРУПНМЛЛИЗЛКЛННМКЖГВБГА{zzysrvsqpqqsusnmtywpt{~tqs}ЖИЖ|rgikkib^[`cgrЫ┴╩╚кБ[]^_chopcUTVY_ghaahllfcXQOV\_SEJV^WHFKV[VH@FQTMGOZ^UONOW]SKO_ffkvxtfZX^ef]TU`idSP\edVQWee]VXdkc]`ntoYQduwpveX_lqqu`Q\nwslyЙЖp[QYjxВ{suГ~plmgUJXiljec^YTW\\[ag`TQW\]bigeaaabcb_``]RQZ\YUPIFKUXNHRX[[^^UILVZ[YZ[Y[YZYW[nvsngdZCGOVRNIBEMU]^^ZNB@>>JTZ\ZTF>;CSckeRHVWLFOZ]TMLRYZSMQ]ecU]jncZZ^eg]TW_gdSP[deVRX_a^ZYcjcY]oxpYQctxtvfXbruqu^R[jzxrtВo[TZhw~vr{{tpmgTIZjolg_[UTV[]Z^e`SNW__aghfdbbbbb_a`YOMY\\XSIELUWRMQWYZ\]RKLUZ]ZZYZ[]\YV\lywqldWDFMNLFC?LVY]^^ZLAACHQWZ\YO@99GWdheO;CLUZ^]^[LIZe`PG;44;Se[OYyЩЯМmWUbePGMcЕЯ╗аu^SLB>HJSwШ░║ФcZtОНtVL\ШбЦrVYfgU>BKhРдЪ{^SMDDLSSSQJDJONRvЮ┬╦╧╤╤╥╤╤╤╙╒╤╤╘╓╘╙╘╓╓╘╘╒╓╓╒╓╓╫╫╙╒╒╓╫╒╓╘╫╙╓╫╫╪╓╓╓╓╘╙╙╫╫╫╓╫╫╫╘╙╘╘╙╥╥╤╤╬╠╬╬═╦╩╩╔╟╟╟╔╔╟╟╠══╬╨╥╘╘╙╙╒╒╘╙╓╓╒╘╘╪╪╪╫╫╪╪╪╫┘██╪╫╪┌█┌┘█┌█┘██┌╪╪┌┌█┌┌┌┌╪╪┌┌┌┌┌┘┘┌┘╪╫╘╩бrOHKD;;YИл╟╙╘╤╫┌█┌┌┌┌┌┘┘█┌█┘┘██┌┘┘╪┘┘┘┘╪╫╘╓╓╓╫╓╫╫╫╒╫╪╪┘╒╫╪┌╫╫╪╫┘██┌╪┘╫┘┌┌┌┌▄┌┘┌┌▄▄██▌рр▐▌▀ссррссрр▀ссррссссстфустууфуууффхццфттуфффччшчццфцчшшшчхчччшшшщщшчшшшцфср▌┌┌┘╫╤┼зИysyЗУЩгймо▒╢╖╗┐┬╞╩╠═╠╠═╧╧╬╨╨╧╧╧╨╨╤╨╨╨╬╞║и                    юКНННРОООМЛЙЙЙЛЛИЙИВБАВА}{yysrsroorqortqqrwzxttz{ysjhjmzЛЗqmljgb\W\`hpАЫ┴═╠░БY]]bkqmdXVW\`elnsutsrlfWRRZc`OFN[^RECPVYQD@KUTMIP[\QLNRZ^ULS^b\OTfhd_aehh]UV`ibPR]a_VRZab^X[dgbZ\kxpXSaqrnmcXcvАwu^QYgx|vrpsl]Q[fvВАul|АsoniUJYfjkf\VRTV[\[bh`RRY^^bffebaa_`abbcZLNZ_]ZRJEMTVPLPSVX[]REIRY[YZ[[[\\ZY[gx{tleUEHMKGDBHSY\__^XMB?BFUY\]VL=7>N\jndM;?MU]`eohTNW`]LC800:LSOIX{ШЪДeOVgkPHOhЛз╢Ъn[PJA>GJX|Ь│╢Н`[xПОqVK\ГЮжСpV\kmW?AMkУдЦsZSMGGMRNQPGCJRRRwв─╦╬╙╤╥╨╨╥╘╒╙╙╘╓╘╙╘╙╙╙╙╒╓╒╘╒╓╓╫╘╘╒╫╫╫╫╘╫╒╙╓╓╓╥╒╒╓╙╙╘╫╪╓╓╫╪╪╒╘╓╘╥╤╤╨╨═╦╠╠═╩╦╦╔╚╞╟╚╟╟╟══╬╬╨╥╙╙╥╥╘╘╙╙╫╫╫╘╘╪┘┘╪╫┘╪╫╫╪┌╪╪╪┌┌┌┌┌█▄┘┘┌█┌╪┘┌┌█┌┌█┌╪╫┌█┘┘┘┌┌┌┘┘╪╒╬░}PBJI>LXUKHQ[[OKLSY[TOT]_VKSadabehmh]UW`f_ST[daTU[aa^ZZehaY[hrnXR`nuom`Ydt{yw^VYgyБwruwk]U^gq|ВylxАwnmiUNYemmh\TSTWZVW^e_ROYbaadffaa_^_ccee_NJXbaZTGDJOROOVVVY\^PCHRY[YY\]ZZ[\[Yex{vndUGILJCBHNV\^__^WLCCHNVYZ\UH<=BR_hkbK:BMYagkssYOX]ZKA70/6JQJGYzХСz]MXhhTJRlМк╢ЦlYOIBAGIZБЮ╡▓З\\zТНoSJaЙЭгРjT_nkW@?RoХвРpYRJCEMRONLFCHQOU|ж─╦╧╥╥╤╧╤╙╙╘╥╙╙╓╘╙╒╒╒╘╥╘╫╓╘╒╓╓╓╙╘╘╓╓╒╓╘╓╒╓╫╫╓╘╓╓╫╘╙╓╫╓╓╒╫╫╫╘╙╓╒╘╙╤╤╤╬═╬══╔╠╠╠╚╞╟╟╚╟╟╠╬╧╧╨╥╘╘╙╙╘╒╙╘╓╫╫╘╒╪┌╪╓╪┘╪╫╪┌┌┌╪╪┌┌┘┘┌▄┌┘╪██┘┘┘┌┌▄┌┌▄┌┘╫┌█┘┘╪███┘╫╪╒╨╗ЖVFGIB>LrЪ┐╤╤╥╫┌██┌▄┘█╫╪┘┌┘┘┌┌┌┌┘┘┘┘┘╪┘┌╫╓╫╫╫╫╓╫╫╫╓╓╓╪╪╓╫╪┘╪╫╪╪┘╪┘██┌┘┌█▄█┘█┌┌┘┌█▌▌▌▐▐▐▐▌ртср▀сссрсстс▀стсррууурсууфуууфффхццуццххфчччцццфцччччшчцчшшшшшшщщщчххусс▐▄█╪╒╨┼иИys{ИТШбейп░╡╕╗╛├╟╩╦╠╦═╬╬╧╧╨╤╤╧╨╤╤╨╧╨╨╧╟╕е                    ¤ЙОПРПЛММЛНКЛКЛЛКОНИЕВВАА{vvwtuuqqtsporusmq|{vrv{Бyj`Z]k{ВЗrllg[T]afl{Т╝═╬╡ЕYY_ktteWVW\`flmjmwvssmbOPU[_ZLER^]N>CQXWMBAKXUKGR]ZNKNR[]QJU^\RJRaddejqqj[UYci^OR[`\SV\fd]WYhg_VYgplVR^iooqb\bsДВw]SYeuВ{nnqj]Q\cn{В}svztpngUQYdilf\WRV][TP]b\SRYabbbeecca\]`cff^OLSae^SGEILJHJXZXZ]^ODHSY[YZ]][XY[ZWbwxngSFGLIFGMUY]^^__WI@BLTY\[ZSB9>JVajmbI:CNZehnuhVPZ[WL@5-+4ELHFXyНЖoXN[njTFRlОиоСeSKD@?CE[Дб╢пАY_~ФНqUJdНвеЛhT_rpUABSsШеМnYQIDHMOJMLD@FTTZБк╞╦╧╤╤╥╤╤╙╒╘╙╙╘╘╒╘╘╒╒╙╙╓╒╫╥╓╓╓╘╙╒╒╫╓╓╓╙╙╥╒╓╓╓╙╓╒╫╫╓╫╫╫╓╫╫╪╓╙╒╒╓╙╥╤╨╧╦╠═╠═╩═══╩╟╚╟╟╟╚╠╧╧╧╨╘╘╙╥╙╙╒╘╘╫╫╫╒╓╪┌┌╪┘┘┘╫╪█┌┘╓╓┘┌╪┘┘┌╪╪┘┌█┘╫┌┌┌█┌██┌╪╫┌█┌╪┘┘█┌╪╪┘╓╥┴Р`ILRD8FfС╝╬╧╥╪┌█┌█▄▄▄╪╪╪┌┘┌██┘╫╫┘┘┘┘╪┌┘╪╪╪╪╪╫╫╓╓╫╒╓╓╫╪╒╪┘█╪╫╪┘┘╪┘█┌┘╫┘┌█┘╪┌█┌┌┌┌▄▄▄▌▐▐▌▄▌ср▀▀рср▐стсс▀срр▀суууссуууууууфффццуццччцшшшчххфцццччщчшшщщшшшъщщшшчхтт▀▐█┘╓╙╨┼зИytzЗТШбейн▓╡╢╗╛┬╞╚╩╦╠═╠╬╧╨╨╤╤╨╨╤╤╨╧╨╨═╟╗е                     КОНРРНМЛЛЛИККЙККТНКЖЕЗГВ{yvuqqqqrqrpnrtuqtz}yrt{yo`VXcqГЛЖyqjh^X[^ckyС╕═╥╣Жa]cqvq_TVW]ajnifjmtxvp_NPUZ]XLKV\\M?GQXUKBAKYQFGT^[OKLTYWNLT^]ODR_aafp|yiZW\de]JPZ^[QU^cc]XZfi`WZfniRQ^krro`\arЕЗy]WZftБ}oopj]Ydgn}Е}iq|yqnfTTYckjf]XV[^]UO[b]SP]fdbbfeeea^`acgf_MLU]aaUIEJKHGLSWY\b`PGLV]]YZZZZYZ[ZU`szwmiUFFFEENVY[_^]__WKCFQX[]]WM>9DQX`incG:DOYdkib[STW]XM@4-+2CIEFXq}vcQM]oiNAOnОийЖ_SMG??BH_Ид╡кzU`ВЧПqQLhСдгИdScrmU@EVyЪвЛkYRI@EPTMPND>ETS^Е░╚╠╧╨╤╤╤╤╥╙╘╙╙╘╘╒╒╓╒╘╘╙╓╫╫╓╫╓╒╥╥╒╓╓╒╒╓╒╙╥╒╓╓╓╘╓╓╫╫╓╫╫╓╙╓╫╓╓╥╙╙╒╙╥╤╤╨╠╠╬═╠╦═╠╩╚╞╚╟╔╚╩╦╬╬╧╤╘╙╥╥╙╙╒╘╙╓╓╓╒╓┌┌┘╪╪╪┌┌┌┌┌┘╪╪╪┘╪╫┘╪╪╫╪┌┘┘╪┌████┌┌┌┘╪██┌╪╪██╪╪╪╪╪╘╔аoNGQI;>YЖ▓╩╧╙╫╪╪╫╫█▄█┘╪╪┌┌┌▄▄┌┌╪┘┌╪╓╪┌┘╫╓╪╪╪╓╓╫╓╫╘╓╓┘╪╘╪┘┘╫╫╪╪┘╪╪█┌╪╪╪╪┘┘╪┘┘┌┘┘┌▄▌▄▌██▌▄▐р▀▀▀рср▀рстс▀▀▀▀рссттссууутууфхххццффцччччшчцхчцчччччшщщшъъщщшъщъшччутср▄█┌╪╒╧┼иЙzsyИСШбжйн▒│╢║╛┴┼╚╦╠═╠╬╧╧╨╨╨╧╬╨╥╤╨╧╨╧═╚╗ж                     РПННОПППМНЛЛКККИМЛЙЖЕГА}|zxxutuqprsnnsutqr{}ytuzАveVT]h|КИ}tjh^X\_bjyП╡╠╤║ЙdbiuujZTVW_dilgadr~Вym[LMT[]RHKW^[J?JRXTIABNTLFIV_ZNIMRYVNMV`]OFU`ddiwДh\W\fk[IRZ]YRS^ddXR\ef]W[fnfOR^jvxoa[_pЖЗy]SWbrЕhing[WlmpyВ}jox|wpfURZahkd^WT]e`TR\`\UT]eebcfhjhd^^abee^NNU\]]WIDGKIELTWZZ`bQDLUZ[YWZWWZ\\YU]tВynjWHDCGMVZ[\_^^a`WIBJV[[[ZSG<;FT\akoaH?AFcЛж╢гvTdЕЩПoPOkУегЕcVhypR?EZ|ЯбКjWNGCGNNLPPCAHRUaК▓╚╠╧╤╤╘╥╥╙╙╘╙╘╙╘╒╙╒╒╒╘╙╓╒╫╘╫╓╓╙╤╓╫╓╘╘╒╓╒╤╥╙╙╒╥╓╓╫╫╓╓╓╪╒╓╫╪╫╒╓╓╒╙╨╨╨╧╩╦╠═╠╩╦╠╦╚╟╚╚╩╚╔═╬╧╧╤╥╙╥╥╙╙╘╘╙╓╓╓╓╫╪╪╫╪╪╪╪╪┘╪╪╪╓╫┘┘╪╫┘┌┘╪╪┘┌┌┘┘┌▄┌┌███╫╫┘┌┌╪┘█┘┘╓╫╫╪╒╦п{UGJD?=Ozз┼╧╘╪┌┌┘┌▄▄┌┘┘┘┌┘┘┌┌┌╪┘┘┘╫╪┘┌┌╪╫┘┘┘╪╫╫╓╘╒╒╫╫╫╓╓┘┘╪╪┌█┘┘╪┌┌╪╫╪╫╪╫╫┘┘┘╪┘┌█▄▌▄▌▌▌▄▐▀▀▌▌▀рррртср▐▀рр▀▀рссстутутуууфффхфуфчччччччххцччцччшчшъшщщъъщыъъъшчууср▄█┌╪╘╧├йКytxИСШвжйо░┤╖╣╛┴─╚╩╦╠═╠╬═╨╤╨╨╧╤╤╤╨╧╨╧╬╞╗г                     дППППНММКЛЗИЙЙККНКЗЗЕГБАБ}zuuppsroosporxxsryГ~uvxВ}iXTYdrЗДxmh`[[_ch}С╢═╙╝НqlorqfYWVY^flia\fyЗЕ{mWMOU[[QJMX_XGCKTXRHAGSVLBIV]YLGLTWWNMU^\QJWabbnЗ~i]X\ffZKRY]YRW\cc]VZegZT[ekcOQ[htzq`[^mДР{\VYao}|lkldZ\tpowБ|jpwxtneURX`hjf[VTaf`WS_d]QR^hfbdfhliea^^bfd_LMTY]^UGEKMIHNWXX[^^RDJSXXVWYYXX[[WTZrВ~rmWFBIPX\]]^___abWKEMW][\XNB;=LV\ainbI=CO_kqhVLNUXZUMA3,*/=CAEP^d^ODHXc]LCSqНЭЧrRMHA<>BJgПз╡ЪpSfКЪПoOHmУббБ^WnyjO>EZббЙgVPHAGPQMNLCAKOQcМ╖╚╦╧╨╤╙╨╨╤╥╘╥╙╙╘╒╙╓╫╫╒╒╫╫╫╙╓╒╓╙╤╓╓╓╙╙╒╓╙╤╙╙╙╘╓╫╓╫╓╓╓╓╫╙╫╫╫╫╓╓╓╫╘╥╤╨╬╠╠╠═╦╦╠╠╔╚╔╔╚╩╚╔╠╬╬╧╤╘╙╙╙╙╙╘╥╒╫╫╫╓╪╪┘╫╪┘┘┘╪┘█┌┘╪┘┘╪╪╪┘┘┘╪╪╪┘┌╫┘┌▄┌█┌██╪╪┌┌╪╪┘██┘╪╫╫╓╓╬╖Ж]ELLA;GoЭ┐╬╒╫╫┘┘██┌┘┘┘┘┌┌┌█┌┌┘┘┌╪╪╫╪┌┘╪╪╪╪┌╪╫╫╪╓╒╓╫╪╪╫╓╓╫╫╪┌┌╪╪╪█┘╪╫┘╪╪╫╪╪┘┘╪┘█┌█▄▌▄▄▌▌▐▌▌▄▐▀стрср▀▀▐▐р▐▌рсссртууутууххххцфухцццхцхцхцчшшхччшшчшщъщщщщъщщщшцту▀▀▌█┌┘╒╧┼жЙwrvЗСЧЮеиоп┤╢╗╛┴╟╚╦╠═╬═══╧╧╤╨╬╤╤╤╨╧╨╧═╞║е                     ╜НРОТПОПММИИИИЙЗЕДДЕЕГБА}АА}zvyvrprsrsootvuqszАА{xyАДВq^XXaluЖ}ng][^acjФ║╤╫┼Уsturj`XZXZagic[Yh{ЛТАjUOQX\YNJO[bXDBOXXQHEKVVNGJV]ULKMT]YMJV`\OLXdefvГДyhZVZfgXMSX\XRW^ed[W\ef\TWdmbOSZfyАt`WXgО|[RX`kxyoqmeYZuzuw|xmkv|wpeUQW`fhcZTR_c^Y[bc[TV^hgbcbfgki]]\ade^LNSUXZTJHLOLHOZZUW]_PCGOUUUZWVVVYXVQXrВ}skVHGMV[^^]^__]]_WGDM[\[ZTJ=8AQZ^chlbG;BQeyВiYRPV[[WNA2-+/:A@FQ[^VJCEU`ZFBVpЗПЙjNHE@:;=IjСз▓ЧkSjОЬПnRPpЦжа~]YrАpO?DYБбЮГeVQJEDJLLOLCBIQQeР╖╟╔╬╤╥╥╨╨╥╘╘╙╘╘╘╘╘╫╫╓╙╘╓╫╘╘╘╒╒╙╥╫┘╫╙╘╒╓╘╥╙╤╙╒╒╓╓╓╓╓╫╓╫╫╪╪╪╓╒╓╓╘╙╤╤╤╧╦╠╦╩╩╚╦╦╔╔╔╔╩╦╔╔╩╠╧╬╤╘╘╙╙╘╒╘╙╒╓╫╪╫╪┘┌┘╪┘┘┌┘┘██╪╫╪╪╪╪╫╪╪┘┘╪┘┘┘╪╪┌┌┌┘┌█┘╪┘┌┌╪╫╪┌┌┘╫╫╫╓╒╧╛Сf@JOE9@eЦ╕╠╒╫┘┘┘██┌┘┘┘┘┘┘┌┌┌┌┘█┌╪╪╪╪╪┘┘┌┌┘┘╓╫╫╫╓╓╓╫╪╓╓╫╫╫╓╓╪┘╪╫╪┘┘╪╪╪╓╓╫╪┘┘┘┘╪┘█▄▄▄▄▄▌▌▌▐▌▄▌ррр▀▀▀▀▐▐▀▀▐▐рссттуфуутуухххцццфцчцфхццххцчшчхчччшшшшшщшщщшшщшщцфтс▀█┌┌╫╙╧─зЙvqwИТШЯеко░│╡╣╜└─╟╩╦╦╠╠╠═╨╨╤╤╨╤╤╤╨╨╤╧═─╣ж                     ╙ПТООМЛЛИЙГДЖЗЙИВАБВДДБ}||yrsttssqqtqqswxtrw~А}{yАЕДvg^V^fmu|Бzlc^^_ckЧ╜╒┌╩бЙ~xnb][]\\cij^WWh}ЖБwgTPSX\YJIS\_VB@QZXOIGLZYIDKZ`TKHMTYWMMW_\MK\efhrИЕufXUZdgXMQX]WRW`dc]V[ff\UXdlbPRXexЖy_WVf|Зv[UX`guАtqnf]^sА|xwwqnrxyreUQW`fidXTT\^YZ_eh\OP_jhdaacgkjd`_^bd]LNVXYYQIIMPKHPWZYZ]ZLCFLNQRTTUVVVVUPUoБ}qgUIKRX_][]^^\YY[RIENWYYXNE=:FV\]bjobE=BNezКvaXWY\[VM>4.+2>ABGQ\\RF?ES[TEBSi~ЛАaMJHA68C^П▒╩╘╪┘┘╪█┌┌┘┘┌┌█┌██┌┌┌██┌┘╫╪╪┘┘╪┌┘┘╒╪╪┘╪╒╓╓┌╫╪╓╓╫╫╫╪╪╫╫╪┘┘╪╪╪╫╒╫╪┘┘╪╪╪┘█▄▄▄▌▌▐▐▌▌▄▄▌рс▀▀ррр▀▀▀с▀▀▀стрсуууттфхфффццууццхффхххцхчччцшшшшшщщщшщщщшцшшшхфус▀▌▄┌╓╘╬┼иЙwqyЗТЧЭемно╡╡╕╝┴╟╚╚╔╩╠╠══╧╨╧╤╧╤╤╤╨╨╨╧╠┼╣е                     тОСОНМООМНЖИЗЙЛЛЗАААВГБzz|}zsttusssoqqqrsvvspyБА}zАВГ}oc\`chntzАyea^^blАЪ╛╒┘╔еУpf]\YYX]flgZTVg{Д~qaUUVZ\WOLV``U@CRZXOGKQWVKDI[bRGKOV^XLMY^[MO[hiehu}sdXV^giTMSY\YSU_ebXQ\ee[UXbk]PTYdvЕw_VWbuБp[V[bftАysmeWWrЖ~swzsmqwzueVRW^bc`YTSWXY]bfg]MN]jjebacimjgb\_bd\ILUZ[YRHFLRKDRZZZ\`]J?EJLJMOORRQQRQJRm}xqgRMLQX\Z[^^]YTTWRECOYZXSH@>?LVX_dikaB=BM_yВ|j_[\]ZSJ>3,,4<APY]_ejn^B>BL^tЖpb\[\ZRJ>3*(09:>GTY\`eii[C>BL\nwth`\\[TI;2+',6:CJRVRHCBISVMBAKVacYJBDC?7FLSVQE@CMUTJ?=HU\]XDCGG?7<@RpКТНuQWxТУДeLWЪЭМlWf}kLAMkТбЦv[ROFAFMMQSJBCJLNrЪ╛╔═╧╨╧╤╤╙╙╙╥╙╒╒╘╙╙╘╒╒╘╓╫╓╓╘╒╒╓╙╙╫╓╫╙╓╓╓╙╙╒╓╫╒╫╫╓╘╘╫╒╫╒╒╓╓╓╘╘╓╓╙╙╘╘╥╧╬╬╬╦╚╚╔╩╚╟╚╔╔╟╟╦═╧╬╧╤╙╥╥╙╘╓╫╓╪╪╪╫╪┘█┘╫╫┘┘╪╪╪╪╪┘╪┘╪╪╪┘┘╪┘╪┘╪╪╪╫┘┘┘┘┘██┌┘█┘┌┌┘██┌╪╪┘╪┘┘╫╥┴ФaISXLBHaФ╛═╘┌┌╪┘┘┘╪╪╪█┌┘┌┌┌┌┘┌┌█┘╪╪╫╪╫┘┘┘╓╒╫╪╪╪╪╪╫╪╫╫╓╒╫╒╪╫╪╪╪╫╪╪╪╪╪╪┘╪╫╪╫╓╓┘┘┌┌█▄▄▄▄▀р▀▐▌▌▌▀▄▀▀р▀▀рсрррсссрсусстффуууффутхххчцчццчцчшшчшшшчцчшщщшшшшшшчччффтр▀▌█╪╫╙╧╟нМzryДРШЮейм░┤╕╝╜└┼╚╔╩╦╦═╬╬╬╨╨╬╬╤╨╤╤╤╥╧╬╞╣д                      МФУОММНОЛЗЗКЛКЗЕДЖЕГБ{|zzwtrvxrqssssvuuwyuquzБ~|}|БЖВxlbbbelqssqprx{ЖСЦЧУЗk^Y]]]\_ahmfYORU^nsi_bgjfe[PQW]`[MBN\`THFO[]PGFQ\\MKNUY\OHO[]TGQ^dZPPU^bbaejkcNOY^]UQV_c_UT[fdYT\em[TV[agok^UT]gsh]bmshlАИ~rdRWkyysqrzngkrpcRP[bb\VPSSTRZbfihYHIYbfgebabfklhdbbfUHNTX[WNFKRWOLRY[[_b^MELSVWVVSROQSSSTXdxЗ~ePHHRZ]]ZXVOGCLUM@CPWTM?:=IV]_VBAEF>8;ARm~ГБkMWzРС`Q[ЪЫИhYjБДiKIPoХвТqWONICFJKOSIBFPPTwЯ└╔╧╨╥╙╨╥╙╙╘╙╙╒╒╒╤╘╒╘╙╙╫╫╫╙╒╫╫╫╥╒╫╫╓╘╓╓╫╙╒╒╒╓╒╫╫╓╘╘╓╫╫╓╫╓╓╒╘╙╓╫╘╙╥╤╤╧╬═╩╩╟╟╩╦╚╚╚╔╔╟╟╩═╧═╧╤╤╤╤╥╒╫╒╓╪┘┘┘╪┌┌┘╪╫╪┘╪╫┘┘╪╓╓╪╫╫╪┘┌╪╪╪╪┘┘╫╪┌┌╪╪┘┌┌╪╪┘┌┌┌┘██╪╫╪╪╪┌┘┘╘╟аnNMSKEDVК╕╩╒┘┘┘┌┘┌╪╪┘┌┌┘┌┌┌┘╪┘┘┌┘╪╪╪┌┘╪┌┘╓╒╫╓╫┘╫╪╪╪╓╪╫╫╪╫╪┘┘┘╪┘┘╪╪╪┘╪╪╪╪╪╫╓╫╪╪┌┌█▌▄▄▄▐рр▐▌▌▄▌▀▀▀▀▀▀ррррстттрстстсуууттууутухццхчцчччччшччшшчцчшшщщщшшшчччцхфср▌▄┌╫╫╤╧╚▒ОytyЖСЧажзл░╢╕╗╝└╞╚╔╚╦╦╠╬╬╧╨╤╨╤╥╥╥╤╥╤╤╬╞╕д                      РТУПЛЛРПЙИЕЕЗЖДБДИИЗДАzzzzwtstqoqvtrsxxwwxxuuy~ВБzt{ВГteecfkqtrnjkqxzБКОУХМpWW[]]^chlj`VRRT\ing_goplf\OPX`_XMHS^^PHHO[ZNDFP[[LINVZXMIP[[QIS^cWNOR_edgowrdPOY`^UQV^b]TQ[edWT\hkXRUZ`fqk^SR\ejg``hsllЙВrcOShw|uopsmjlpnaSS^ed_TOQVTQUcgkhXJJY`egge`aeflle`bdSJOUXYVKFHPWPLRXZZ[``K@LVWXXWXVUTUVWWXavВ~fOGHOY[]ZUOI>AOUMEEOWRHC?BNX\^ZX_lnXA@@K[hryyqhd`\TH:;APiuxtaIYzНК|ZGZФТГcVoВfGDTrЧбРlUNNEAHNKNPGAENNSyд┬╠╧╥╙╨╤╨╙╘╘╥╙╥╙╘╙╒╒╒╘╘╓╓╫╓╓╫╫╒╥╓╒╓╘╥╓╫╒╙╒╓╓╫╒╫╫╫╘╙╒╫╓╒╓╓╓╓╘╓╓╫╘╙╤╤╤╧╧══╔╔╩╔╩╚╚╚╔╩╟┼╔╠═╬╨╤╤╤╤╥╒╫╘╓╫╫╪╫╪┘┌╪╫╫╫╫╫╫╪╪╪╪┘╪╪╪╫╫╪╪╫╒╪┘┘╫╪┌┌┘┘┘┘┌╪╪┘┌┌┌┌▄▄█╪┘┘╪┘┌╪╒╦пzON\SE@HOUTI?BGNSQHADC>78?NaknlZEXvЕЕtVJ[АХСz[QnЗГdGKVwЩЯМiTNLFCEIFNQHBENPVАи┴╩╬╤╤╨╤╨╥╘╘╥╘╙╙╙╤╒╒╒╙╙╒╓╒╥╓╫╫╓╙╫╫╫╒╒╓╫╓╙╒╫╫╫╘╫╫╓╒╒╓╫╪╫╓╓╓╫╒╫╫╓╘╤╙╥╤╬╬═╠╩╔╩╩╩╔╚╦╩╦╚╚╦╠╬╬╨╤╤╥╥╥╓╓╒╓╪╪╪╓╪┘┌╪╓╫╪╫╪╪╫╫╫╫╪╫╪╫╫╫┘┘╪┘╪╪╪╪╫┘┌┘┘┘┌┌╪╫┌┌┌┌┌█▄█┌┌┌╪┌┘┘╫╧╗ИUH[XH9Ewв└╙╪╪╪┘┘┘╪╪██┘╪┌┘┘┘╪╪╪┘┘╪╪╪┘╪┌┘┘╪╪╪╫╪╫╫╫╪╪╓╓╫╓╫╫╫╪╪╪┘┘┘┘╫┘┌┌╪╫╪╫╫╫╫┘┘┘┘▄▄▐▄█▄▀▀▐▄▌▄▐▀▀▀рр▐▀ссррсср▀тттттууууутсфутфххфчцццччччцчшшшчшшщшшъъъшшчшцхтр▀▌┌┘╫╘╥═╚▒ПztyИСЧЮдйм░┤╣║╝└─╟╟╔╠╠╠╠╬╧╨╨╧╧╤╤╤╤╤╤╤╧╟║д                      ├ФЦПЛМПНЙЖДДДЕГАВДДВА|zyxuurqtrqqtposwwuwz{xtzВЙ}sj`hwББzkcdkorum`_flrВЪ╢─╠│В^Z[\\]hsoc[UUTRYdggltzytiWIP]b`UHIW`ZMHPW\XK@CQYUGHPX\WMJR^\OES]\UNMS_dhwБГxeOTZbaWSXce\QO\e]UT`kkVRW]dgni_XZdhkf^[gwwmuИЕvbNQ`qyvnnrnmjmkaVS^ed\NKX[VPV]elhWKOY^bgllfb`blngddcUOU\]XTIEEKW^XWVVY]b[IFMVXYZ\ZYWXXZYXV\oЗИlSLKS\\WSJCA@KVXMBENNE;8=JU\][WS\jlVB=?GUdosvuupkbTE:/'%0>AHOVSG>AIQROE<@JSWXJ:AJF;58AL]fhbTIVpzylOBWxЖАtWToГ~aDFY}ЫЯИfTNKC@HKIMNIBEKMYБк─╦╨╤╥╤╤╥╙╙╙╥╘╘╘╙╙╒╘╘╘╘╒╓╒╙╘╫╫╓╥╘╒╒╘╙╓╓╓╙╒╓╫╫╒╫╫╓╘╒╓╫╫╒╓╘╒╒╘╓╫╓╙╙╙╤╨╬╬╬╬╠╦╦╩╩╚╔╔╟╚╞╚╦╠═╧╨╤╙╙╙╒╓╓╒╓╓╓╫╓╪┘┘╫╒╫╓╪╫╪╪┘┌┘┘┘█┘╪┘┘┘╪┘┘┘┘╪┘┌█┘┘┘┘┘╪╪╪█┘╪┌█▄┌┘┌┌╪╫╫┘┘╘╞У^JXWK=AmЫ╝╤╫╫┘┘┘╪╪┘┌┌┘┘┌┌┌┘┘┘╪╪╪╪┘┘╪╪┌┌█╪╪┘╪╫╫╫╪┘╪╫╓╓╫╪╓╫╒╪╫╫╪╪┘╪╪┌╪╫╓╫╪╫╓╪┌┌┌┌▄▄▐▄▄▌▀▀▐▌▌▄▌▀▀▀▀▀▀▀ррррсссрттттсууффффухухххцхчххфхццццчшщщшчшчццщъъшчццхутр▀▐▄┌╪╒╥╬╔оМytwЕСЦЮеик░┤╣╗╝┐┬╟╚╩╦═══╧╨╨╤╧╤╤╤╤╤╤╤╧╧╟╣в                      ╫ХЦСЛМООЛЙЗИКЗДАГВА~|zxxxwwvtsrprsllrxust||urw~Е}qf_co|БВufcimpvj][akvМй├╨╘┐Кe\[^\coul^XWWVW]ehnv|~}vhUKV]`^RCH[aYJGOZ]XLCGSYRFKRX^[JIS^[MET^`UJLT_fnИАxdNTY]^UQZdd[PQ[b\TU`ljUUY^acki_\_hmoe\YdtxssБВwaNU^nwxpmspolmkbSS^fdZMLZYTSW_inhWNT[_afkkh`a_emjgdcRLU]a[SHDDJS\WVVTW]c\HHOUYZX[XVUUWXXXW[mЗКnTFJTY[SLFBBEPY\OADLJ>:=DQX\_[UT[imTA=>ESblpvxvpmcTE91-)18?IQURDEF:3:COZba\KCUhpncMCSsЗАlTVoД~^HK]АЫЭДcRMJB>DJJOOFCHMN[Еп─╦╧╤╤╙╥╙╘╘╙╥╙╘╘╘╙╘╘╘╘╘╘╒╘╥╒╓╫╫╓╫╒╓╫╫╓╓╓╒╓╓╓╒╙╓╓╓╒╒╓╓╫╫╓╘╓╫╒╓╫╓╙╤╨╤╨╠═══╠╩╠╠╠╔╔╔╔╩╚╩╠═╬╬╤╤╤╤╤╓╫╓╒╒╪╪╫╓┘┌┘╪╫╪╫╪╓╪╫╫╪╫┌█┌┘┘┘┘┌┘┘┌█┌┘┌┌█┘┘┘┘┘╪╪██┌╪┌▌▄┌┌┌┌╪╪┘┌┘╘╦йfKX_RCBbТ╕╬╒╪╪┘┘╪╪╪┘┌┘┘┌┘┘╫╫┘┘╪╫╫┘█┘╪┘█┌┘┘┘┘╪╪╪┘┘╫╓╓╓╪╪╪╪╫╫╪╪┘┘┘╪┘╪┘╫╫┘╪╫╪╪╪┌┌┌▄▐▐█▄▄▌▌▐▐▌▄▐▐р▀▀▐▐рс▐ррстусттссрссфццутфуфцхфуцххххчцчхчшщшчшцчццщъъщшччхфтрс▌▄┘╪╒╤╬╚░НytwДСШажйл░╡╣╗╗┐┬┼╚╩╠╠═╠╨╨╤╨╧╨╥╥╤╤╥╤╧╬╞╕г                      цХЦПЛМЛМЖЖГДКЖДГГДВААzxwwwvvqrrqooronptxttz}xru{}{udY]esВЗxjijorvm^[^gwОо╟╒┘╟Тi^[``hsviZSUWY\bgiw~}||ueONW]a^RIO]cWGFPY]TGAJU[REHQX\WLIP]\LHT][SOOWafnБЛЗvbQU[_\QPZgdZNO\d[SU`lhVSX^bekf^\bjnleXXdu~ss}u_MVajx}rgrrmiihaSS_d_UJMXWUV\ckngVNU^_aehijfbachmmhbPKU\`_THECIKOSUYZY[a^FFOVXX[]\XWWWWXWXYiГЙnUFGTXVNFBBGNU\[NA@FB<9AKSY\[VNMZilTB<=DO\fmqvupn_TG93/.4;CKQUNB>CJNQPF>AIQURB:@HC739DQZ__XJEScdc]I?PhstgRUow[CF^ВЫЫА`PKH@>GMJMLGDFJL^И░╞╠╨╤╙╥╥╙╥╥╙╤╙╘╘╥╙╘╒╒╒╘╓╫╒╙╓╒╫╓╥╓╙╓╙╙╓╒╒╒╓╓╓╓╘╓╓╓╒╒╓╓╫╙╓╒╓╓╒╓╘╘╙╥╘╤╤╬══╬╠╦╠╩╩╚╚╔╟╩╚╩╠═╧╬╥╤╙╨╥╙╫╫╒╓╫╫╓╓╪┘┘╫╓╫╪╪╪╪╪╪╪┘┌┌┌┘┘┘┘┘┘┌█┌┘╪┘┌┌┘┘┘┘┌█▄▄▄┌┘╪▄▄┌╪┌▄┌╪┌┘┘╫╧░qQVaYED[Ип╦╥╓╫╪┘╪╪╪╓┘┌┌┘┘┘╫┘╪┌┌╪╪█┌┌┘┌█┌╪╪┘┘┘╫╫╫╪╫╓╒╒╫╫╪╓╪╓╓╫╪╪╫╪┘┘┘╫╫┘┘╪╪╫╪┌┌┌▄▐▄██▄▄▄▄▄▌▌▐▐▀▐▀▐▀ссрррсттртстсрсуфцххффухццстчцхххчччхчшшшщшшчцшщъщщшшчфтсрс▌█┌┘╓╤╧╟▓ПywwДСЧЮжйк░┤╖╗╝└┼╞╔╩╠═╠╠╧╨╨╨╬╨╨╨╨╤╤╤╤═╟╕г                      єХЦСООНСЙЗДЕИГБВГВГАzxwwywvtsrrpornnqttqu{{xtsu}АygYZ_iЙ}pkkoprmb]_dwЛл┼╒┌╟Пla]^ajwtcTTWY[aegisББ|qaQPX\_ZQIQ^bVEEQ\^RFEKVXMDKSY_WGFS]ZLKU_`SNQ[cci}Г~uaUX\_\SPZgdZOP[a\TU`lgVVV]bekg]\mwvocTVbwГvnxБw^OXajwwhqqronj_QR^d_SJQ[YV[dfllhVNW`_`beikgd`chjnhbPMPY^]VICBGJMOPUZ]]`^HFQXZZZ\\ZYXZXXXVXeЖkREHTYWNEDHNRV\\M?AE?9DJUajquplk_TG<3-)6?FOSSM?ADA96;DQZ``WDBR`b_ZH?Lbom`NVnuVFH^ВШЦz\OJHB>CHHOOHDIMMaЙ▒─╦╨╤╥╥╥╥╙╘╘╤╙╘╘╥╙╘╓╓╘╒╓╓╒╘╫╓╫╘╙╓╒╓╒╒╫╫╓╘╒╒╒╘╙╘╙╒╒╒╓╒╓╫╓╓╫╓╘╒╓╙╙╤╤╤╧╠══╠╦╔╠╦╩╩╩╦╔╦╚╩╦═╬═╧╥╤╨╤╒╓╓╒╓╫╫╓╒╫┘┘╪╪╪╪┘╪╪┘┘╪╪┘╪┘┘┘┌█┌╪┘┌┌┘╪╪┌┘╪╪┘┌┌┌█▄█┘╪╪█▄┌┘┘▄┌╪┘┌┘╫╨╖wWWc^HHQе┼╙╪┘┘┘┘┘┘╪┘┘┘┘╪╫╫┘╪┘┌┘█┌▄┌┌▄▄▄┌┘┘╪┘╪┘┘┘╪╓╒╒╫╓╪╪╪╒╒╪╪┘╪╪╪╪┘╪╪┘┘╪┘╪┘┌▄▄▄▄▄▄▄▄▄▄▄▌▌▌▐▐▀▀▀▌▀сс▀ррстсрсттсрссуфтфтууцццууххххччшчхчччшчшшшчшщщъшшшцффур▐▄┌╪╫╒╨╬╞▒РxxxГРЧЭзил░╡╖║║└─╞╚╔╦╠╠╠╬╤╨╨╬╨╤╨╨╤╥╤╤╬╟│а                      √ФЦОКЛЙКЕЕДЕЗГББГДДДААzzwvwtvrsrrqpspppsxuv{zvss{А~jYXYfxБВzqknnvnc\]fsЙе┐╤┌┼Лm]]agnpj_VWY^`dfghntx{wm]PRY^_ZQMR]^PBER\\QDDOZXKDHR[_RGKR[XILW]YSORZ`bclvvnb[]cb[SR[deYOR]bZTXckdUTW^dfkf[\kwwpbUR_sБwnsvq^P[ajv}viovqjkh^NP[`ZRMS[][^ejmkhVOX`_^afikidabfmmjdQPPW^`XJDBEJMNPTW[aa^FHPVXZ[YZZZYZXXXVWbzБgQFKW_ZMIIMSVX]ZJ>CIM_fny|rd]OE;2((7AIPSRK?@HPSQ@;DIB97>?;8CSY[[YSKFIXkkOA;=BEJZdnyГ~j^NC8/&*6?KRURJ=>GPSSLD>>HPTP>:CGA74BJQSQOEA@IPTL<>EGA44ERZ[OEQ^b^LAH^yЛГjQKOICCGHHJJEAEIIfР╡┼╦╧╨╤╥╤╤╨╤╨╤╤╥╥╤╤╥╓╒╒╫╓╓╘╒╫╓╘╘╘╫╫╙╙╒╘╓╘╘╓╫╓╘╘╫╓╘╘╘╓╓╓╓╫╫╫╒╘╫╫╒╘╙╥╤╧═╬╬╠╔╚╦╦╔╚╔╩╔╚╚╦╠╠═╬╨╤╤╥╘╫╪╒╘╓╫╫╪╓╪┘╪╫╫╫╫╫╓╓╫╫╪╪╪╫╪┘╪╪╫╪╓╪┘┘╪╫╪┌┌┌┌┌┌┌┌▄▄▄┌╪┌┌┌█┌┌┌┘╪┘┌┘╪╙╟ЦlWYWQE=cХ╗╠╫┘┌┌╪╪┘┌┘╪╪╪┘┌┘┌┌┌╪╫┘┌┌┘█▄▄█┌┌┘┌┘╪┘╪┘╫╪╫╓╘╙╓╓╓╓╓╪╪╪╫╪┘┘╪┘┘╪╫╪╪╪┘█┘┘█▄▄█▄▌▄██▌▄▄▌▄▌▌▐▄▄▀▀▀▀рсс▐▀тттррсууууууууцццуууххххцццхччччччщшшщцчччччцутр▀▐▄█┌╓╒╤╧╚╕Р{tuЕРЦЮезк▒┤╕╗╝┐┬╞╚╔╩╠╩╦╬╧╨═╬╧╧╧╬╤╙╥╨═╟╣Я                       ЦППЛИЙЙИЙЙЗАy|ГДББГБ~yxwvvvwvsrtsqttqnouyur|Б~xswzyoc\`ipw|}}skmoh]Ydj|Пй┼╥└Нwicluo_[VTWZ_jodXYg|ККv_RNV[\YSQR[bWE?KY^WKEGPYZE@LV]^RDIUYRFLXb[PPV^_\UV\dd]`eie\SU]d`XPVacZU\go_UUW[_hmh\XcyДwdWT]i{vnmpnZSgwtptsiflmlliZMMUZUJLSVW]adfjogUPXdfda`bgmfa_aacf^RNSZ[ZRJEFHIELUVVX\]SEGNSVXYWWXXYXWVWXWZcjaNCL[_\OSVZZY[_XI>;9=DQY\\[RFB>I_kgOB98@GMWaisЖ|bRB4+#%7@LSSOE:AKRRPJD?@GPRJ@CIHA78>ISVWVJ;BPZ\XRBZН│╦╫╪┌╪╪╫┘┌┘╫╪┘╪┘┘┌┌┌╪╪┘┌┌┘┌▄▄█╪┘╪┘╪╪┘╫╪╫╫╫╓╘╙╫╪╪╫╓╫╓╫╫╪┘┘╪╪┘┘┘┘╪┌┌█┌█▄▌▌▄▄▄▄┌┌▄▄▐▌▌▄▌▌▄▄▌▀▀▀▀рс▀▀стсрсттттттуууфцхтууухфцхцццччччччччшшцхчччцхутс▀▀█┌╫╫╘╤╨╚╢С~swЕСЦажзкп╡╕╗╛└─┼╟╚╩╦═╠╧╧╨╬╬╨╨╨╨╨╤╤╧╦╟╣Ь                       пННКЕЕЖЕЙНКx{ВЖЕДВА~xwvutswwroqsssrrqquzyu{ББ{rtw}Бzh]bgkpw|А~njjf^Yaj|Ок╟╙┼ЧАsnppg\ZXXY]con_WZfyЖГnYQNV\^XQOT^aXHDO[[VLDGSZWC@LX]\RIJUYREMZ\VPUY^`XOR[be`flpl]RW_ebVLTddYV\fm]UUX\aglf[We}ЙxfVS[fuxnjmmZThyuoorniimnmjZLLUXRKMTVV]abdineWTYbfdabbhnmb]`dfg\QPSWYWPIFFJJFIUXXZ]]SEGLORSUWVWWWWWXVVVX_j`MBCPUTSVYYWX\_XI?=>BJV]^]WO@==LamgOB;:AHRX^fpzЖ~bO>1*$):EOSSOD>DNUSLEC>@FORH=CLJ?69AKTTUQI@DPXYWQ@?DNUVNHR]_WG=HZjrn[PMKGAACCDIHCCFJKjХ╢─╩═╬╧╧╧╤╧╨╤╤╤╤╤╤╤╥╘╒╒╓╫╓╙╘╓╓╓╥╘╙╙╙╘╓╓╓╙╘╓╪╫╘╒╓╓╒╘╘╒╒╒╓╫╫╫╓╫╓╙╥╤╥╥╨═╦══╦╩╩╠═╦╩╩╩╩╚╟╦╠╬═╧╨╤╥╤╙╓╫╒╘╒╫╫╪╫╪┘╫╪╪┘┘╫╓╪╪╪╪╫╫┘╪╒╫┘┌╪╓╪┘╪╫╪┘┘┌╪┌┌┌┌┘█▄▄█┘┘╪┌┌█┌┌┘╪██▄╪╘╨▒zPL\UF=UЕм╩╓╫╪┘╫╫╪┘┘╫╪╪┘┌┘┘╪┘╪╪┘╪╪╪┌█┌┘╫┌╪╪╪╪╪╪┘╓╫╒╓╘╙╓╫╪╓╓╓╓╫╫╪┘┘╪╪┘┘╪╪╪╫┘┘╪┌█▄█┌▄▄▄██▄▄▌▌▄▌▌▌▄▄▄▀▀рсрс▀рстсрстсттууфуухфусуттухххццццчччщччччцхцфффффтсс▀▀▌┌╪╓╙╨╨╔┤РuwДРЦадзм░▓╣╗╜└─╞╟╚╩╦╠═╧╧╧╠═╧╤╤╨╤╤╤╧╦┼╕Щ                       ┼ОНКЗЖЖЖЗЛИ|~БВАБА|wxxtruwwuqrsvrrqqquwutyАГvtvzАГqbcgjkqzyrokf[W`hzОк╞╒╟дЛzvsnaZYVWY]grjZQWdwГ|gYVRZ^\WQQV^aVHGR]_PDAHPXSADNX]\ODLUXRGO[bVMQZbbUNP\ff_jv{q\SW_faUMTegYQYej]XZ]^`imgZYe{МygYU[cksqnnk[UgtqlnpojlmophZLMSUPFQWUUX`ffikdWQVchfdabhkke`_`cc\RNRWZ\SJGIKKJMSUW[``REGKLLKNSTVVVUTTURPP[e^K@CNSUVX[ZZY\_WF@ACJPW]^\VJ>=APbndNA:=DKSX^flyГ|bN=1'&+=JSVUOC>HRTQLHB>@IPOF@CIG>79CMSVUOE:ETYWVOB:BPVSJIQ\^TIBHXekdVLKNG>=@?DNIDCGHKnХ╢├╦╦═╬╧╧╨╨╨╨╤╨╤╥╤╤╥╙╥╥╒╙╘╤╘╫╫╘╘╒╘╒╘╘╘╒╒╤╒╓╓╫╙╒╙╒╒╘╒╘╒╒╓╓╫╫╓╫╓╒╘╥╤╨╨╠╦╦╦╦╩╠╬═╦╔╠╦╠╚╟╟╦═╠╧╨╤╨╤╘╓╓╘╘╓╫╫╪╫┘╫╫╓╓╫╪╫╓╫╪╪╓╫╪╪╫╒╫┌┌╪╪╪┘┌╫╫┘┘┌╫╪██┌┌█▄▄┌╪╪┘╪┌███┌┘┌▄█┘╫╤╝ГSK^\I?P{г┼╙╓┘╪╪╪┘┘┘╓╪╪╪╫╓╪┘┘┘╪┘┌┌┘┌█┌┌┘┘╪╫╓╓╪┘╫╒╓╓╓╒╥╓╪┘╫╫╓╒╫╪╪┘┘╫╓╪╪┘╫╪┘┘┌┘██▄▄█▄▄▄┌┌█▐▐▌▌▄▌▄▌▌▀р▀▀▀рсррсттрсстттууутууфутуфуффхфхцчццчхчцччччшчххфхфутр▀▐▌█╫╓╥╤╧╔┤П}txВРШЮджн▒┤╕╣╛└├┼┼╔╔╦╦═╧╬╬═╬╨╤╤╤╤╤╨╧╩┼╕Ь                       ╫ММЛИЗЕЕЖЖЕАБВБА}xyyupqtvspqvvppststzzxy|ГА|xuz|}tkefijlowzwuof\X^gxМк╟╒╦лСВyob\[YXZ]`ipeURYduАuaY[]^a^UPQZ``UGET`]MC@HTZR@ERZ]ZMIOVXNDO[^UORYa`QMR]hhjr|u[UYagcRHUgeWQZem]W]cdeikeYVfvxvfUQYalwqnokZTcuskmqoggjlniYMOSSMLYYUQV^fggf^XRTbjifcbenofb`ace\QNOV[ZSKJKOSJMSUWY_`REGLNJJKLNRRQPOOQOLMV_[LAGPWXXZ\\Z[]_VJACGPV\\YWPC<=EUfpbKA:>GOUY\bju~ybO>4)#,>KTVSLBAKRSOLIB:@HQQD?FLK>7;EMTVTND?IUYYVKB?DMRPJGQ[ZRE;?KXiqcK?;>HRYY\_gpvscM?5,&-ANTXSJAALSRMJHA;AHQMF@GMLA4;FNUWUOD@JUYXVK@:BLROJHU[\SDAGV`b[QIJQHBBACIOIBDGJPsЧ┤┐╟╟╩╩╦╦╬╬╨╨╧╨╨╬╬╨╨╤╤╤╙╙╘╥╙╒╒╙╙╘╒╒╙╘╘╘╘╤╙╓╓╓╥╓╒╓╒╘╒╫╫╒╫╓╫╫╘╒╒╒╙╥╙╙╤╠╠═╠╩╚═╬╬╠╚╩╩╩╚╚╦╦╦╠╧╤╤╨╨╙╘╒╓╫╪╪╫╓╫╪╪╫╒╒╫╓╒╘╓╫╪╪╪╫╫╫╫╫┘┘┘┘╪┘╫╫╪┌┌┘╪┌██┌┘██┌┌┌███┌█┌█┘┘██┌╫╫╓╚ТbLWbPAGgФ╜╬╒╪╪╓╫╒╓╪╪┘┘╪╒╓╫╪╪╪┘██┘╪┌██┘┘┌┘┘╫╫╫┘╪╫╫╓╓╫╫╪╪╪╪╓╫╫┘╫╫╪╪╪╫┘╪┘╪╪┌█┘╪┘█▄█┌█▄▄█▄▄▐▌█▄▄▄▌▌▐▀рр▀рсрстрттуутуттууфутстутххффффухфцццххчфцчччччххффусс▀▐▄█┌╫╘╨╨╨╔║Т~swВНЧЭейп░╡╖╣╛└┬╞╚╦══╬╧═╬╬╠╧╤╥╨╧╤╤╥╨╦╚╕а                       їМПМЖЖЖДЕВБАА}}А{ywwtoquvropttoquvrtx{{yxЕЖА{zw|А}lfgfeegnsvuqfaekuДЪ┬╟╣дО|m^\\\ZXY^fph[PQX_mrg[_loid]QLS]a\QGIU\UJEGNWWK@KU^`ZMHMXVIAQ]^TMU\c_QLQ^gemЖЙВq[X[af_OJWgbTR\gk]W`ijehldUV`moreVRZ`j}|rkeVS^mrqmlmhhhjkfVKLOQNO`[TRWbigee^WTV^hkhebcgkoha_``ZROOTZYSMILTYONSWZ]_aOFLRSOPPNLJKMLKKNOQMOXVJBITYYXYZYWYZ\SIBHPVZ]\XOD:=GP\iscL>:@HOL@HV]^YPKJIFBBACHNHBBGFStЧ░╣└─╞╚╚╔╩═╬╠═╬╬═╠╧╨╥╥╤╥╘╙╥╙╘╒╙╤╘╒╒╙╥╙╙╥╤╤╒╓╓╙╓╫╓╒╒╒╓╓╘╫╓╓╓╘╒╘╒╘╙╥╤╤╬╬╠═╠╚═╬╠╚╟╩╦╦╚╚╩╩╦╠╬╤╤╤╤╙╙╒╘╫╪╫╫╓╓╓╓╘╘╒╓╘╘╒╫┘┘╪╪╪╫╫╫╪╪┘┘┘┘┘╪╫┘┌┌╪┘┌█▄┌┌███┌┌█▄█┘┌▄█┌┘███╪╪╪╠ЯmOTcTEF]Л╕═╥╓╪╫╪╪╫╪╪┌┘╪╓╓╪╪╪╪╪┌┘┘┘█▄▄┘┘┘┘╪╪╪┘╪╫╪╪╪╫╫╫╪╪╪╓╓╫╫╫╓╫╪╪╪╪┘┘┘╪┘┌█╪╓╪██┌┘████▄▄▐▄┘█▌▌▌▌▀рр▀▀рстрррсутутууууфтссттутухуутууффцчццхцфччшчцчффууср▀▀▌▄▄┌╫╘╤╤╨╔╣Т}rvАНЦЮгйн▒┤╢╣╝┴─╟╔╦═╬╬╬╬╬╬═╧╧╨╧╨╤╨╨╬╬╟╖Я                       ¤ЛССКИЖИД~|{А|}}}~}yvtspqtvsrqswoqvxvru{{wv{БЖБДxmr{ЕshffdcfhntwulhmsuАОЭ░лУГsdYY^]\Z^`hkcYRRW\fmfbgtwmf^SQV]aZMFKYaVG@GSYTHALX]`YKDNYTHCP\\RKR]a^PJM\hfmВЙГm[VZde[RP\gbXV`fe[\`figjmbVV^iqpaXY`bj||qkdVV[kqojiniehkmeVIKPPNP[[XX^cgffhaVPSZfkigb`ejkhf_^_[RMPVZ[QLJLRXNMOV[^`aNINSVURRUSNNOPLLOPMJO[VIAKUYXWWWWVXW[TFDIPUWYXTL?9BJT_jscM@8AMVUMIEA>@IMI@AJOJ?8?IOSUTM?>KVYZXM@=CLPLDEPUUMDAGU]\VOKJJFB??@JNHBEKJRsФж░╕╜┴┬├╞╔╩╦═╬═══╠╧╨╤╤╤╤╤╤╤╥╘╘╙╥╒╓╓╘╙╥╘╘╤╥╘╓╒╥╒╘╫╘╒╘╓╓╘╓╓╓╓╙╒╘╒╙╥╤╨╨╠══╠╠╔═╧═╩╩╩╦╦╟╔╩╩╦╠╧╤╨╨╤╙╙╒╙╓╪╪╫╘╓╓╪╓╒╒╓╒╒╒┘┘┘╪╪┘╪╪╫╪╫┘┘╪┘┘╪╫┘┘┘╪┘┌██┘┘┌┌┌┘██┌┘┘┌▄▄█┌███╪╪┌╨кuUOWSGCUВ▓╩╙╪╪╫╪┘╪╪╫┘┘╪╫╓╪╪┘╪┘┌┘╪╪┌▄▄┘┘┌╪╪╫╪╪┘╪╫┘╪┘╫╫┘┘╪╓╓╫╫╫╫╪┘┘┘╪┘┘╫╫╪┘┘╫╫╪┌▄┌╪███┌█▄▌┌┌█▄▄▌▌р▀▀▀▀ррсрсссттууууфуттсуттутфхтттууффхццхфхфцчцшччфффффсс▐▄▄▄┘╪╓╥╨╬╟╣У|rvАОЧЮгйк░│╖╕╜└┬┼╚╩═╬╧╧════╤╨╨╨╧╤╤╨╬╔├┤Я                        КОМЖЖГДД~}zА}}Б{wtrnrvwwspntrptxwtv{zuw~З~znckuyqiffeghjpsroptwx}КТФРЙ{laUZ^^][^eli`WSRT]fjcdoz~ri^PNW_dYKGO[eUFEKV\UEBMX^_WKHPYTGBQ]YPOU[`\PJNYdbfxБ}j[X\ff]NN`jbVW_hjZU^hkhik^ST]fpm`X]efjwzrkdUSZiqqmiljhhhidVHJMMMT`ZZ]`ehhff`XSU\cikhfdcfjifaab[TOSXXUQLHIQTNNOUW]`_NIOUVVVRSSRQQSQQSQRNOXSHDMWYVWWXVUTUWRFCKQVWYVOE:6@MWajs`L>9=AJNF:?GQVVSJ?AKUXXVLA=BJPLCDLRTPD@GSZZVKIJJEA@@CJMJDDJIRpМЫео│╣╗╜└╞╚╩╩╩╩╦╦╠╬╨╤╨╨╥╥╥╤╤╥╥╥╥╙╙╘╙╤╘╙╥╤╥╘╒╓╓╓╓╒╒╘╒╒╫╙╓╓╫╘╘╘╙╘╥╥╥╤╨╬╧╬╬╦╚╦╧═╩╩╦╠╦╔╔╔╩╠╠╧╨╤╤╥╘╘╘╙╓╫╪╓╒╓╒╓╓╓╫╫╓╘╫╪┘┘╪╪┘┘╪╪┘╪┘╪╪╪┘╪╫┘┘┘╪┘█▄█╪╪┌┌┌┘┌█┌┘╪┌┌┌██┌┌┌╪┌┘╤╖YJVQHAOzи├╥╫╫╫┘█┘╪╪┌█┘╫╪┘┘┘┘┌┘┘┘┘█┌┌╪┘┌┌╪╫╫╫┘╫╫╪┘┘╫╪┘╪╫╓╫╫╪╫╫╪╪┘╪╫╪┘┘┘┘╪╫╫╪┌┌█┘╪┌┌████▄┌┌▄▌▌▄▌▀р▐▐рссрстсстттутттууссуууттутуууууффхччффцфшччччхфхфхутс▐▄██┌╫╘╥╨╬╟╕ТswГПЧЮгзлп│╡╖╝┐┬╞╚╦╠═╬╬══╠═╬╧╧╧╧╨╤╤╧╦├│п                        ННМЙЙЖКЖА}{}}}|||}~{zvssonsxwurovqqsuuqv{|xvw{ЗБue\bmz{xmeedegjqsrptwy{}ИСУРИ}qeVX[]ZY`ipd[VSSU]ghiltБЕxj[NOY`eYJIS]dQEFNW[WHCLY_aVEFRYTDDQ^[OJR]c[OIMW_Z[jurg[Zahh]PQajaTUaie\Z^ehiki^VV^gmi`\chgjqrpmdXQXerupkqliilkdWJKMLMQVW[^cgjkkj_UOU\bhjjgccainkd`b[ROU\YSNIFIPZWOOSX]b]OKPUWXVWWUTVUSTTUTROT\SGFNWXXWWWTSQQTOJGLQXYYUK>78CR[akr^K>8KLD>EMRL>8>HQUTSH<;AKOJFGJIOkДСЩгкп│╡╕╛┴─╞╟╟╔╚╟╠╧╨╨╨╧╨╨╤╤╥╤╥╥╘╒╒╘╙╘╙╥╤╙╙╘╘╙╘╙╙╙╘╒╫╓╘╫╓╫╘╘╘╙╥╥╤╤╤╧═╬╬╬╩╩╦╬╬╠╦╦╠╠╩╩╩╩╦╠╧╤╤╤╤╙╘╘╙╒╫╪╫╓╫╒╒╓╓╪╫╒╘╓╪┘┘╫╪╫╪╪┘┘╪┘┘╫╪┌┘╪┘┌┌┘┘┌█┌╪╪┘┌┌┘┌┘┌╪╪┌┌┌┌███┘╫╪╪╤╝И[BXTJ?Ksб└╧╫╪╫┘┌┌╪┌┘┌╪╓╪╫╪╪╪┘┘█┘███┌╪┘╪┘╪╫╪╪┘╓╪╫╫╫╫╪┘╪╪╓╫╪╪╘╙╫╪╪╪╪┘┘╪╪╪╪╫╒╪┘██┘┘┌██┌▄▄▄█┘▄█▄▄▄▀р▐▐▀рсррссстттттттутрссууутуффххфухфхццууффцхчччхффххуутр▐▄┌╪╓╘╤╨╠╟╖ТuxГРЧЭдзк░┤╡╖╝╛┬┼╟╩╩╦╦══╠═╠╬╧╧╧╧╤╨╤╧╬┬▓о                        ЯЛЙЕДБЖЖА}z~~}~АБ{yurrnpswvspmwsquwytvz{xxy|БzaU[buВ~pffdbfiovwokpqs{ИСгкШЗxjY[]]\_bkn^UTVTS_hinv{ВЖzkXMQ[ddXMLU_aMFKQY]VGDNZa`QFJUXPFDT[SMNT]cZNKNW^XS]jmc[^aihZMPbk`RUajf[Y^fjijh\VZ_fnl]YcokfmuvrfTMWdrwmgkkgegmeTHJLJLQVX\^afkkjg`XSV^dhjmkfdcgjmhb`[QPT\]WQJFHP_`TSTUZ_]NKOTWWY]YWVXXWVWXVVPPVRIHQYYYXXWTOMMPOGFMTWXXRF=;=JV]dkq]J>9=KTYXSNSad`XI=534?HQUQHDCIPSQEA@;8=GJC>FORL>9>IRTUQF?BMUWWTKDADKRJBFMTUL@@HPUTOGHLKEA=>DKLHEDHHOdzДКОХЮей░┤╕╜└└┬├╞╞╟══╬╨╧╬╨╤╤╤╤╤╨╘╒╙╤╤╤╤╥╤╙╘╒╘╙╒╫╒╘╘╒╫╒╘╫╓╒╘╙╙╙╥╨╤╤╥╨═╧╬╬╦╩╠═╠╠╦╠╠╩╚╔╔╔╩╦╬╤╤╤╤╙╒╒╘╙╫╓╫╓╫╒╓╓╓╫╓╫╘╓╪┘╪╫╓╫╪┘┘┘╪╪╪╪┌┌┘╪┘┌┌┘┘██┌╪┘┌┌┌┘┌┌╪╪╪┌┌┌┘█┌┌┘╪┘┘╘┬ОfLYTLCHkЭ╜╨╘╫╫┘┘┘╪┘┘┌┘╪╪╫┌┌┘┘┘┌┘┘┌┌┘╫┘┘┘╪╪┘╪╫╒╫╫╓╪╫╪╪┘╪╪╪╫╫╙╘╓╪┘╪╪┘╪╪╪┘╪╪╒╫╪┌█┘┌┌┌┌┌┌▄▌███▄▌█▌рр▀▌▌▀с▀стсттттттртутсрсттссттффхффуфхццхфццчхцччхфхцхтсс▀▌▄█┘╫╘╨╧╠╟╕Т}sxДОЦЭбжкп▓╡╖╝└─╞╟╚╦╦╦╠╧╬╧╬╨╨╧╬╧╨╤╤╧╦├│м                        ╖НОЙЕДЗЖБ}{~}z|}}zxussrptwvvrlprsuuwuvy}}ywv~Б~gXV\nВЕuidbdbfmrupcdhoyНж╣╜мТ{jRWY]\_hojYRTUVVaikuВДДzjXLV\a`VMNX_^KBHRX\VDDQ\__PDJW[PCGU[TLIT]cXMKOVYPPW_b`_`fkhYOTbj^QQ`haYW\fnmkf[X^fgge]YaoohjuyufXOVcnrmhlmjiikcSGILLKPRV]`cgkllh`SOZadfknkgb`fmohfa[POX^_YNFDELWVYWUWZ^\MLOUXXXZXVVWYXYXVUVUW[SHJV\YVVVTNJGILLIJOTVWUN@8=HQY^cjnZJ<9@JRYVLIN[b_WG:2,+EOLFADGDL_ov|ДЙПФЪвйп│┤╣╗╛└├╚╚╚╩╦╬╬╬╨╨╨╤╤╤╥╘╘╥╥╨╨╥╤╙╙╙╙╥╙╒╙╥╘╘╒╒╒╫╫╓╙╘╒╘╥╨╧╤╤╬╦╠╦╠╦╩═╦═╠╦╩╩╔╚╩╩╩╩╠╧╤╨╨╥╘╘╙╙╥╓╫╪╓╫╓╫╓╓╫╓╓╒╫╫╫╪╓┘╪╪┘┘┘┌┘╪╪┌┌┌╪┘┌┌┘┘┌┘╪╫┘┌┌┘╪┌┌┌┘┘┘┌▄┌┌┌█┘╪┘╪╘╚ЧgHUUMFHeЧ╣╬╒╪╫╪╫┌╪┘┘┘┘╓╪╪█┌┌┌┌█┌┌┌┌┘╪╪┘┘╪╪┘╪╪╒╓╒╒╓╫┘┘┘╪╫╓╫╪╘╘╫╫╫╫╫╫┘┘┘┘╪╫╫╫╪╪┌┌▄▄█┌┌▄▌▌┌┌██▌█▌рр▀▐▐▐р▀рсссттттсрстсрсттуссуухххффутхччфхцчхфхчшцфчцхтст▀▌┌┌┘╫╙╧╧╠╟╣Т}txГМХЮдзкн▒╡╖╝└─╞╚╦╦╦╩═╠╠╧╧╨╨╧╧╨╤╨╤╧╔┬▓й                        ╠ЛЛЙЕГЖЕГБААААzytsrrpprssrnrttswzwsvА|wu}ЕВk[UYk|В}rieechntvqdchn~Ц╢├╦╢Ч|lVWY]_bilcYWWWWWejkyГГВВwhWRW`d^SMQ\c`GDKT[\UCFP]c_NGKVXPBFVXRLNW^dWMIPY\OMV_c`bfjmiYNUfk^PRajdWSXcmqng^W^jkkh]Xaorllt|ygTNUamrnkkmidgmdQGJJHKRTX_dfimnmiaWSZbcgknnhc`ekqoic\RPU`bXKFDDFLNU[\\^_ZMLQUWXXZWVWWXWXXWYWVXZTJMY_[VVVQGCCHLLIHMTWUOF:8@PUZ_eknZI=9>JRVPIDGW`^SD90*,=IQSNIEGMRSL?>B>:?IIDCJTTI=8ALTUSODAGQUWUTHA?DLPFAGOWXL@@FMRRMDHJIB?=?FMLIACFCKZhlqu{БЖЛСЧЮгкп▓╡╕╛┴┼┼╞╔╩╠══╧╨╨╨╨╤╥╥╤╤╤╤╤╤╙╙╙╙╤╥╘╘╙╒╘╘╘╘╓╒╒╥╥╙╙╤╨╨╨╤╨═╬═╠╦╠╠╠═╦╦╔╩╚╟╩╦╦╩╠╨╥╥╤╤╘╘╙╙╫╫╫╫╓╓╒╓╫╓╫╓╫╒╪╪╪╪╪┘┘╪╪╪┘┘╪╓┘┌┌┘┘┘┌┌┌┌┌█┌╓┌▄┌┘┘┘█┌┘┘┌██╫┌██┘╪┘┘╒╦еpELRMDF^С╖╨╘╒╫┘┘┘╪┘┘┘┘┘┘╪┌┘┌┌╪┘╪┘┌┌┘╪┘┘┘╪╪┘┘╪╒╓╫╒╫╓╪█┘╪╫╫╫╒╙╒╓╫╪╫╫╫╪╪╫╪╪╫╫╓╓╓┘╪┌██┌┌▄▄▌██▄▄▄▄▌▀▀▀▌▐▐▀рсттсстуутрстсрстттсутуууутуфуфцчхччцххччшххчцфттср▐█▄┘╓╘╤╬╠╚║У~rvМХЭбжл░│┤╖╗└─╟╔╦╦╦╩══╠╬╧╨╧╧╬╧╤╤╤╬╩┬░й                        рЛНКЕДГБА~~~~}}||{yxsrrqopuwxvqrssptzyut|БА{uzБВrbXZgw|~{odcafnsxufcgnБЬ╢╞═║Ц{kVZ\]_djj]UWXX[_ghkwБВВ~sbTPZ`a\UOU]a\ECMW][QAFS\_]MBKWZODJY\TKIXdbWLKQ[[MLT^aacottn^TXgj]PS`i`XUVdproh[W`knkg^Y`q{kgq~{iWPV`jrrjiljgikcNEGIJPPPT]dfflookaWR\dbehkmkc`ejopnf]ROU\aZNHGGHFJNV[]_cZMNOTXVWWTSTWXXXYZYWX[]SKO[`\Z[XQICBJQOKGLSVSIA79ETXZ^dlnXF<9@IRWMDAEP^\OC8/*->KRSNIFHOVSI??A?=AGHBFMTRG<7BMVWSLEBISWWVQI>@FLLDCJRWSKD@EMRQMEFMJC=;9CLKFABB@IYdilmpuy|БИОУШбжк░│║╛┐┐┼┼╚╔╩═╬╧╧╨╨╥╤╤╨╨╥╤╤╥╥╙╤╥╥╙╥╥╙╘╘╘╘╒╓╒╙╙╘╙╥╤╤╨╨╧╠╬╬╬═╠╠═╠╦═══╦╚╩╠╠╩╠╨╙╤╤╙╘╘╘╘╓╫╫╒╒╫╫╒╒╒╫╫╓╓╪╪╪╪╫╪╫╫╫╪┘┘┘╪┘┌┌┌┘┘┘┌┘┘┌┘┘╓┌▄▄╪╓┌█┌┘┘┌█┌╫┌▄┌┘╫┘╫╓╧пwFHQKDBXИ│╬╥╘╫┘┌┘╓╫╪╪┘╫┘┘█┌┌┌┌┌┘┘▄█┌┘┘┘┘╪╪╪╪╪╒╫╫╪╫╓╪┘╪╫╫╫╫╒╙╘╓╫╫╫╪╪┘╫╫┘┌┘╫╫╓╫┌┌┌┌█████▄▄▄▄▄▄▄▐▀▀▌▌▀▀срттсрссуурссссрстуссттуфхфууффхххххххххцчшцццчффтср▌┌┘╪╒╙╨╧═╚╗ФtuМХЬвзлп│╡╣╜╜┴┼╟╩╦╔╔═╬╬╧╧╬╬╧╧╨╨╨╤╨═├│й                        эЙМЛЕД{z{z}А||А~yxtrrsonqsvvrtuusvzxtv{ВВ{szАxiXVfq{А~wicbhnswvibfmФ│╚═┤НwjXY]`ejmdXTWX[_dfadp|ГЖАm]SS[beXPOV``VDFQY[ZKAGS]b^MFLUYM>HX[RMOX`aUKISYZLLVadbhx{wn[OZjjYOS`k`XUYanxrh[S_qpnh[U_r{lgq|}hQMU_hnpliiefhkcLFHIJOOPSZdfdfklhbXS\efcchmkfbbfkoqj^ROUZ]ZTHDGIFHMOPV\e\KJRUVWYWURTUVVWXWVWY\\TIN^d^[]ZTHCIOTPGELUTOF>;>LUYZ_hkeVH>9ALRPI=;DOWXOC7.*/>KTSKDFKSVRHBA@<;?DHDFNUSI>:DPUWTJCCJRWWTMEBBGLNEAKRWSJAAHPUTKCGJHC>=>ELIEABA?JYbehjklnpsy~ДЛУЩЭбип▓│╕╛├┼┼╞╩╦╦╦╬╧╨╨╨╨╨╤╨╤╤╥╥╨╥╙╘╥╤╤╘╘╙╙╘╓╒╤╙╘╙╥╤╨╨╥╧╧╧╬═╬╬╬═╦╦╦╬╬╔╔╔╩╩╦╠╧╤╤╤╙╒╘╘╙╫╪╓╘╒╫╫╘╘╒╪╪╓╫┘┘╪╪╫╪╪╫╪┘┘┘╪┘┘┘┘╪╪█┌┌┌┌┌┌╪╪┌█┌╪╓┘█┌┘┌┌█▄┌▄▄┌┘╫╪╪╫╤╢|JETQEBSАн╩╤╫╫┘┘┘╪╫╫╪╪╒┘┘┌┌┌┌┘┌╪┘┌█┘╪┘┘┘╪╪╫┘┘╓╪╪╫╓╫╪╪╫╓╒╓╫╓╘╒╫╫╫╫┘┘╪╫╫┘┌┘╫╫╫╪┘┌█┌┘┘┌▄▄▄█▄▐▐▌▄▌▀▀▐▐▀▀рртсссстсттттутрттуссссуууфуффхххцхццхххчцчцфччхтсрр▄┌┘╪╓╙╨╬═╩╗Ф~utЛЦЫвзн░▓┤╣╜┴─╟╚╩╦╔╔╠═╬═╬╬╨╧╬╤╨╥╤╨═╞╖л                        ўЙЛЙЖЕБzz{}{{{z}|xyvsqrrqswwtsttutuzzus|БВ|vv}Г~p]Xfmv|{of`fmu}yjbem}Ро└─мКvi[Z]bijf_WTY\^chh^_l{ДКЕhZQU]b`VPQX__SCIT]^XF@FS]^ZHCMXXK@HY\RJN[c`SKKU[ZJNX`ddn}{kZSZhhVMR_h`[Y\dluvjZV`suog\U^pzigozygRMU^fmmigkkgjjcNFGILWTOSZaefgkmk`TS^dfdchnogbachopj]QNTZ\ZTLHFIJJMNPV[_XNIOSUZ[YWVXYYWVWVVVY_^RIN`gacc^VMJOTWPIGKSRJA=@FRZ]^`gojVI@?ENPND79DPUUK?4++2@JSRJAHMSVQE>CC=;>ACAHPURG<>HPUWPHCEKUWUQJE<>GLK>@JSVRJB@GOSRJDJNJC?=@FPKECEB>JW^bceiihjlqtw{БЙНСШбззн┤║╝╜└╞╟╟╟╦╬╨╨╬╬╧╨╬╤╤╤╤╧╥╥╤╤╤╥╙╘╙╘╒╒╘╙╙╘╘╤╤╤╤╤╧╬╬╬═╠╬╬╬═╦╠═╠╩╩╩╩╠╦═╧╤╨╤╙╙╘╙╙╫╫╫╘╘╫╫╫╫╓╫╪╓╫╫╪╫╫╫╪┘╫╫┘┘╫╫┘┌┌┌╪╪┌┌┌┌┌┌┘╪┘╪┘╪╪╪┌█┘┌┌▄▄┌┘┌▄▄┘╫┘┘┘╤╝ГVJOPFBNwж╔╥╫╪╪┘┘┘╪╪┘╫╒┘┌┌┘┘┘┌┌╪┌█▄┌╪┘┘┘╫╫╪╪╫╫╪╪╫╓╓╫╪╓╒╘╓╫╓╘╒╫╫╫╓╫╪╪╫╓╪┘┘╫┘╪╫╫┘██┌╪┘█▄▄┌▄▄▄▌▄▄▐▀▀▀▀ррсстссстттсссттсстуссууфуууухфхфхцфхфххххцччччхфтср▀▐┌┘╫╓╤╧╬╠╟╗Ф|rsЛХЪбзм░▓│╖╝└┬─╟╔╔╔╩╠╧╧╧╨╬╧╧╧╨╤╤╨╧═─┤з                        ¤ЕКЙЙЖА{z{~}{{|{{zxwvsoommqvxytqswusuyyvzАБ|xwxГwa\dlqw}{pginw~Аn_bkyМз╗╛жЙtj]U^gllc\XUX]ainf\am}ЛПБcWSX_daRKR[baRCKV]]VEAIS^aVEELWVK@KZXOMT]caPKNX^XKNZehhuГВzkYP\ggVNS`m`ZY]bkwxjXUbtungYT\jrljkqqfSOZbfijifhffkkbLEEGLUSSS\cfggkmiaXU^fgedgjnkda`ciph[NMU[\\VMGHJIIOTUWZ^VLIMQTUYZWWXZZWWXWUWY^]QJQdiddigVGKTWYPGENRME>=ALW[ZZ_fjeWF>>DNTL@9;HSYTI=5-+3BLUSKCGOUVOE@AC<:>@BCHRVRH<@HPVVPF>GPWYVRID?@DJJBDJSWRI?AIQTQIENOIA?=@DOKGCED@^][^acffefghkkqux}ВЙОФЩаеп│╡║┐├┴┬╟╔╦╩╩╬╬╧╬╧╧╨╨╨╥╘╥╤╥╙╙╙╤╙╘╘╙╥╒╒╘╥╨╤╨╤╧╬╬╧╬╦╬═╧╠╦╠═╦╔╔╩╦╠═╬╨╥╥╥╙╘╘╘╥╓╫╓╘╫╫╓╫╓╫╓╪╪┘╪╪╪╫╫╪╪╫╫╪╫╪╪┘┘┘┘╪╪┌┌┌┌┌┌█┘┘┌┌┘╫╫┌▄┌┘┌█▄┌┌┌┘┌┘╪┘┘┘╙└К]GNMGEIkЮ┼╤╫╪╪┌┌┘█┘┘╫╪┘┌┘┘╪┘┘┌┘┌█┌┘╪┘╫╫╓╫╫╪┘╪┘╪╫╫╓╓╒╒╘╒╓╫╒╘╫╪┘╫╓╫╓╫╓╫┘┘┌╪┘┘┘╪╪┌█┌┘█▄▄█┌▄▐▀▌▄▌▐▀▀▀ррррсссссттсттутусстттстутттуухххффхуцхххххцчцчцхуср▀▐█┌╪╓╒╨╧╬╠╟╛Ш|rt~ЛЧЪбжлп│┤╖╝└┬┼╔╩╦╩╩╠╬╧╨╨╬╨╧╧╨╧╧╧╬═┼╖й                         ЕЙЛИЕБА{~~{yyyzxxvvpmrpnptwxwqquvuvwvwx}ВБ|uvz}i[ajpqxВЖsgiov~Вo`aiwЙЯ▓╕дИri`]amoi]VXWY^cjmcW\k|ЗЙw`VUX`a\ROU^b^PBKX`_UECLTZ[TBBNWUH>MZZQKS^d`OJNYaXLO[dggwЛЗyjZU^jhVMS\a_[Y]bjz}jXUctzpgWR\hqnjikneTS\dgiligjhfeh^JGGGMYVWY_dhgfgkh_VV_ghfadjokhcaadieXNMSZ^ZTMIILJFMUYZ[ZSLILMQSWVVVWY[WWYYXWZ_]PITilimn`TMRVWUPHEJNI>9@FRYYZY\ckeVE=LVZUI>60,4ERWXQHMRWVODAED:8HPTRLEAFQWWSNJD>?FJE>FKUWPJDCKSSOHELRI@<:DLRWZYY\afbUD<GQVVRKIDAAFJF@FLTWUIBBJQUNEFMMIC@>@JMKEBDCB╧    ╙}__bfeecgjllmsvx~ДЙТШЫдйнп│╗╛┴└┬──╟╚╩╦╠══╧╤╤╨╨╥╥╙╨╥╤╤╥╥╙╘╘╥╤╤╤╤╧╧╧╬╠╦╬╬═╦╦╠╩╦╚╔╩╩╩╬╬╨╤╨╤╥╙╘╘╓╫╓╓╒╓╒╓╫╫╫╫╫╫┘┘┘┘╫╫╫╪╫╓╪┘╪╫╪┌┘╪╫╪┌┘╪╪┌┌┌╪╪┘┌╪╪┘██┌┌██┌┘╪┘┘┌┘┌┌██╫╩аkFIRNGAJRUXZXXZamdTD<>CIHC99GUZYUIDPVVQC;@IQVQHAAJRWTMIGB=AIKD>FLVWRKBCLRRLFGOOIB?;AMOJEFFCCщ      ·└ob`aaceghilmopw}ДИЛУЫЯвжп╢║║╜└└┼╞╟╔╔╩╔══╧═╧╨╥╤╨╤╙╙╥╥╘╘╘╤╤╨╧╧╠═══╠╦═╬═╠╦╠╠╦╔╔╔╔╩╦╬╨╨╨╨╥╤╘╙╒╫╓╫╓╫╓╫╫╫╓╫╪╫┘┘┌┘╪╪╪╪┘╫╪╪╫╒┘┘┘┘╓┘┌╪╪╪┘┘┘╪┘╪┘╪╫┌█▄█┌█┌┌┘┌┌┌┘╪╪╪┘┘╫╠оtGLWRIDSК▓╩╘╫┌┌╪╪┘┘╪╓╫┌┘╪╫┘┌┌┌┌┌┌┘╫╓╘╘╥╥╙╥╓╫╓╫╫╪╫╫┘┘┘╫╫╫╫╓╓╫┘╪╓╫╫╫╫╫┌┌╪╪╫╪╪┘╪╪┘┘┘┌┌█┌┌┌▄▄▌▌▌▌▌▌▌▐ррррсррсууууссттсстттттфуфууцчхфхффхцчччффхцччцффур▀▐▄┌╫╪╓╤╧╬═╩┼╗Ъ}uu~ЛЦЫвелн││╢║┐┬╞╚╔╠╦╠╠╬╧╨╧╬╧╧╧╨╤╧╧╬╔├╖м                         ┴ЛЛ~}}А||z|zxxxzzxxspkorqpqtsvrswzzxzБАzvyЕЕ}ztu|~yjjjkmrvzВtouЗrebguЕТжлЮЛyooqtla]Z\ZZ^bjnbVW]gt}xbXX[`dhZPUY^`YEBQ]^ZKAIV[ZVIAIQWTEDS\XIIU_cZOKQZ^TIR\dcZ^lomfY[jpbPMS\a]SU^belmcUW_huueTSYbkojijnbTUfqqkjhdgjnok^DCEIOWZ_eglnmiffe^TU^hlhdbfjmngba`abVNLW]\YQGFKQOHOSWZ`aVNKLKIKLNOSTSRSSTVUQPZYOHWnqYSUWVUWZ[VPGEG?;>GPVVZYWUY^cdTE>?BJD>7;JUZXSG:3+-8J^pthUQVVSLDDDA:8<<>FOVWRCHRUSLHGABCHJD@FLUWRF@GPUSKDGNLFC@?ENOLFFGEEў         ЄЯba`cbegfihllpv|~ГИМСЦаем░│╣╗┐└├╞╟╚╚╠╬╬╠╧╨╤╤╨╥╥╥╥╤╥╥╙╨╨╨╨╧╠═╬╬╠╦╠═══╠╠╩╩╟╩╩╚╩╦╬╧╨╨╨╙╙╒╘╒╓╪╓╘╓╘╒╓╓╫╓╪╪┘┌┌┘╪┘╪┘┘┘┘┘╪╒╓╪╫╫╓╪┌╪╪╪╪┌┌┘╪┌┌┘╪┘┌█┌┘█┌█┘┌██┌╪╪╪┌┌╫╨╡~LISTH=MГл╟╥╪▄█┘┘┌█┌╪┌█┘╪╪┌█┌┘██┌┘╫╓╙╙╙╙╘╙╒╓╫╫╫╫╫╪┘╪╪╪╫╫╫╓╒╪┘┘╫╫╫╪╫╫┘╫┘╫╫╪╪┘╪╪┌┘┌┘┌█┌██▄▌▌▌▌▐▌▌▌▌рр▐▐рррсууутсссссрсстттттутуфххфцххфхцччфххцчццфутс▀▌█┘┘╪╒╤═╠╬╦╟╗Ь}vt}ЛХЪдзл░││╢║┐┬┼╚╚╠╠╠╦═╬╧╧══╬╧╨╨╧═╬╔┬│м                         █ИК|yy|}|~|{yxz{zxxvupnrrqquxuvstwyxrГГzvzГДАБujp{ЕohiknmptyА}urzsgbhtДРгнбН|tvwrd[[Z[Y\_eji\UY\drzvb^acdfeVNW]``YKJU_^YICJU\YSHAGRWQEER^WIKWbcXLKS]`RJS^a_YT^hib]`kpeRMV]_[WV[`cij^SU]fqpdUPY^hpkggjaQVhrpjkigfhmnk[FGILTZ]efekoqmfgg\TV^ilkhedfklhda_bbWMLR^^WRIIKROFNWY]`]UOMMOMMMIKMONJMOPQNNU]XMIWmm\VWXXVWZZVPIC>894IRVVPA:AJSWRE=AHSUTMIG??FHC?HQWWSICGLSPH=FOLIB@AHNNIEEHEG               №╔sabdeeegfimoqtw|ВЗМТЩЯжкп│╢╗╝┐─╟╟╟╦══╧╧╤╤╤╧╧╨╤╧╧╧╤╤╧╠╠╦╦╦╩═╠╦╟╩╦╩╟╟╚╔╩╦╠╬╨╤╧╤╙╙╘╙╓╫╫╒╘╒╒╒╒╓╓╪╫╪┘┘┌┘╪┘┘╪╫╫┘┘╪╒╫╫╫╪╫╫╪╪╫╫┌┘┌┌┌▄█┘╪╪┌┌┌█┌┌█┘█┌┌┌╪┌┌┌┘╫╙┬ОPGQSLAJyб┬╤╫┘┘╫┘▄▄█┘┌┘┘╪┘┌┘█┌█┌┌╫╓╫╙╘╘╙╙╘╓╓╪╪╪╪╓╪┘╪╫╫╫╓╓╙╒╫╪╫╓╫╓╫╓╫╪┘┌╫╓╫╫╪╪┘┌┘┘╪┘╪╪┌╪█▄▌▄▄▄▄▄▐▀рр▀р▀рррттуттттутссстстфхутухфууцццчххцхфхцццхууусрр▐▄┌┘╫╓╥╬══╦╟╛Ь~ur~МЦЩгжллп┤╖║╜┴┼╔╔╦╦╦╠╠╬═╬╧╧╬╧╨╨╨╬╬╦─▓й                         №ЖГ~||{~{~}~zzzyxwwurpoosvsrutttssxxzБНЗ}xz{ЗД{j`cnxwskhhhjhpv{}{skebfrПЮгЬПБtqca\Y][[W]cji]SU\_akql`huwof_POW_aaRHKW`aSDCIU\ZTJDLWWNBFU[RGMXbbUMOVaaQMX`a^SOYchdcjqqbQPV^_XWW]abig\PS]fnk_WV[_gomggh_OTerqheeegikmjXGHMRQPYdeekrvoggd[SS^eknmgdfhlmib`caUKLSYYUOIHNUQKOVY_a\UMMORQTSRMLMKJGJLLLNV[VLM[li^XXXVVUXWXQIAA=EOTUY[ZWNHN]i`PB99=>88AJT[^\SE;416BYej`RSZYUQICDD@97;CLUXTJEC<;AGD=AIRWVQHCGNQPH@GPMFA??GPOGEDDBW                  Їмg`acfdfiilnoqt{АЕЙПФЬажлп▒╡╗└─├╟╟╩╠╬╧╬╬╧╧╧╧╬═╧╧╨╠╩╩╩╦╦╦══╦╚╔╩╩╔╟╩╩╦╠╠╧╨╨╨╤╙╙╘╥╒╓╓╘╒╒╓╓╓╓╓╪╪╪┘┘┘┘╫┘┘╪╫╫╪┘╪╓╪╪╪┘╪╫╪╪╫╫╪╪┘┘┌█┌┘╪╪┌┌┌┌┌┌▌█┘┌┌╪╓╪╪┘╪╪╒╟ФVIPUMDIqЮ┬╤╓┘┘╫╪┌┌┘╪┘┘┘┘┘┌┘█┘┌┌┌╪╫╓╙╘╙╙╒╙╫╘╫╪╪╪╫┘┌┘┘╫╓╘╒╘╫╫╫╫╘╓╫╫╫╫╪┘╪╫╫┘╪╪╪╪╪┘╫╫╪╪┌┘┌▄▄▄█▌▐▀▐▀ррс▀▀ррсстуутттутрстсттуфхууффхухцххффхххххчцффхуфтр▀▌▄┌┌╪╓╥╬╠═╦╔╜ЬАvs~МФЩвзкн░│╖║╛┬┼╟╚╦╦╠╠╠╠═╧╧╨╧╨╤╨╧╬╬╩┼▓й                          ДГБ~~~{}~~~|zzxvsstrpospnpuvuwtrvxz~ДИАzyyАЗh]ZbvВzmihijjkrtv{zpkhjs|ЙШЦТИ{ni^]\]^^^Y]imeWTTX\ahkjgpxzsh]RS[`d_OFN[`[PFDKW^\SCCMTSLAFVZPGNY__UMOZaaPNXbd\QOYfffgnzw`PQYb`VQW^``fe\SV^emk^TYafflplji]SWeoqfdhkigkokWGHOVRMT`efgounggc[PU_fjnnjhghknmf`a`ULNTWWVOIGLOSPNRW^b^ULMOQVVVTRQOPPMNQPRSX[VNN_kg_ZXWTTVWZWPICBELTX[YYXSHEM]c_O@::?B:>HQY\^ZPD92/:F`hbYOUYWSMHDDC=879=ERUVSKB>DLSSKA>GPVWQHECA=@DDBDMTWVRACIORPEAKPMFBABHMMIDDCBw                     шФbacedgghfknqty}БЖМСШЭбжл▓╖╗╜┴├┼╔╩╠═╠╩╠╬╧╧══╬╧╦╔╩╩╦╦╔╔╠╩╟╚╚╚╟╚╟╩╦╦╦╬╤╨╨╥╒╒╘╥╙╫╓╘╒╓╓╫╫╫╓╪╪╪┘┘┘╪╪┘┘┘╪╪╪╪╪╫╪╪╪╪╫╪╪╪╫╫┘┌┌┌┌█┌┘╪┌┌┌┘┘┘╪█┌┌┌┘┘╪╪┘┌┘╪╒╔Ч]JPTMEIjШ┴╤╒┘┘╫┘█┌┘╪┘╪┘┘┘┘╪┌┘┌┌┘┘╫╓╙╥╤╥╒╓╫╓╫╪╫╫╫╪█┘╫╓╒╘╘╘╘╓╫╫╓╓╓╪╫╪╪┌╪╫╫╪╪┘╪┘╪┘╫╫┘┘┌┘┌▄▄▄█▄▌▀▀▀ррр▌рррссууттрсттсрсттстфуутуфхфхццхуцхццццчхффффусс▀▌▄▄┌╪╫╥╧═╠╠╔╝ЪБvs~ЛХЪвжйнп│╖║╜┬┼╞╔╠╠╠╠╠╦╠╧╨╧╧╧╤╤╧╬╬╦┼│и                          УМИЕГАА|{{|zzwxxussstqpuuqqtuwxuqsy||АВБ~wt}ЗВk\X\mЖЕqfihggjlmot|}xxtvy~ЗКЖ}skgUVXY[\]Ybml`RQUX\aimllvБГwh[OU]ac\MKS]c^NDFMX_[PGDLXVG>HWYKENZa_TLP\ebNNY`a[QO[egfm}}dOR[d`YRT[`cie[SV^fkh^X]ehhimkkj^NRaklgfimmikljUFJPTPPT^hghlrpkhd[TV_ejmnkgdcinnidc`UPTYXVUQIILVXUSRV\^\SLLOSXYYWURSSSSSSRSU[^XNReqla[XUUUUW\YQECFHOUYXXXVMBAO`f^M@<<=;9?JSX[\ZNB844>LgndVPWZWQLGCEC=87:>HTXWRKA=DMSSJ:=IRXWOHDA@?CHD>HPVWTNFEJPQLCBKRNFA>>IPNFCDB>Н                        ╒cdfdghhkkmoqvy}ГИНУХЬео▓┤║╝└─┼╟╔╩╚╦═════╠╠╩╚╩╩╩╚╚╔╦╩╔╦╔╔╚╔╟╩╦╦╩╧╤╨╨╤╙╙╘╘╙╓╓╒╒╫╓╫╫╫╫╫╪╫┘╪╪╫╓╫╫╫╪╪┘╪╪╪┘┘┌┘╪╫╫╫╫╫╪┘┘╫┘█┌╪╪┌┌┌┘┘┘┘██┌┌┌┘╪╪┘┘╪╫╓╩ЮgQOSQGGcТ╗╬╘╪╫╫╪┌┌╪╫╪┘╪╫╪┘█▄┌┌▄█┘╫┘╓╒╥╥╘╓╫╒╓╫╪╪╓╫┌┘╪╫╓╒╒╘╒╓╓╫╓╓╫╫╫╫╪╫┘╫┘╪┘╫╫┘┌┌╫╪┘┘┘┘┘██▄██▌▀▐▀рр▀▐▀рртссттууттурсстттууфутуфффххцфуффцчччццфццхустр▐▄▄┌╪╫╥╧═╩╦╟╛ЧБusКЦЬгдйн▒┤╕║╛┴┼╟╚╩╩╠╦╦╠╠╧╨╧╧╤╨╤╧╧╬╔┼┤й                          ▓ИЗЗЖГ}||{zzz|zxvsssrpqqoprtuwwvuz}}|~ААxs|ДБo_UTkАВynhehghikmqv|{|yxzzБ}sifb[TUVW[\^gnj]QRTY]dhlpt{ВГzeVPT]caZOLW_cZLEGMV\[NDFNVTG?JWYJCMZ_`RLR\d`JMYbdXLO[fmntИЖ}eRUZhaWPV_cgkgYQXaehgZT^kkgkooli\SP]hieeijffjmkSILTYSPWdhhjkpoplf\PV^chjnogbbclqnheaUNS_aWQLGHJZd[VSTX_[QKKPVWYWVVWVWVUVWVUVZ]YSYmzoc]ZVUTTV\WPHGKPSWZYXXRI=?N^c[K?;<=>:BMTYZZYRB622>TpxlZVY[WSLIFGD@969>LTVURIA?FNSPF7;IQVUNHFB>>@CEAIRWXSLEDHMPKCDLPMFC?BHNLFCBB?к                          ∙╕nbdefghiiijoqry~ДКПФЮезм▓╖╝┐└─╟╞╚╚╦╩╦╦═╩╚╚╩╔╚╚╚╩╦╔╟╚╔╔╟╚╚╦╦╩╩╬╨╤╤╙╘╒╘╙╘╓╓╙╒╓╫╫╫╫╒╪╫╫┘┘┌╪╫╪╫╪┘╪╪┘╫╪╪┘╪╪╪╪╫┘╓╫┘┌┘┘┘┌┌┌┘┘┌┘┘╪┘┘┌█┌┘┌╪╪┘┘╪╫╫╓╠еnRNPNLHZН╕╬╘┘╪╪┘┌┌┘╪┘┌┘╪╪┘┌┌┘┌█▄╪╫┘╫╫╘╒╓╫┌╪╫╫╪╪╫╪┘╪╫╫╫╓╓╓╫╓╪╫╓╓╓╫╫╫╪╪┘╫┘╪┘╪╪┌█┌╫╪┘┌┘┘┌▄▄██▌▐р▐▐▀▀▀▌▌▀▀рсссттууусрсстттууутттффффхххфххцчччццфхццутт▐▐▄█┌╫╫╙╨╬═╠╟┐ШВwq~КФЩадзмп╡╖╗┐┴╚╚╚╚╚╔╩╠╦╠╬╧╬╬╨╧╧╧╧╧╔├│к                          ╨ЖДДДГ~z|zyyyyuutssrqqrronruxwvuvx{xv|~~xv{БВxgZXm~Аxjdfdfdhlnyxsqqou{yia`^YWXY\^bkmgZSUVY_fhlsyГГxdUOV_ccZPNX__VE?KSWWTKFGQWQFBMYXI?J^f]PJQ_h`GNYa`XNQ]gkoxОД{`QU\d`XUW^ejlgYRV_eie\V`pogjnomh^MP\ffddfmkijlkPIPVWTX]dhhihnnpneXR[bdfimoncceinojf`VOU]cZSMHEGMWYWVXY[ZRMMQTVXYWWXWWUVWYWVX]^XQ\wАrd^\XTSUVYUMEDORVYYYVVNB;>Pfj[K@=>?::GPVYZXUPB834?FNTOB5AKQVSJDDA9;╚                             юЯbbfgggdfgjmqsw}ГЙНУШЮжо▓╖╣╗╛└┼╞╟┼┼╔╩╔┼╞╚╚╟╞╚╟╦╩╔╔╟╟╟╟╟╔╔╚╩╬╨╧╧╤╘╘╥╥╙╘╘╘╒╓╫╫╫╫╒╫╓╓╪╪╪╓╓╓╪╪┘┘┘╪╓┘┘┌┘╪┘┘┘╪╓╫┘┘╪╪┌┘┘┘┘┘┌┌┘┘┌┌┌┌┘┌┘╫╫┘╪╪╓╓╫╬оsMGORMGWИ▒╦╘┘╪╪┘┘┘┘╪┘┌┘╪╪┘┌█┘┌█▄┘╫╪╫╫╘╒╓╫╪╓╫╫┘╫╫╪┌┘╪╪╪╪╪╫╫╫╫╓╒╓╓╫╫╫┘╪╪╫╫╪┌┘╪┌█┌╪╫┘┌┌┘┌▌▌██▄▄▐▐▐▀▀▐▄▀▀▀рррттсстусссууууууутуууууфхфхфххцццчхцххххфтр▌▌██┘╫╘╤╧╠═╩╟┐ЩГvs}КХЫвдзмп╡╖╗╛┴╞╟╚╟╚╔╩═╠╠╬╬╧╧╨╧╧╧╧╧═┼│й                          тБВБАБ}}|~}z{yxussrtrrooppposuvuuvw~{vvzytx{АqYVnБВ}ofgedffkn|И~ldfnxЛУЛpaa]VWZ[\`gol`VQUV[affis~АБАtaTT[bfaXNMZb_RBCMTWYRHBJRTODCNXUHCO^d]OLRae`HOYa_VOV_ils|ЕВw^RX`fcVTX`gjnfYRZafieWVbqoijmrqj^RV]dfbcfhhgjmiNIQ[\WY_ghihhikmleVMZdeehkqribeglmkj_UOW^_YSMEDEIKMOYcb_ZPKNPSWWWTUWZXXZZYXX[_]YT_~Йwg`ZWUTUWYUKDHNTWYYXXSG=9CTbf[KA><@BFLTXYYUSMA857?TvЗ~ma^[YSMHFHE=659BNVYVQG@>FOSLC=DLSUSJCC@>?@A>@KSXYUMBEKRQJBGMPKEB@DLOIC?A>>т                                █Иdccdcehiknquv{ДИОФЮгио▒╢╣╛┴┬┬├─╟╞├┼╞╟╟╞╚╚╔╔╔╟┼╟╞╟╟╟╔╚╩╧╬╧╨╤╙╙╥╥╘╘╘╙╘╪╪╪╪╫╪╓╓╓╪┘╪╪╪╫╪╪╫╪┘┘╓╫╪┌┌╪╪╪╪╪╓╫┘┘╪╪┘┘╪╪╫┘┘╪╫╫╪┘┌┌┌┌┘╫╪┌┌╪╪╪╫╨╢}RELNKDOГн╟╘┘╫╫┌┌┌╪╪┌┌┌┘╪┘╪╪╪┌┘┌╪╪┘╫╓╒╒╓╪┘╫╫╪╪╫╫╪╪╪╪╪╫╪╪╫┘╪╫╫╒╓╓╪╪╪┘┘╫╫╪╪╪┌┘┘█┌┘╪┘┘┘┘██▄██▄▄▐▐▐▐▌▐▌▐р▀р▀рттсссстртууутуууутууутффхххххчцччфцуцфхутр▄▄██┘╫╘╨╨╧═╩╞╛ШДvsКУЩаезл░╡║╜┐└─╟╚╚╩╩╦╦╦══╬╧╧╧╬╬═╧╧═┼┤з                          ЇГДВБА~}{{{xyxxttssssvqqrrrqsutssuuxwtsu{}wvzБw`ZqГЖБsieeddgfn|ЙАkafs}ЙШбЧtae_WUY[^ekkeZRSUTXbhedm{||zl[QT]bd^TNS]c_RCHQYXWPGEKSUNBDOYRDDRbe[MKTbf\GOY^]UQVaijkwКАu\S\hmaYUYagklfVR[bfidZWbpthhmrql\MU_deebdihhikdMKU\YT\bffggfilmlaVOWbeediqpjfcehlml_RPU]d\WNGDEGJKOT[a^YQKMQVXXWVUWYWXYYXXW[__TOaВН{le^YUTSTWULBJQTVVXXULA9;?BHQVXZXTRJ@96GNPK@:FPTWSHABABLRWYSMECNTRIBFLOIEA@DNQJC??=@ї                                  ¤╚tbcbdgiijjnpuw}БЕНУЩаин░╡║╜╗╜└┬┴┐┬┼─┼─╚╟╚╟╞╟╟╞╟╟╚╟╟╟╦╬╧╧╧╤╙╥╥╥╥╙╘╙╒╓╫╫╫╫╪╫╓╫┘┘┘╫╪┘╪╓╫╪╪┘╫╫╪┌┘╪╪╪┘╪╫╫╪┌╪╪┘┘╪╪┘┌┘╪┘┘┌┌┌█▄▄┘╫╫┌┌╪╫╪╫╤╛ДVEPTRGMyд─╘┘╫╓╪┘┘╫╪┌┌┘┘┘┘┘╪┘┌█┌╪╪╪╪╪╫╫╫╪╫╫╫╫╫╫╫╪┘╪┘╪╪╪╪╪┘╫╫╒╒╒╒╫╫╪╪┘╓╓┘╪┌┌╫╫┘┘┘┘┌┘┘╪┌┘┌┌█▄▐▐▐▐▀▀▐▌▐▀ст▀рттррсссртуфууууутуфцфсууухуцхцццччцуцчцус▐▄█┌┘╪╓╙╧╧╬╠╩╞┐ШДvwКФЫадин░╡╣╗╛┬┼╟╚╟╔╠╠╦╠═╬╧═╬╬╬╧══╧═─┤и                          ¤ВГААААБ{zz{{zusuusrrnosrrprutuutsyzuuv{~zvyАЕ}e`t~АБ}nedddfho|Й~jeitБРбйЬvfg_YW[]_hng^WUSUV\bea_gsz|vgVQW`dcZQOU`fbPDLSZ\ZRDBLSTNDDR[RCFU_dZMKVceWGOZ_^QMVaijchszq^V_lsaUTZehmnfVR]dhjcVVbptjkmuvjZOS\bcgeceggijcNMW]]\\dhijjgjmlldTKYceccglohdcafkpmaTOU\^`ZNFDDFHKNTV]_ZPLMQWXVXXVWXVWVWWVWY__VQaГР{qf^[URQUUSKDKQSTWWUQD=7;L[eeZI?;8?FMTWYZTRNIA<59>QrЗЕylb_^XOJKLE=68?HRYXUOD=AHONI=A?<=>?>EMTWYULEHOSRH@FOOIC?AFKOIC=<>C¤                                     Їоhafgfhgijlmqux~ДЛОУЪазно░┤╣╝╜╜╛┬┬┬┴─╟╚┼┼╟┼╞─╟╟╟╟╟╦╧╧╧╧╤╥╙╥╥╥╥╙╥╘╓╫╫╫╫╫╫╪╪╪╪┌┘╪┘┌╫╒╫╪┘╫╪╪╪╪╫╪╪╪╫╪╪┘┌╪╪┘┘╪╪┌┘┘╓╓╪╪┌╫┌▄┌┌╫┘┌┌┘╪╪╪╥┼Л\CLONGOuЯ┴╒┘╫╓╪┘┘╪╪█┌┘╪┘╪╪┘┘┌┌╪╓╫╪┘┘╫╫╪┘╪╫╫╪╫╫╪┘┘╪╫╫╫╫╫╫┘┘╓╒╒╓╪╪╫┘┘┌╫╓┘╪╪╪╫╫╪┌┘┘┌┘┘┘█┌┌▄█▌▐▌▌▌▌▐▀▐▀▀▀р▀рттсутсрстуфууфуутууфууууфхфцчцчцццфуццфтт▐▄▄┌┘╪╫╘╧╬═╠╔┼╛ЫДuuЙФЫаджл▒┤╖║╛┴┼╟╚╟╔╦╠╠╦═╠╬╧╧╬╧╧═╬╧═┼┤й                           ДИДБААБ~{yz{xsuvurrrpoqssqsuvxxvnuzysuГАxx|АБmctБ|w{В}fabeggp}ДnbfuБПднЬwjlgZRW]clpcXUVVWY^de^[guАБy`TRYbfd[OOYbfbMCKWZZVOGELSTKBERZQCHVcdYLKXffVIOX][RMVaha\^fqm^Zbnm`UTZbgnoeWR[ehjcVUamqmkmprjWGS\acegeghehkdNNX]\^defijjgjkjjbUQ]dgccghjgd`bcfmlaUPTZ^_^REDDDEJSWTU[YQLMQVXXZYWXYZXXYYWWZa^VRcДН~tia^^_TRVTMDINRVWVSL@<OlГИ{qgbbZSIJMF=7;AKTZZVNCEOVYZVMEGPTSGBIQQJB=?EOQJA<9=?FT_fh[JA?>HOUX[ZVOMNH?;6:@PkГ~xjiicWOQOI=7:DMUXWRL@=BIOLE>BNVWVNDAB?;;>?>GPUYZVHDIPSQD?IPOJB>@HMPKC>9:U                                           ■╥xaaeggiimonrwy}ВЙОУХЬвейм▓╡╣║╣╛┴├┬┬─├─├├──╞┼╩╠══╬╤╤╥╥╥╙╙╘╙╒╒╓╓╓╫╓╫╒╓╪╪╫╫┘┘╫╓╒╫╫╪╫╫┘┘╫╒╒╓╪╫╓╪╪╪╫╪┘┌╫╓┘█┌┘╪┘┌┌╪┌┌┌╪╪┘┘┘╪╫╪╫╒╠ЧdFKRVUTqЩ╗╥╪╫╪┘┌┘┘█┌┌╫╓╪╪┘╓╪┘╪╪╓╪╪┘┘╫╪╪┘╪╫╪╪╫╓╫╪╪╫╫╪╫╓╫╓╓╒╓╓╓╫╪╫╫╫╪┌╪╫╪┌┌╪╪█┌┌┘┌┌██┌██▄█▄▌▀▄▌▌р▀▀▀ррр▀сттттссттсттутуфтттуфхфффффхфхчцхцччхфцуутр▐▄█┌┘╫╫╘╬╬═╠╔╞╛аЖut~КХЩЮдко▓┤╣╝┐┬╟╚╚╚╩╠═╦╔╦╦╠╧╧╬╬╧═╬╬╔─┤╝                           ├МЛЕА|{{{zzz{xstvvvqpoorvwoswxxyupu{zuu|ГИ}xv|А~}{Аxrw{zumgdgglyЖЖudbtДУйпЭ}nolZR[bike]VUVY[^chbWYlzГГt\VU\cgcVMR^fd[GBQ]aa[MGHNUSF?IVYPCEUcdVLQ]ggVKMSYZSNVde]PKXfhbejmj^RS[eimmaTRYagkaUU^gnrlgloiSKU_dceeceffii^NNTXY^fgghlmjhkol_QMZimfcbcddda_`bfg]SSW]`\YOKGHFBGQWZZ[WMIHLOSUVVVVWXVWWYWXZ][PQb~НВ}wtromXUUQJFKQSVTRJ@9>ENX`hhZG?@@JTWYYVQNKKE=79:ARi}ДВАrpxt^MOOG>9EPPJ@?<;p                                              ў╕mceefikklmqux|БДИМТЦЩазмп░▓╕╝╜╜╛└┴┴┴┴┬┴──╚╩╠═╬╨╤╥╤╥╙╘╘╙╘╘╒╒╒╓╓╪╫╫╫╪╫╒╫┘╪╓╒╫╫┘╪╫╓╪╪╫╪╓╫╓╒╓╓╫╓╫╪┘╓╒┌▄▄┘╪┘┌▄┘┌┌┘╪╫┘┘┘╪╫╪╫╙╬бhHJQWWXoХ╣╤┘╪╪┘┘╪┘┌█┌╪╪┘┘┘╪┌██┘╫┘╪╪╪╪╪┘╪╫╫╫╫╫╓╫┘╫╫╪╫╫╓╓╓╓╒╒╘╫╪╪╪╪┘╪┘╪╫╪┘┘╪╪┌┘┘┌▄┌█┌┘███┌▄▌▌▄▄▌рр▀рррр▀ртуттссссссссртффууутцфуууфхццхххцччхфцхутр▐▄┌╪╫╫╙╥╬╬═╦╚┼╛аЖutzЙХШЮдйо▓╢╕║└├╟╟╚╟╩╦╬╠╦═╠═╬╬╬╬╧═══╚├│╗                           ▄ЛНИА{{zz{zzzyxxuwsppopopurw|yyzysuzwryВВААxx~БАvwusrw{|ynfdekuАЕxhcsЕЦм░Юlhi^U^isg^VSWWZ]bii_UZlyАzmWRV\be_VSV]edYGEU_dc[KFHPVQFBIVYKBHT\^VNP^ghSINUZXRQVacXGIXabahstl^RT]eknm`TTZ`jm^TU[bmrmilldTKT]`_ddddehll^NOSUS[eghknnlihjh^LK\ilhdcbadgdb_`ce\QPX\]ZWNJIIJIKSZ^_^XOHIKKNORTTUVWVWWXWXZ^YRQc{ЙИАvqomcUVWRIINRRUSNB;8BKRX_ffXHAABPV\][VMGHIC:64=AITWXUOH?:;HPUZdmgUIBBERY[]YSIFHGB:45=CVhwВКЙ}|p]TSNG>>FKTYYTPH>8BIKJALSWXWTJGKRSLABMSOG=<;з                                                    ▌Йefghghijjmosw}ЕЛТФЪЯелоп│╕╣╖╣╜┐┴┬─╞╟╚╟╩╦╬╧╧╤╥╥╥╤╙╘╒╒╘╒╓╫╓╫╫╫╫╫┘┘╪╓╒╒╪╪╪┘┘╪╫╓╙╫╪╓╓╫╫╪╫╪╫╫╪╓┌▄▄┘╪╫┘┘╪┘┌┌┘╓┘┘┘╫╫┘┘╘╬кrPJSY^YgМ╡╥╒╫╪╫╫╪╪█┌┌┘╪┘┌┌╪┘┌┘╪╓╪╪┘╪╫╪┘┘╪┘╪╪╫╓╪┌┌╫╫╪╪╫╘╓╫╫╓╓╓╓╫╫╫┘┌╪╓╫╪┘╪╫┘┌┌┌┌█┌┌┘┌▄▄▄┌█▌▌▄▄▌▐▐▐▀рр▀▀ртсртс▀ссттууттууууфуутуфухццффффчччцууфуср▀▌▄╪╪╫╓╨╬╬╬╠╦╩┴аЖwuyИФЪбжмн░╢║╝└─╟╟╟╚╦╦╠╬╬╬═╧╧╬╬╬╧╧╬╩╟├│╗                           №ЕКЗ~{z{{zyy||wwuusqrrpmquvvwy{z{utx~zvx}ВА~nhioz{tlkmnryА{ridgp}ЖАncyКб╖╗иНofhhegni]ZVVVX^cficZU^ksvpd]`aadd[MT^dgbQCJ[bc`TB@JSTLABKWYH>FRXZPMT`f^NINTVTMOYbaUDMX_`drВЙu^ST\elnk\UW^bkk^UUZ_kqmjhkgQLW_a`deebehjm[POOPQW`ehjnpqjfhf\LL\fklhecdiljfbbecZPPW[\[UNJJPTMMQY]_^XNJKLKLHLMOQTTRSUVWWX[VOPaxНПВpcWPRV[\WOIJSUTKC<;@LSY_eheUGBCHRZ^[VNFEGJB821;EVhvВКИВ~tcUTTOD=>DNUZWNJF@;CIKGBAMSVVRD8>E?:;:;ALSXYWQFDNSSMBCNRMG@>BKOOH@=;<╚                                                      №├sbddfehhjlmnqw}ВЗМСШЫадйо▒░┤╕║╛└┬─┼╞╚╚╠╠╠╬╨╥╥╨╤╘╘╘╘╘╓╓╓╓╫╪╪╫╫╪┘╫╫╪╓╫╓╪┘┘┘╪╓╓╪╪╫╫╫┘┌┘┌┘┘╫╫┘┌┌╪╫┘┘┘┘┌┘┌╪╫┘┌┌┘┘┌╫╫╨пwTNS\dafИ╢╤╘╫╪╪┘┘╪╪┌┘┘╪┘╪┘╫┘┘┘╪╓┘┘┘╪╪╪┘╪╪┘╪╪┘╫╪┌╪╓╓╪╪╫╘╓╫╪╓╘╒╫╓╓╫╪┘╪╓╫╪┌┘╪╪┌┘╪┌█┌┘┘┌▄▄▄┌█▌▌█▄▐▀▀▌▐рр▀▌рссррсртстууутуууууууусуфффххфффхчцчуууут▀▀▐▄┌╪╪╫╒╥╧╧╬╠╦╔┬гЗtqyЗУШбзмо▒╢╣╝┐─╞╟╟╩╩╦╠╧╧╠╠╧╧╧╬╬╧╧╬╦╔├┤╜                            ЖКЗ~z|{yyywxwstuurpprrnosuuvxyzyuqryzwtzГВ|lbclu{wkfjmppzБ}pfkr|ЗДqg~Уп┼╟╕Хtggiikk`VVWVUY`hlg]WW`hpslc`dhhidYMS`ejaQHQ^de^R?DLQRKCCLXWE>GSZXNMS^f]MKRVWUOO[fbTIO[b`gyДИr_RU`glnk]RV_bik_VW]aiokgkndMLW^`^ffecekkj[MNPQS[`efhlppliid[OO[afjjdcbfloh``ccXPQW]^\XNHHRWQNSXZ\]XPLORQNLKIKMNOORSRRTW\UMO[rКЛpcWTWX[]ZQLPUTPH;8AGOU[`elcTIDDHS[\YRJBDHGA824CIID=>OSVWOC=AE@;8:DMQOD==BKPME=:9:т                                                         єжfdddehjjkklsv{}ДЛОСЦЮвгзн▓┤╣║╜├──╞╟╔╩╦╠╧╤╥╧╧╤╘╙╥╘╒╒╓╓╫╪╪╫╫╪┘╫╘╫╪╫╓┘┘┘╪╪╫╫╫╪╫╪╪╫╪╫╪╪┘╪╪┌▄┌┘┘┘┘┘┘┌┌┌┘╪┘┌┌┘╪╫╓╓╧▓{UHR^caaД┤╨╙╓╪╪╪╪╫┘┌┘╪╪┘┌┌┘┌┘┘┘╓╪╪┘╪╪╪┘╪╫╪╪╪╪╫╪┘┘╓╓╪╪╫╒╫╪╪╓╒╒╒╓╓╫╓╫╪╘╓┘┌┘╪╓┘┘┘┘┘█┌┘┌┌┌┌█▄▄▌▄▄▌▐▐▐▀▀▀▀▐рссссттсссууутууффффууууфццтууфххчцчххфутр▀▌▄┌╪╫╓╙╨╧╬╬╬╩╟┬зИvszИУЩвин░│╢╣╝└─┼╟╩╦╦╦╠╬═╦╦══╧╬╧╧╬╬╩╟┐│║                            ЩЙЖ}z}||zyyzxwwssrqopnlpvxpovxzzxsrx{zwyАЕ}k_Y^r}ymhjlnos}ЕrqryИИrkЖв├╨╥╞з~nknnldZUUXXXXcig_Z_dbfnniekzsokdXLTbfg]MGT`ee^N@FNVRGBDN[TAAIHA855>EO`p}ЖМЕtcYVVUOD<DG@:9:CJMLD=97;ї                                                            тПcbdhiihhjnprw~ДЖКОУЩЬбзм░│╢║╛└┬─╞╚╔╩══╧╠╧╤╘╤╤╘╘╘╒╘╓╪┘╫╫┘┘╓╒╓╪┘╫╫╫╫┘╫╫╓╫╓╓┘┘╪╫┘┌┌┘╪╪┌┌┌╪╪╪╫╪┘┌┘┌█┘┌┌█┌┘╓╓╫╨╣АYHR^ea^▓╠╙╓┘┘┘╪╪┘┌┘╪┘╪┘█┘╪┘┘╫╫╫╫╪┘┘┘┘╪╒╫╪╪╫╫╪╫╫╫╫╫╪╫╓╪╫┘╫╓╓╫╓╓╓╫╫╫╓╪┘█┘╪╪╪┘┘╪┌██┘┌┌┌██▄█▌▌▄▐▄▐▐▀сс▀▐▀рссстссрстутсуууууууфтхфцхфтуххцчццххфус▀▀▄▄┌┘╪╓╘╨╧╧╬╠╩╟├зИvvzИУЩгимп▓╡╗╝└─╟╚╦╠╦╦╬═╬╦╬╬╬╬╬╬═╬═╩╚─▓╣                            ╕ЕЗА}}}zyzxxstvtutrpqsqpsxqkpuxzyqry{{wx}ВБqbZXh{|qjijikpu|Б}tswАГwqК▒╬▌▄╧│Нvvtoc\ZWWXYZZcnh\X`nkdhiiirА~sjaUMWdff\MHRbfd]MCISUOJCFPYS@@LUYSLLWbf\FKU\[UMR]e_UHPahgoГФКk[U\eikohZT[dhjf]X[`dhmjhlmaKP[``afffeeiklWONOSX_fjihknrnkge\NQ[agjlifbdhkicab_UOSYY\[ULGJOUSNRVZ]^VOMTUVWWVPMLLKJHGHHLUXRJJRjВКВsd[YXWYXSLKNLID?9@MUY\]`gkcSGBEKSWVRJ=9?CE?:79@BI\lzЕМКzcXYXVOD;CORKB;98=¤                                                              ■╤zedebdfgkmosw{~БЖЛНУЩбжйп╡╣╣╜┐┬┼┼╟╦╬═╦╬╨╥╨╨╙╘╘╘╘╒╫╓╒╓╪╫╓╒╫╪┘╪╓╫╫╫╫╪╫╓╓╓╪╪╪╫╪╫╫╪╪╫┌┌┘┘┘┌╪┘┌┌┌┌┌┌┘┘┌┌┘╓╫╫╙╜Ж\CN_ga[zм╩╥╫╪┘╪╓╫┌█┘┘╪┌┌┌╪╪╪┘╪╫╫╫╪╫╪┌┘╓╘╪╪╫╫╫╪┘╫╫╫╫╫╓╓╪╫╫╫╫╫╓╫╓╫╫╫╫╫╪╪╪╪╪┘┘┘┘┘┌┌┌╪┘┌┌┌┌██▌▄▌▐▐▄▀▀ср▐▐▀ррр▀рссрсссутууффууфутуухфуфхцххццчцхфутр▀▌▄┌┘╪╓╙╧╧╬═╦╔╟┴зИvtzЗТЩгино│╢╣╗┐├┼╞╩╦╦╦╠╠═╦╬═══╬═╬╠══╚─╡╕                            ╪ЕЕА}~|zzxxuwvtttrlmppqqrnmquyy~vpt{utzАvhVTct}xnjkkjlorw~zx|}}wЦ║╓ур╥┤ФЗynh_]ZWYZ[Z^hneVVbkhdgginwБАvk_TO\egfYJHXdfe[NGMUYOFDGT[Q@@MWWRLMXdf\FKV\[QLS^e_ODUceckВФЕjZX_iknngXU\filfZW_gefkkjjiaKP\cdceffbbfgiUNMPT]ajonjkosnmkfZGP[aejnlgbbenng]a`TOV\_]XTLGHNUPMRUY__TMNQTVYXVTRRSOONMOOQVVRLJPbГПВrcYXXWYWPIJMJE>=;DRWY[^aehaREDFKUZXPG>;@GE?96:@CGVgvДОПБk]Y[WND>>JV[YPDB?::CGDA@FPWWSJ@AHG@:9:@HPPIB<99@                                                                  °╗nabefighllotw{АЕЙРФЪЯдм░│┤╗╛┴┬─╚╩╩╦═╨╨╨╤╥╙╙╘╘╓╓╓╘╫╫╫╓╘╒╪┘╫╫╫┘╪╫╪╒╓╒╓╪╪╪╪╪┘┌╪╪╫┌┌┘┘┘╪┘┌┘┘┌┌┌┘┘┘█┌┘╪┘┘╘├Л`BK\d_Ywз╞╤╫╪┘╪╫╫╪█┘┘┘┌┌╪╫╪┘┘╪╪╪┘╪╫╒╪╪╓╒╪╪╪╫╓╫╫╫╫╓╓╫╫╓╪╪╪╪╫╫╓╫╓╫╪╪╪╫╪╫┘┘╪╪┘┘╪╪┌┘┘┘┘┌██┌█▄▌▄▄▌▌▐▀рср▀▐▐▐▀▀▀ррсрсссттуууууутхуухффутххххццчцхусср▀▄┌┘╫╫╓╘╨╧╧═╠╩╟┴зЙwvzЙУЩдмнп┤╢╕╗└┼┼╚╦╦╦╦╠╩╠╦╬╬╬╬══╬╬═╩╚┬│╣                            юЖЗА}{{zzyvwtwvussspprrssxpnqwxuxttsw}{vuzА{mWR_oy{vkhijkkmov}~||АИЦ╝╫р▌╠мРАtjaYYYYZ[][ajlaWW^fdcikpw}ЖЗyj]RT^egcXMMZfedYIDNTSMEBIVZNA?N]]OHNWehXFNVYYTNU^d^NEUgi`brВwgZ[bkooneVU]ejjgYWammgihhml[JS[bebdgifdfedSNOTYadknmjkkqpnmdXMPZadgknjdceimmgd`VPV^c]UOKHHNY[UPSTZ^TMNQUWYYYYWVVSSSQQSSVUMJLO^АНГsg[ZZZYVNFFLG><>BKVYYZ^`fh_OEDGKUXUNB9:DIG@85=A?FUbsКТЗti`ZVMC?ANY\VLDB?8;CEC@@HTYWPF=AHE=9:=AKSW[XQJC@JPLA?KSSL?:?FPPI>:;=S                                                                     шФbceeedfhlnrty|ГЗМСФЮгзн▓╣╗╜┐├┼┼╚╩╧╨╬╧╤╥╘╙╘╫╫╒╘╓╫╓╘╘╓┘╪╓╪╪╪╫╓╒╒╒╘╘╓╫╪╓╓╫╫╪╒╪┌█┌┌╪╪┌┌┌┘┌┌┘╪╪┘┘┘┘╫╪╪╘╞РdFMVcebvб┴╬╫╪╫╫╓╓┌█┘┘┌┌┌┌╪╪┘┘╪╪╪┘╓╓╓╓╪╪╫╪╪╪╫╓╪╪╓╓╓╫╫╫╓╪┘┘┘╪╫╫╓╒╓╪╪╪╫╪╪╪╪╪┘█┘╪╪┘┘┘┘█┌┌▄▄███▄▌▌▐▐▀рр▀▐▐▐▐▀▀▀ссс▀рттттууутухуцхцххууффххцчцчцхууср▀▄┌┘╫╫╓╥╨╧╬═╠╦╟└жЙxuzКФЪдйоп┤╢╣╝└─┼╚╩╦╦╦╠╠╠╦╦╦╦════╬═╩╚┐╡╣                            №ГЕА|zzzzywvsstvutrmorrpqvqrtwywzwwxz}zw{ГЖuWT\hw}{rjhjjllkmv||}ЕЛУп╚╙╦╖ЫЗvlg_XYYYZZ\[dlj[RTX_egjnw|АЖИ|jZOTaffbVJP`ge`WKGOWTKDAIW[N@BRYXOKO[fgWFMV[YOJT^d]LFWhh]\ekmb]^fnqrkdYW_fjjeWWcnnjijkjg\OU]bc_bffbacdcQMLT]cdjqqnoknnolbVIR\_aflnmeefgjmmg`PJT^_\WRLGGLY`ZRNTXZPMNSUX[\ZYZZYVWWUSSUVURLLP]ПЕti\[YYZVNFFEC@>CGPVZYZ^`ee]MDEHLSVTJ?8;HMG?:49ADHRan{ИОЛ|nb]WMC@FRYYUI??>:=CED<@LVYXPD=@HG>8:>CMTX[YRG@EOOIB=JVRKC>@JQOH>9:GOUZZUMG=AKPI=>LSSLA=@IPOGA;9:К                                                                          √├qcddfhiiilnqw|ГЗМРШЭгй░╡╣╗╛─╞╟╚╩╬╧╨╨╥╥╙╙╤╘╓╓╘╘╫╪╫╓╫╪╪╓╒╫╓╓╘╒╫╫╫╘╒╓╓╪╓┘┘┌┘┌█┌▄┘╪╪┌┌╪╪╫┘┌┌┘╫┘╫╒╦Чi@EN^`\mЪ║╬╒╪╪┘╓┘┘╪╪┘┌█┌┘┘██┌╪╪┘╪╓╘╙╙╒╫┘╫╪╫╫╪╪╪╪╫╓╓╪╫╪╫╫╪╪╪╪╪╓╓┘┌┌╪╫╫┘┘╪╫╪┌╪╪┘┘╪╪╪▄▄▄█▄┌▄▄▄▄▐▐▐▐▀▀р▐▐▀▀срррср▀сууссуфхфуусууцццууфтфцчццфуффутс▌█┌┘╪╫╓╙╨╨═╦╩╚╟┐жИvs|МФЪдйн░│╢╣╝└─┼╟╔╔╔╔╦╩╦╦╦╦╦╦╦╦╦╬╬╦╟┐▓╕                             ТЖГzzyxxyzvvvvspqmopqrouusrtxvxzyuu|ГДuv}А}ja^fozВАuhjjkjgijlqv{}~}ДЛППЙzmdegaRUVXZ]ahlf_WTTV^ijdhw}АЕЖwcVQ\egc\SNXcgf`TECPYTEBDNYYKBGUZYPLQ^gcOEMV[UIJWceYHJ[fcTPW`e`_flrwwqdUT\ajpeTWeqwnkkoohWKS]cbabdgec__\QKKU]agimpqnimopndPHWdcdfjongcccfnqk\NIT[`cZPJEDEKNSWZ[a\SNOSWYZ[ZY[\[YXWZYXXYYNGIS\}КЕ|m_][YVSMEEACEGJQVWVWW[\de]JCEILSSLC<9BOSI<83?GPWXVLC=EKG>:;?ISWZYULE@EKKGABMQQJB>@JPLEA<;<п                                                                             єдgddghghjlmpv|БЖМПЦЬгкп│╢║╜└├╟╩╦═╬╬╤╨╨╧╤╙╙╙╘╓╫╫╓╓╫╓╒╘╘╓╓╒╘╫╪┘╒╓╪╪╪╒╪┌┌╪╫╪┘┌╪┘╪┘┌╪┌┘┌┌█┘╪┘╒╒╬Яn>BKW\\lЧ╖╧╓┘┘╪┘╪┘┘┘╪┘┘┘╪╪┌┌┘┘┘╪╪╫╘╒╘╪╪╪╪╪╪╫╪╪╪╫╪╫╓╫╓╫╫╪┘╪╪╪╪╫╫╪╪┌╪╫╪┘╪╓╪┘┘╫╪┘┘┘┘┘▄▄▄█▄▄▌▌█▌▐▐▌▌▀▀р▐▐▀рстсрсссуутртухфуусттууцццхууфцчцфустттс▀▌┌┌┘╫╪╫╙╤╤╬╠╦╔╚┐лИvt{КУЩвимп┤╢║╛┬├┼─╚╔╔╩╦╩╠╠╦╔╔╦╦╦╦╦╠╦╚┐│╕                             ╗ЕДА{yzxxyxvuusrprqqqssquwvqruvy{yrs}ВГxuw|~qkaioxГЕ~hgjjhehjkpu{}uwwБЛРМБface`PRVW[^elsbYVVVVZikcalzАГАp]UW_ehdZQP]fhf_PADRYQFDHOYWJDKU\XLIS_gcNFOVXUMMXebXKO]c]QLU`caflotvzsdUT\ahkbVUbpuqmjnplWLU]bbacffec`c^PLLRY_dgnqrmkjmqnePHWeedcjlmjheegjnk]LLU\_dcXLEDEKMORX[\ZSNOVYZ[YYZ[\[ZXXYZYYZWOHGN\wОН}m_[ZZXSMCA=BHKORUTUVWW[deXLEIKNRNF>::ITSG;65=DIOV\esyВЛЛАlbWJ@AKVXXOE@AA:?A>;AJRXWTMB?GKD<:=@OUZ\[UJD?CNLD?CLRRI>:AKSOD;;<=╬                                                                                уРgeefeijkmoty~ДИМУЬвжм░┤║╛┬╞╞╟╟╦╬╧╧╧╤╥╤╤╙╒╓╫╓╓╒╒╒╘╒╓╓╒╒╫╓╒╙╘╓╪╫╘╫╪┌┌┘┌┌┌┘┌┌┘┘╪┌┘┘┘╪┘╪╪╒╒═еr??FV][gУ╢╬╒╫╫┘┘╪╫╪╪╪┘┌┌┘┘┌┌┘╪┘┘╪╫╓╓╒╫╪╫╓╫╫╫╪╪╫╫╫╫╓┘╪╫╫╫╪╫╪╓╪╪╪╫╪┘╫╫┘╪╫╫╪┘╪╫╪┘╪┘┘┌▄▄██▄▌▄▄┌▄▐▐▐▌▐▀▀▐▐▀▀сутрсрсутуттуфууффуутууфуууфхцццхфуфуср▐▌┌┌┘╪╫╓╙╨╧╠╦╔╚╚┴мИwsyЙТЩгймо│╣║╜┴─┼╞╞╟╟╩╩╔╠╠╦╔╩╩╦╦╦╠╠╦╟╛▒╣                             ╓ЕЕА}}{zzzxvuusrpprqoprqtvustxvw{~upyЕЖzzxx}|p`goyГКЗsiiijgghimsГwfrАНЧЬШmb`cbUSW[]aiom[VWXVUZjg_]exАЖzgXSXchgaYUU_fhf\NDFSXPCCJPYTFAKVYPLLVbg`LFPZ\TKNWbaVGO]c[ONVbeadp}~{udUT[`ilaUW_nwslhmnkWMU\`accbefd^^[QMLRYdikoqsnhhmpncNI[cedbgklhgebdfij\MKU]_bb]PEBFILPSXXZVQMQWZ\YZYZ[[[ZXYY[YZ\[QHKNZsЛСВpb\WYWSLDACHNQSSVUTUSTWceVFCIJLNH>99BRVRE931?BIQW\`mtЙКДtbXG@BLWZXOC@BA=?@=:>LTXUPG>BIOD:8>AOSX\[VMD?HOJC@DMRQJA:APVYWNEBEKMC:;@HPSVYXRLDAFLMC=DOUSJ@?HNQLC:;;;ў                                                                                     °╗nbdedefgkmpt|БЕЛСШазн▒╡╕╗┬╞╚╞╚╦╬╧╧╧╨╥╙╥╘╘╒╘╘╘╘╘╘╘╘╓╒╙╓╫╪╓╒╪╪┌╪╪╪┌┌┘┌┘┘╪╫┘┘┌╫╫╪╫┘╪╘╧пtA:@LRVdЛ┤═╘╫╪╪╫┘┘┘╪╪╪┘╪╫┘┌┌╪╪┘┌┘╫╓╪╪┘╫╪╒╒╓╫╫╪╫╫╪╪╫╪╓╓╪┘╪╓╪╪╪╫╫╪┘╪╫╫┌┘┘┘┘┘┘╪╫╪┘┘┘┌┌▄█┌▄▐▌▄▄▐▐▀▌▀рр▐▐▀рссссрсртсусруффууффффхфцфуфффхфхххууфут▀▐▄█┘╪╫╘╘╤╧╧╠╦╟╟╚┬иЙzqyЙФЩвикн│╖╣╗└├┼╟┼╚╔╩╔╔╠═╦╩╦╠╦╩╩╠╠╩╞┴п╡                             №ИИГ|{zzzxusurrrstuojlrrnoqqquxxwxywyАЖГАzvx~xjjnxГДВА|ogifgdhjsАЗ{drГУЬаЩq`]ae[UW]dkpj_TWYYY[`c\X^j{ЖДt\PV_gih\RU[gijcWKEMVXKCDLU[QDBNXXPKMXbeZJLWbaSLQ[baREPbfYNOYceaoАЖЖЗ}saUW^cgi^TVZfpohgjnlUOV]`dffdee`\^YONTZ^jmjjnqqoklnnaNO]ijfdfghjjfa_bfeZJGT\]^_[RHGLLIKUZ[[YSLMQTVXXWXZXZZ[ZXZ\_]WNJLNXhЖТКte\WZ]WNGGLPTTTTVWTNLKTcdVGEIKJFA<=DOYWQD701AGMTWY\cpzЖРНАt\KDGOXYUMEABA;??<>889ALWZYRB712=CLUWUUZfuБНРЙx\HBFPUVSLDAB?;=;9>ITVXSI?BIPRC<@ELRWXVQKFCCJKE?ALUSNGCAJVULA;99O                                                                                              ¤╩zecfgffjlpsvГИНФЪело▓╣╜┐┴┼╟╔╩═╧╧╨╬╧╤╥╤╙╤╤╙╙╙╘╓╒╘╒╓╓╓╒╓╫╪╓╓┘┘┘╪╪┌┌╪╪┌┌┌┌╓╒╬┤{M=:GUZ^▓╠╥╫╪╪╪┘┘┘╫╓╫┘┘╫┌█┘╪╫╪┌┘╪╫╫╪█┌┘╪╪╫╫╫╫╪╫╫╫╪╓╒╓╫╫╫╓╪╪╪╫╓╓╫╫╓╫╪╪╪╪╪┘╪╫╫╪┘┌┌┘┌┌┌█▌▐▄▄▄▌▐▌▄▌▀р▀▀рррсстттссттутуутсрууутууфххццхффхххтттср▄▌█┌┘╫╘╥╤╬╬╠╠╩╚╚╔├лКzrzИТШвилн░┤╕╜└┬┼┼╟╚╚╦╔╩══╩╩╦╦╬╬╬═╠╔╟└▓╗                              ╡ЖБА|yyxxtssssrrrrrootwmhlqpiptux{yvБЛКГshegsАxknВywБxhdgfginzЕ~ko~ОЫиЪ|cT\miZXgoj_UVX[]`cgdXSW`mwzveVS]diiaTR\flkf]RLQZ\TE?FRUUKBDP^ZHEP^feSDO]aYOLR^e]NIUhhWOR^fedtВЕЙЗВs^UZafih[UX[bkmebhmeLOY^_beed`_]Z\TNNV_fhllhinsojjif\MQ]fmmiggggmmf^`dbSILSZ_]]VMIJQRLNV^^_YOJKKNOOPRVW[ZYYYXWY\\ULKLOP`~ФТБupmkeWJIOTUVXWWURIA?FXb^QEDGF@:8;FRYZZSC7029AJSVRNS^q~ИСП{\IBFSVSPKGEA<::77>JUYWPE@CLQLC=?FNUXYVOJGB@ILI@APUSNEBAIXUJ@<;;p                                                                                                 Їоkdddehkmmov|АЖКСФЫгло▓╕╝┐├┼╟╦═╠╠═╬╧╬╨╨╨╥╥╙╘╓╙╥╘╒╫╓╓╫╓╪╫╫┘┘╪╫╫╪╪╪╓╫╪┌┘╓╒╧╡~M68EUYX}о╩╤╒╫╪╪┘╫╫╪╪┘┘┘╪┘┌┘╪╫┌┘┘╫╫╪╪┌┌╪╫╫╓╫╫╪┘╫╓╓╫╓╓╫╪╪╫╓╓╪╫╫╓╓╫╫╫╓╫╪┘╪╪┘╪╪╪┘┘┌┘┌┌┌┌┌▄▄▄▄▄▐▐▐▄▌▐▀ррррссссстсстуууууутттууттууутцчхфухффуттср▐▌▄┌╪╫╘╙╤═╠╦╦╦╚╩╚┴мЛztyИТШвйлп░╡╣╝┐┴─╞╚╚╔╔╚╦══╦╦═╦═╬╬╠╦╔┼┴▓║                              ╒ДГА}z|y~wtvvsqrqponpsskilqpkpttv{{z|ГЗБyn`_pxxprДztx~Аqedgggmuuolr~НЩдЩ~cW\loihmmdYV\][]ahmaRPT`mxwna]`dghi]RR_hkkf[OMT\]RDAIRXVF@CR^XGHP\ebRHR`d\NHS^c[KDWgfWOU^hebkМЛЙЖt]U]bgihYTX\bhkfehjcMOZabacee_^YTYTNQY`fhmnmjmqvmihe[KO^eklkigfgiljdadbSHKRW^`]XMHJSTPRX]_^VNILNOMLLMPSWXXXYYVX[\TJILPR\{ФХЙxd]`\REIMSVVWWVTOF=>JZe`OEEHEA;9>ITZZZQA7/3:BKSSMJKYjyЕОР~^KDGUYSNKIGA==;68AMXYUOD@DNQKAAFQW\[YM?8039@IPMHCEO`pzИС~bNCJVYQLIHIH?:;9=GSWZTMC@HTVLADO[aeZMCEGFBFJQW\\[XK;3-08AIIGAADO^lyДКvWDAJVWTOKLLHC=<=BKU[YSHBEOTTJ@=GPVYVSNJE<>>ў                                                                                                               чТ_abfgigkotyАИМСЦаем▓╡╖╗┬┼╞┼╚╦╠╬╬╨╥╘╙╙╘╙╒╘╓╫╫╓╒╫╪┘┘╫╪┘╪╘╒╘╤┴Н[1,2IRXWLCCLX[JAFNW`YFIZedTLLPWYRIQbj_PGNTZUILYgs~zj`fksushYU]cedefilm[OV`fhfbee]URWYOKPYafhlpqlfioqplbOFR^bejnqjacgfghhf\NGN\a\YXTKDKVZTRQSYYSKOVZ[ZYYYXWWSQONLKNRSMGEJKMSlЙХКxf^ZWPCKNSUUSMH>?CJU]`aYJDEIJCINTX\][XG:3..7>EHEADIS]huАГoSBBLWZXSOOMF=:=?EQWZXSD?FNUSI@@HQWYWSMJHC?BFEBGMUVPGAALUXPA:>=?■                                                                                                                  ╘~bbacfikmpu{АЕКТЪгжм▓╣╜┐└├╟╚╦╠╧╨╤╤╤╥╥╥╥╥╓╓╒╒╓╓╫╘╓╓╫╪╒╒╘╨┬ПZ1*/;EFeЭ╝═╘╒╓╫╫┘╪╪┘┌┘╪┘┌┌╪╓╫╪┘╫╓╪┘╪╓╫╪╪╫╫╪┘┘╪╪┘╪╪╓╫╫╫╓╒╫╪╫╘╒╓╪╪╒╓╪┘╪╫╪┘┘┘╪┌┌┌█┌┘┌█┌██▄▄▄▌▄▌▄▌▐▀с▀р▐▐▀▀р▀ррттттрсууссуххустсутуууусуухутттр▌█┌╪╓╘╘╒╙╬═╬╦╦╩╦╩╚┴нЛwsxЖТЪвейо▓╡╢╝╛┴┼┼╟╚╟╔╚╔╔╦╩╦╦╦╠╠═══╦╟┬н╔                               █ЖЗ~yyxxvtqrpnqssrqonsrstuwsptzwtzВЕomsz~l[]co{}sca`a`bfkqv{wqwwvs|МЩаЭР|rtqjbZXZ\]`cegfc_VPUelghjhzААДЕ~jZSXcilngZMO]daYKCHTVUH?COY\I?FPWZSIM[ecRHKTYXQFOakaRKOVZTHLZhrzwkejoqssh[Z_cggeeimnXPX_fggdcc[QNSWPLP]ehkknqojgnpsocNEUcehjmpmfcccfjle[LHPW]^\XSJIMW]ZWUPRXTKMVZZY[YYYYYVTTRQNNTTLFEJNOWiЖФНyi`[WNCINSUROIB=BIOV^cdWHCEIMKMRWZ]^[SF92-25>CFA>GPV^gp}}iREFQYZYVONLF=;?@HRY[VNDCIQTSIAAJSXYWTMGD@@DGC>HPVWOGCCKVXMB::9B                                                                                                                     ·┬n_`bcfgknuz~ДМРЦЪви▒│╢╗└─╞╟╩╦╧╧╧╤╤╥╤╙╘╫╒╘╒╒╫╒╓╪╪┘╓╒╓╨├Р\/*-5HSWYQDL^gbOJLTYVNGNck_RMQ[^WLLZgnxwibkpsvthYY]dihedfklVOW`ehgfebZONVYQMR]gigglpokknrupeNEWgjjhlonhddbbgki\NGNW]``ZRJHMSRTTUXYZQKMTX[[[[ZZ[ZWWWWTSTWSLHFLOQWhВФОzi`ZUMDJQTTPGA@>DLRX^b`UHBEJLKQUWY[\XSD80+07@CEABGDCGPWUNEBELUVL?9:;_                                                                                                                        Єаa`aaddgmqtyГЙМТШажм▒╕╝╛┴─╟╟╦╦╠╬╤╧╥╘╒╘╙╘╘╙╘╘╒╫╫╒╓╘╨├Т^1)*3;BiЬ║╬╓╓╒╪╫╫╫╫╪╫┘╫┘█┘╓╫╪┘╫╓╓╫╪╪╒╪╪┘╪╓╪┘╪╫╫╫╪╪╓╫╫╓╫╓╫╓╓╘╒╓╫╫╒╓╫╪╪╫┘┌┘╪┌██▄┌█┌█┘┌█▐▌█▄▌█▄▌▌▐▐▀▐рррррррс▀стттсстуттуффууутуффсутуфхфтсстр▌█┌┌╫╒╘╥╤═╠╠╦╦╩╦═╦─оМwouЖУЩаел░│╡╡╗╛┴┼╟╟╔╩╔╔╔╚╩╩╠╦╩╩╦╬═╠╩┼┐л╔                               ¤ДГА{yzyyvqoomnrroppotuv{ДГytrwyxw|А}y{АЗ|`YV^m}~mb^][[^_cilrwyyvux~АЕБ|sifhjcYVWZ]j}xrk`TTVZaejjikw}АВГx^WW]fllmcPKVcf`TGELWWRGCJU\XA?JTX[OIP`ibNFMUZWNFQej^QQR_`VKO[gkvskhptwzveXXZaifcdgjiROV_ehhfd]XONSWSOU_diihjoqmikorobLFZgjjhinmgcabbfgg\MIOW\_][QHFKMMMPS[^WOIKTY[[\Z[[[[XYYYVVW\XMGIMQUYe}ФУ}kaZTJCGQROKDACEKSVZ_dbTEDHJNQUUVW]\VOC:1+27>BA;:IW]_cjwt_JCGU`ff\URMI>>BGNV\\UGBDMUVQE=@LVZ[VOIDC>?FGB?JSYVMDAENXVLB;<<@NX]aairm[HAJZhsk_XSOE<>FJRZ\YTGAENUWQD?BMZ[ZUMFCB@>BCBCJUYWLB>HNUVK@:;:Х                                                                                                                             ■╨t__bfijlmtzДМУШажл▒╡╗╛└┬┼╚╩╬╨╨╤╨╥╤╙╤╙╒╘╘╒╓╘╨─Щe5(&/8@`Щ║╧╓╒╒╪╪╫╓╪╪╓┘┘╪╪╪╪╓┘╪╪╓╓╪┘╫╓╪┌┌╪╪╪┘╪╫╓╫╫╫╓╫╫╫╫╓╫╒╓╒╫╪╪╫╒╫╪╫╓╒┘┘┘╪╪╪┌┘┘╪█▄┘╪┌█▄█▌▌▄▄▄▌▐▀▀▐▀ссррссс▀ссттсуффууууфууууусууусууфусттр▀▄▄┌┘╓╘╒╤╨╬╠╩╩╚╔╠╬╩├░ПwruГСЩЮжлп│╢╢╗┐├┼╟╟╔╔╚╚╚╩╩╦╠╦╠╩╩╠╠╦╦╚┬л╚                                Щ}ywsrvwsqqrpppprwtruxzАБzstx{}xwБЗИЖ{qr{uibdku{{scVRQSRSVY[^`egjnt{ВБzj[UWgrbSPPSkБ|reXRXYZ]gnf^]fwВД{jVV\bfkji]RQ]gh^PGEOXXMGEKX^R>DMU\YLGSdl^IFM[_YKFWghZPMWbbSLQ^jtz~~ВКПЖzrcYVX^ffcbfigNMW_dhlfbZRMMVWQPV`gkkllnomjilnn_II]gkljhgiolbaabcaVLLTX[]_[SGFKNKKOVYZVMFJTY\]ZY\[[YZYYYXXY[VJEJNQUW]tСЧДqf\TKEHMNJDAFKOSVX\_e`SDCHNSWYZ\YUQMI>6--4:=<<GNU[\YQGCIRWXPC>FRYZVRJDBA9:9╜                                                                                                                                ў┤k_bccdejns{ВИОУЫглн▓╡╕╜└├╚╔╬╠╧╨╥╙╙╙╒╒╒╒╒╘╨╟Ыd9,&-8>_Х╕╧╫╓╒╫╪╪╪╫╫╓┘╪┘╫╪╫╫┘┘╪╓╫┘╪╪╫┘┌╪╫╫┘┘╪╫╫┘┌╫╫╫╫╫╫╫╓╒╫╓╫╪╫╓╒╓╪╫╒╒╪╫╪╫╪╪┌╪╪╪┌┌┘╪┌▄▌▌█▌▄▄▄▌▐▐▐▐рррррсстссуутстууттууутууфутфуутуффтртрр▌┌┌┘╪╒╘╘╥╨═╠╩╩╩╩╦═╚├▒РyuvДТЩЮжлп│╡╢╜┐─┼╟╟╔╔╟╟╟╚╚╩╩╦╦╩╩╠═╠╦╔┴п╔                                ╛А~{wupqssrqropqrsvurtuvz}{rsv{{zy~ЕГ{rpqwzqgint{Бzj]TOLMJKJLQSV\cltБЛН}hXLOfwdNJKPdvtk`XUX[\\afcWYhyДЗ{eTT]dhjjg[OSagd\NEISYWKEENX[Q>@LUZVJEVfh\GHQ[^VJJYiiYNOW_`SJO`lvАЕПЪЮЧЕvbXYY\fhedffeMMW_agmhbZPMM\VNPXahmnmkmpolfknk^KK]inmliiknlfbaaa_TLITZ^__\SFEKLJHO\]\WMHJSVZ\[\[[[XXZZZYZZ[TLGHNUUW[pПЩИuh]SGDHIFDDDJPSUWX[ac^PCAIPUYZ[ZYTLFE>5..4>@?AELXZVJCAGRYWI=::=┘                                                                                                                                   эЫ_]^abfjnsx}ГКПЦЬгкп╢║╜┬╞╟╚╩═╧╧╤╥╙╘╙╥╙╙╨╚аf;-)+3:`Т╢╬╒╒╓╓╓╫╪╪╫┘┘┘┘┘┘╫╪┘┘╪╘╓┘┘╫╫┘┘┌╪╪╪╪┘╪╪╪╪╫╫╪╪╪╓╓╓╓╫╓╓╫╫╓╓╓╫╫╒╓╪┘╪╫╫╪┌┌╪╪┌┌┘╪┌█▄█▄▄▄▄▄▌▐▀▀▀срср▀ррс▀ртттсуууссууфтууутсуутстффтррсс▌▄█┘╫╘╘╘╥╨╠╩╟╟╚╟╩╔╟┬▒ОytvДСЩЯил░│╡╣╜┴┬─┼╟╟╟╟╟╞╟╚╔╚╩╩╦╦══╦╩╚┬░╩                                сА~xxrsstsqrnprruwunpsuxx{xtuz|zw}БАym]dxБrfjqtuВvf^\YVROMHHGINWgxЖСЧПmSJIavfH;=G^kiaZWVZ\^``a[V\k{ЕД{dTX_efhlgXOWbkhXJFKT\VHGGNY]L=DMWYUJCCHSZTE=9:@ё                                                                                                                                      █Б^_addgmov|ДИМТШазо▒╕╜└┴┼╟╩╩═╬╨╤╤╤╥╤╧╚зf?-%(.7^Р│═╘╒╓╪╪╫╫╓╫╪╪╫╪╪╪╫╫╪╪╪╫╫╪┌╪╪┌┌┌╪╪╪╫╫╫╫╫╫╫╫╪╪╪╒╓╓╓╪╫╫╫╫╫╓╓╓╓╒╘╪┘╪╪╪┌┌┌┘┘┌█┘┘┌█▄██▄█▄▄▌▐▀р▀с▀ссрртсрттуттуутссуууртуутсуууттфхусрс▀▀▄▄┘╪╒╙╒╙╤═╦╔╔╔╚╩╚╟┴пПyvuЖТЩЯин░│╡╣╛┴┬─╞╟╟╞┼├┬─╞╚╚╟╩╦╠══╠╦╚┬╕╬                                ЇА}zsvrrturopnrrrtuwonquurutusu{{xxБГzk\[o~xjjott|ЕВsabdc^\XVSPSWZfzКФЩОnQ:A^oaF75C_neXTWZ\\_bb^XV^mzАu]SX`ehkmdWPZgjbUHEMUYTGFIOXZLBIT[]TEIZggTFIU\]SGL_leUHLVa^SIQcq{ЗИДИОЦШПБeXZ\_dfefhhbLOY`egkgbUMMT[ULP[ciptrknqqpkijg[IN^jpqmijilpnfacebUJKSZ]``]TJFMPJKR[^^VLILNNRWYYZZZYZ\\[X[ZXSMIMSTUW[lРЯЛ|m\P??GHDEIMSUWWVV\_b]MBBKSWYYXXSMIKC80+,3::7;GT[]YVSMNTODFZqvg\WWVNB=BKQV[ZTMDBLWYVK@?GRY[YPDBDA;::;?FPVWRIBBISWRD;98=¤                                                                                                                                        ¤╟p`bcdhknuzДЛРШЯел▓╖╕╝└─╞╚╔╦╬╨╤╤╤╬╟зe?,%'-4[Н▓═╥╒╓╓╓╒╒╒╓╪╪╪┌┘╪╫╪╪╪╫╓┘╪╪╓╫┘┌╪╪╪┘╫╫╫╫╫╪╫╫╫╪╪╓╘╫╫╓╓╫╫╒╓╓╒╒╪╓╓┘┌╪╫╫╪┘┌┌┌┌┌┘┘▄▄▄█▄▄▌▌▌▀▀▀ррррссрррр▀стуутуууттуутртууссуутттффустрр▌▌┌┘╫╒╘╘╥╧╠╦╔╔╚╚╔╚╟┐пОxtuЖТЪбин▒╢╖╗╛└─┼╞┼┼┬┐┐└┬┼┼╚╩╩╦╠╬╬╠╦╚├╖═                                ■А|{xzsssusopnpqrssuoquwuquvxwy||yv|БoUXeournntw}ДЗАlddgc_^^\W[\`k|КУЩПqUBCYj_H?JUZ[PEL[feQDLW[YPELamgUJNXc_TNTcozЗИ~~ЗОРО}bZ]]_`fgggi`LOZdggij`SMOV\WNO\eintvqjnrqjiieYGM[iopokhikmmgbdeaSILRV\_c^TGIOTPOT[^^TKHKOOOQSUYYZYYZ[\Z\\YRKGMSSSUZnПЦКАo`SAADHJKORVXWUVX\bf]K?CLSWXYXVOEDIB61)*4665>OW\[YTNIHLFAH^oubYYYUMC>AIQX]\SGCDOXXTLA>HUZ\XOEEH?9:99@HOV^]QHEHRYXUJAAJVZYULECHB<:77=HSYYSG?BOW[QC98:L                                                                                                                                               юЮ``bcdfimt|ДКСЧЮейп┤╕╜┴─┼╟╩╩╩├Юc<&&.SИп╩╤╘╒╙╓╓╓╓╫╪╪╫┘┘╪╫╪╫╪╫┘┌╪┘╫╫┌┌╫╒╫┘╪┘╪╓╫╫╓╓╓╫╫╘╓╓╓╓╓╒╒╒╓╓╘╒╘╫╪┘┌╪╪┘╫╫╪╪┘┘┘┌█┌┌┌┌┌▄▌▐▐▀р▀▌▐ррсрсррррсстттуусстуутсуффттттттухутссс▀▄┌┘╪╓╘╘╥╨╬╩╔╟╟╞╞╞╟┼╛нНupvЕСЩбип▓╢╕╗┐┴┼┼┬░бЬае▒╡╝┴╟╚╦╩╠═╬╩╚╚┬▒╦                                 Ь~~zwusttqmqqqppqqurstusoquwuu|Б}osАЖy^ZYhuztnqqw|~}|jheeededekor|ЙОХОwZCFU]]VVacb]VUY[[[`hi`PKWalttoc]_bbfhicYTV_hl]NJLRZ_ODEKU]XEDR]_\OEQ_e`NGP^c^QHQdocQLS\c]QMVdow{tkktЖГta`egeehhjii\QW^fihfd]SPVa`XPR[ehktwrnotrojhcSEM]ekqrohiimojcae]RJMTX[^b_VMKQVOKR^a_QEDMSTQNLKPTXWYZ[\[\^\TIFKQRSV[kЖЫФЕtcRBGJPUWWTWYXVX[^df\I?FRUX[[WPE>BF@:3+/7748FW[\YUOHBAFA@LiЖЖka_\YLC?BKSZ_\NDDJSYYUH>@LWYXSHCDFA=;99AKY[YRGBCOX[N@9::h                                                                                                                                                  ▄Г`_bdfknty~ЕЛТШаел▓╖╗╜┴─┼┼╛Ъ_<$ $/SЗп╚╨╙╘╒╫╫╫╫╫╪╓╪╪╫╫╓╪╫╪╫┘┘┌┘╫╪┘╪╫╓╫┘╪╫╓╓╒╓╒╓╓╓╓╒╫╒╓╓╓╒╘╒╓╓╓╓╓╒╓┘╪╫╪┘╪╪┘┘┘┘┌┌╪┌█┌┌▄█▌▄▄▌▌▐▌▀▀ррссрсрртсттстутссстттутуууттттфцутсср▐┌╪┘╪╓╙╥╤╨═╦╦╔╚╟╞╟╟╞╛оМxquЕРЩайм▒┤╖╗╛└┬┐▓гЩЪадЯн╢╛─╟╔╔╠══╦╩╚┬п╦                                 ─|zxwvsrrpnssrrssrtruwvsnqutqt|Б}nq|Ж~fXYdu~xmmosy|АВ}rmfdffbdkuВЗВКОУНx\GJR[ZY]gfZTSVZ\_]aih\LOXakopjefpnighk`WSYdkjXOJLT[]KBELUXSHGVdf\OGTbi_LGT^d`QJSenaOIU`d^OKVenvxiZWcxГpa`gomighhfk[SX`figgc[NNYfcVOPZeimprsompspmhcRBL]ekrrolihjllidb]QGMX\ZZ^\ULKRRNMT[][ODFQXWUQMIJMNTWWYZ[\]YQKGKQORV[iЦЦЛwaO@FLSTWVTVWXXXZ]ccYFMY[[VQJD=CNV\]WJDFLU\YTHACLVYWSIDHH@:957BQXYWOE>COYYM>689З                                                                                                                                                    ¤╚sbddgknqtyАИНФЫглп│║╗╛╛┤Ц]9$!&0SЖм╚═╤╘╥╓╓╓╫╫╫╘╫╪╪╫╓╪╫╫╓╫┘╪┘╫╫┌┌╪╫╪┘┘╪╫╫╓╪╘╫╓╓╓╘╒╒╒╒╒╒╘╓╫╫╫╫╫╫╪┘╪╫╫┘┘┘╪┘┘┘┌┌┌█┌▄▄▌▌▌▀р▀р▀▐▀ррссррр▐▀рсссссттттууттутттсртрртуут▀рр▌┌█┌┘╒╙╥╥╧═╩╩╔╟├┼╟╟╞┐мМxqrВСЩайм░┤╖║╛┴├╝гФЩвжгЫЩк║├╞╔╩╦╦╦╩╩╚┴п╩                                 с{{xwwwtupmoqqppqrstsuwwqqtxvw|Вptz|p]Rct}}ulkouvzААytjccfdej}ЗИЕКОЦС|_MLPY^chh^SSUVYZ]\aebXPQV`gnohintqkjij]VV]fjfQHJNVYZEBGNV[QCKZef]MHUcg]HHU`e^METgm^PMUcg^PMXfrtraNOYk|}l``foomjhiik\RYafgfebYNPZc`WPR[eikquqomqrrnibNDO\chosplhhjmlkfd\OINVXWZ^\RJKQUQMPY[XOHISYYYSMJJGGKRSVXWZ[XOGEKNNRTWbyФЩЛs^OBFNUXWVVWYYWUUY`bWD>FOVY[WME>>FH?6/.378:CS]]ZVNIDDJKB@LmКП{pg_XK=9DRY[]VGADLV\[TGACN[YXSGCIJ=887;DRXXWNDBFRYWL<779о                                                                                                                                                       Їоjdefijnrx~ДЛСХЮдм▓┤┤нРZ6!!&0OЕл╟╬╨╙╙╘╘╒╫╫╓╙╒╓╓╓╒╫╫╫╫╫╪╪╪╫╓┘╪┘╪┘┘╫╫╫╫╓╫╓╫╫╓╓╒╓╒╒╒╒╒╘╓╫╓╫╪╫╫╪╫╫╓╪┘┌┌┘┌┌┘┌┌┘┌▄▄▄▄▄▐▌▀▀▀▐▌▀▀рр▀▀▀сррсрсрсрссттутссуууутсутффффтр▀▀▄┌┘╪╪╒╘╥╨╬╠╔╔╔╚╞┼╞╞┼╛нМyorГСШЮжн░│╢╕╝┴─┤ХПШбвЮЪЪЯ░╛├╟╔╩╩╦╦╩╟┴н╬                                 ўz{yxvtqrrnoqspqrtutprtsqnmrruzА~xtw|xfVdu~А|qgnsvtwБГ{phddfel{ИКЕМПФСАeSQP]klgaXWVVWZ\^`ee]RLQU_fkkilt}xnikgXSX`hkdNJLOWZWDAFOVXNEM\hg[IHWei^CIYbd\LHVfm\NOWdg_OKXfmqn\LLTdrui[]hpqrqmkknZT[`eff_`WMO\kbUPT]fkilprojnprqkbOHS]cgmrrmihjkmnebZMHMX[YY[\RKKORRRSUZ[OFJU[]\ZWSPNMKLMORUWWTNGCHLMPQR\vУЧЛu_MCIMTXXYWWYYVRQW`_SD>GQWWWRJ>8@GF@4//359@KX]]YUMEBBKLD>KkИПГxi`XH<;HSX[ZSEDFOW\YTE>CPYZWQGBHJ?665:HTXZVMC>HTYVI;88:╬                                                                                                                                                          щУdddgjintzБЗНТЩаезЭЙV3#-KДк┬╦╨╤╤╥╥╥╘╓╓╘╙╓╓╓╓╓╫╫╓╓╓╫╫╓╫╫┘┘┘┘╪╫╫╓╫╫╫╓╫╓╓╒╘╒╓╓╒╒╒╘╒╘╓╓╓╒╓╪╪╪╫╫╫╪┌┘┘╪┘┌┘┘▄█▄▄▄▌▌▐▀▀▀▀▀▀▀ррр▀▀рррррс▀срттсуутссууутсрссттуусс▐▌▄┘┌╪╫╘╙╥╧╬╦╚╟╟╟╞╟╚╟┼└пМvkrГТЧЮзн▒│╡║╜┐┴нТТЭддЮФСЦж╖┬╞╟╩╔╦╩╔╟┐░╬                                  }zxwwxuvroqtsnopsusposvtqptuww|{xvxАБl[et|ВВuhlrvtt{ГДzqicaan{ЕЙЙНПХФГhX\\ckkb\ZXXX[\^_ad_WONSW^fijmuy~{unmeSUYbgh_LHLRX[VCCKQWYL@O`gcWGJXcgZDM]ed[IFVik[MOXbh\NNZfnqmZIKS^oseZ`ituvtqnnlXRXaehhc`TJP]c^UPV`hnmlorrnkmrrmbMGS]bglprpliihjnhbWLHNV[][YVRKJOVWTRQUVMFKW\^^][YTSOMLIKMPRVTMFDGJKMNOXoУЪМwaMCGLUZ\ZWXYYUPOR_aSCAIPWVTNC;9?JH?50-05?JUYZWNCBIRY\WQFADS_\XNBAIH?768?JSWZUMCDHSYUF;87:щ                                                                                                                                                             ╒}_cefknrw|ГИНУЦХQ0!*JАд┐╚╬╬╤╥╤╥╘╒╒╘╒╒╒╓╒╫╓╓╓╒╫╫╪╓╫╪╪╪┘╪╪╓╓╓╫╪╫╓╫╫╓╘╘╒╓╒╘╘╘╘╒╘╓╫╪╒╘╫┘╪╫╓╫╫┘╫╪┘┌┌┘╪███▄▄▄▌▌▀▌▐▐▐▐▀▀▀▀▐▐рсррр▀▀сртсттртссстуттттттсутр▀▐▄┌┘╪╫╓╒╥╤╬╧╩╔╚╟╟╞╚╟╟┼╛оНxjrГСЧЮжл░│╢╗╛└╛дТТЭегЩТЛМЫ▒╛┼╟╔╩╦╦╩╟┐░╬                                  Бyxussssrqrttrqrsssqoqutlmuwvt{ГБxsu}Еvbfs{БЖyjkqrppuzБГ}sjddn{ЙЛИЛСЦЧЗm^^_gjf\UVYWZZ[]`ddZQNNQR]fknpy|А~vpkdQS_ejj]JJNT[\SBDMSWUIGRchbUHLXffUBK_feYKJYgiXIM[cfWJN]hnplUGIPXhm`[guzywurqomUUZafhie`RJQ^e^QPVblqjlorpjjmsvqdLFVdghkotqmighilkeWMHNV\baYQMJJMW\WQRVVLCJU[``]\\ZYVRPMNONNOOLFEHIKLMNUkСЬНxdNBGNVZYXXZYWPLLR[\RB?HRWUNF?8:FNK?3.-06=IU]_[VNDCGLNKA@MiВРНДraVF;@LUY[WKADNU[]WSHBHU_]VKCDIG?356>KWXYULAAJUXRB845;∙                                                                                                                                                               ·┴n_adfkntz~ГЖЙwJ,!(F|Ю╕─╦═╬╨╨╤╥╙╘╙╘╓╫╓╘╓╓╫╘╒╓╫╓╓╓╪╪╪╓╫╫╪╫╫╪╪╫╫╫╫╫╘╘╘╓╓╒╘╒╘╘╘╘╓╫╓╘╒╪╪╓╫╪╪╪╫╪┘┌┌┘┘┌┌█┌█▌▌▐▀▐▌▀▐рр▀▐▐▐▌р▀р▀▀рсррссстусстстстттссссттр▀▌▌█┌╪╓╒╙╨╧═╠╚╚╟╟╟╟╟╞┼┼╜пПxnuГСЦЯейп│╖╗╛╛╕бСУЮжЯЧПМПШм╕┬╟╚╩╩╩╔╟┐░═                                  бz{wwusqqpsrpootuqqqqtwsoqv{{wyГ|tv|}tlkox~ГАtlnurnrty~zsgeozБИЙНХЩЦКqgjfhf]SOVZ]\\Z\cjeVNORVW[eilxАypi_OVaink\GGNU[ZPAEOUYWGCUelbO@GXa`R@JajeWIGVfhVKP[deTKQ]hmmgREFNVdj^\mА~zywvrolVRY^ejld[OLT_a\TPXdnvmlorrmknrvqcKI[eghjnsvqkkjghkiZMHPW\]\XRLHHLOSUTUWSJEJV^`a_]][[XXWVRQOOUSKDBGIKLMQRgОЭРxeNEGPVZYY[\XPKGGP\]NBBISXVMB;0*,3779AMYYYUJABITXRB97;>                                                                                                                                                                   ЄгcceghkosxyiF) &CwЫ▓╜┼╔╩╦═╬╤╥╥╤╥╙╘╘╙╓╓╘╘╒╒╫╓╓╫╪╫╪╓╫╪╫╓╓╪┘╓╙╓╓╓╒╘╘╓╓╒╘╒╘╒╒╘╒╒╙╙╒╪╪╫╓╪╪╪╫╫╪┌┌╪╪┌┌┘┌█▄▌▄▐▄▌▌▐р▐▐▐▐▐▀р▀р▀▀рррссрсстррс▀ртссррстттт▀▐▌▄┌╪╪╫╒╥╧╧══╔╔╚╟╟┼╟╟┼─╜пПxkrГРЧЮдй░┤╖╝╛┐╣ЭУФЬвЭХТННЧи╡┴╟╔╩╩╩╩╚└░╬                                  ╟xxrrtusrpossppsxusqqsxxopv|ysv{ГЕЖГyqoqx{Вsknonoprw{~{pqw}БДНФЧУЗvmmhd^XMMW]^]^^^dj`RMNRUX_hjmxЕГЕД~sh^UYdlnkXEKQW]ZMAEOVWUIIXflaMAFVcaM@NbjeWFEReeUJP_fbQHM^glphQFIPVcgaaoГЕД}wsolUSY`glmf[RMU__ZOSXcoqnnmorqnnpro`JP_klijknvtnhgfhkj\KIS]^^^[SJADJMOOPS[UHDMW]aba^]^b]YYYYUTUSPJCDHMPQSSVdМЯТydNGLQTXZZZZUMECFS][ODEKRUSH;<=HRUK=2+-3@KU\_`XND>CNRSL@?OhzКУПАm[GADNW[YSD=FQX\]XNB@KW]ZOEAGKI=67IW\WOEAGKG;77=GQZYXRGABJT\Q@8:8c                                                                                                                                                                        ■╨xaacaR;!:lПЬм╡╗┐┴┬╞╔╦╦╩═╤╥╧╨╥╥╥╥╘╘╒╒╓╫╓╓╘╓╫╪╫╒╒╒╒╓╫╓╒╒╒╒╫╫╒╘╒╓╓╘╒╓╫╫╒╒╓╓╫╪╪╪╪╪╓╫╪╪┘┘┌┌┌┌┌┌┌▄█▄▌▐▌█▌▐▐▌▌▀ррсрррррсср▀рссссс▀▀срссссстсс▐▀▌▄┌╪╓╒╘╙╤╬═╠╔╚╚╟╞┼╟╟┼┬╝мМvlsГСШЯеко┤╢║╛╝┤ЩРНРПМББДЖНЩ░╝├┼╞╚╔╔┼╜м╩                                  ўuvsuxxutvrrsrquzrsuxwuxssvzzxuu{~}wlmzБtlnyВВvqonnpqpnoppsruwtuz{{xtlkaYRRRNJS\]^acghbXSSSUX^cebblyЕИВrcXT^immfTIMS[^YF?HQYYPDJ^hgYIEIR]ZFASdhbRFDQ`^PISahcVJLYanodQHMSY^aWS^l|УЦСИ|skRUYafijeXPNU[ZWNOXcnrroknrsoknok[HPblnlkjosrpkhggceVKKU]`a`]VJEEIKLQVWWSFEPVZ_caab_b``^][YYZWRJDEOSVVVWZbКаХz`JGLSVY[[VOF==BM[a[JHSYWI91),6BMW\_^RE=HKE=9DPY[XOFFMVY[[XK?>JY[UMGHNQF;7:>ISZYXPE>BKTYM@:9<й                                                                                                                                                                              ёd32XuДОУЩгзп│╗╜╜└╞╟╚╩╦╬╨╬╧╤╤╙╙╘╘╘╘╙╘╘╓╒╒╓╓╓╙╘╘╘╘╘╫╫╫╘╘╓╓╫╒╘╓╫╪╫╫╪╪╓╓┘█┌╪╓╫┘┘┘┘╪┌┌┘┌███▄▌▌▌▌▌▌▌▌▌▌▀▀р▀▀рр▀р▀▀р▀▀сс▀▀с▀рсср▀р▀▀р▀▐▌▐▄┌╓╒╘╘╙╨╬╠╠╔╞╟╞╞─┬┼┼┼┬╝мМujvГТЩбзм░╡╕╗╛╛║бРЛЛД{npswГХм╝┬┼╟╟╟╚─║з▐                                   uuuxwrospnpuwswrrvxuouwvsx|{vsyБГya]nywoot}{БЖВvfhgjlnnnohhlorruvzxumeb\RKMSSGOZ^_afk`XTUWWX]`c_[\k|ЛОЙ~k[W_fjmk]MIPW\]TIFLSVWH@L^heUFFNUWTA@Weh_LBHU]YNIU`gaPFJR`nodQKLU\a\QJQ_sВКНМДzfVVZbfge^TPQUYYTJNZdjquojkorrnmkfVHPdlqqplllormhggd\OGKT\cdd_WJCEIILPY\[PDCJUY[]^^a_`_^]^\Y[]YOECGOUXXWWYaГЫЧА`HGKRYZVPLA@AEOZ_bYG=?HKB<9?KVZZTD5-,-8CPY\ZVG?>GSZXOF==J]lxЗПЛ|_G=ESYZXNGHSYZZZUH>@JW\UHBIRQG836>IVYYWMB>EPVYM>79:╔                                                                                                                                                                               Й0/┼мxЗМУШазп┤╢╗└──┼╟╚╩╩╦╬╬╤╧╤╥╙╙╙╙╒╫╓╓╫╓╫╙╘╘╥╘╥╥╥╘╥╥╘╓╫╘╘╓╫╫╫╓╫╫╫╫┘┌█╪╪╫╪┘╪╪╪┘┘┘┌██▄█▄▌▄█▄▐▀▄▌▌▐▐▐▀р▀▀▀▀ррр▀р▀▀р▀ссссс▀▀▀▀▀▀р▐▐▐▌█╓╒╒╙╥╨╬╠╩╚╟╟╞┼──┼┼┼├╜нЛsnxЕСЩаек▒╢╕╝╝╛╣кУНИvollq~Фк╝┬─╟╟╟╟├╕м                                    кuuvxyvrqqqrsppsrrsutqsvxvz|{tyАГxdads{ypn{{~БГ~phgkmomlkedgkswy|ВИОЖkcZQJIOSOOX]afmiUSVZ][Y_d`XX^nАЙКИ|f^YbknmhXLMSZ_]SIINTWUHBN`mcOBEOVVODBYhh]K@HV]UKIWch_NHLT\hmbOHMW\b[OMRbnzГЗИДzgVW]cihe[PNRYYWSMO[cioqomkntsnmicSGO`irsqnlknpolhgd]NGKS[cgfcXLHILMMR[a\OB@ISTVY[\^^^]^^^^[]^[OEBIRVXXXYZa}ЩЫД_EGLTXXTLGABDLW^`eYG>AGIB<;ESY^[WD50.3:GRY\ZSB?BJUZXOD<99;х                                                                                                                                                                               ~./№  сП~ЕМСХЮдкп│║╝╜┐┴┼┼╚╩╦╨╨╨╤╤╙╥╘╒╓╘╘╓╙╘╥╙╘╘╘╘╥╥╘╙╘╓╫╫╒╒╓╫╫╘╓╫╫╫╪┘┌┌┘┘╪╪╪╪┘╪┘╪┘┌████┌██┌█▐▐▌▄▐▐▐▄▐▀рр▐рсрр▐▀▐▀▀рсстрс▐▀▀▀ррс▐▌▌█┌╒╙╒╘╥╨╬╦╩╟╞╟╞╟┼┼╟┼┼├╛нКumxГСЩЯзн▒╡╗╛╛╛╝▒ШМЕ}vmjhoХк╝┴╞╟╟╟╞┐│ч                                    ╬wuuvvvsssqqqqqutsssrquwvrv|Б}ryАГ|j]`hy~ujqw{АБ|pfkoppnnghjmu~ДГЕКПЗma[OGFMRNOZ`bfhcSSX]\\]`aZTXdqЖИВv`Y[elnmcXKLRY^]OEIQWYTGDQbmdKBHOVYOBG]gfYICKW[TIKXfk_MELRZinaNHPY^b[LGRdmv{ВГВ{gX[afiib[TOTVVWOKR^flprqnmnqromjcOFP^hrwsmjlnrpkhhg\OGIQYbeecYOIJMRSW^_\OBBIRRSSUYZ\^]]^^][]_ZPHEJSWXXZXW]zХЭЗ]BGLTYXPIECFJS[_baVE=ADE@?AJV\]]UE6//5;IT[\WN>>GRY]WMD<BLX[PCAJPNC988@LW[\VJ?BIQWWH=;;=ў                                                                                                                                                                               r+0     √─ВЗОСФЯен░░╢╗┐┬├╞╟╩═╬╬╧╨╨╙╙╘╙╙╘╘╙╥╙╙╙╘╙╥╙╘╥╥╓╫╓╘╒╓╪╫╓╫╫╫╫╫┘┘┌╪╪╪╪╪╪┘┌┌╪┘┌██┌┌┌█▄█▄▐▌▌▌▐▐▌▌▌▀▀р▀рсс▐▌▀▀р▀рсср▀▀▌▌▐▐ррр▌▄█┌┌╓╒╒╙╨╧╧╠╩╞┼╞╞┼──╟┼╞─╛░НwpwДТЩЯз░┤╖╗╜╛┐╛╡аРЙБvnjioЦо╜┴┼╚╔╚─╣п                                     ьwvvvvvtuutpoqqsusrrsswxyuu|Д~pv}А~ucWeyАwlrw|~ВГ~lmopnljdhhnwАЛЙЙМРКrb[RHEMTNIW`ghhZQSY]^^^ceXQXhs}БД~mZX]dkmkaUMPU\]\MELUWVSHGUci_FCKSXVNEL`kfWGCM\]TLOXfh]NJMTXgl]LGS\^cYMNWdmquzБА|dSWbiklf[SOSVWWRNSbjoquspnorprok`NFQ^iqwwqkkkoupfeg\PHJOY`cfb[RKJRUQT^c]ODDLPOLNOSX[\]]]^^\]_ZOFCKVXYYYYY`uУбЛ[@FOX^]SFDHLQV[acbRA;BHDBAJS[]][SD82.5;JVZYTH9=LW]]WM>8:FWdpzЗОЕeJ>GRWVOGGNW]^\YTEDIIEIQY^`]ZRB82.4=ITZVNB9BQ[^_XL<7>KYcmvАЗ}aJBHTWTNHGRY\\XUPD>FRYUHCEJMMC99>FQ\][VLGGNU\WD78:?                                                                                                                                                                                X)9          ■╓Ж}ГКРЦЬвио│╢╗└├─╟╟╩╩╬╨╧╨╤╥╤╤╤╥╙╘╙╤╤╤╙╙╥╒╒╓╒╓╓╫╓╒╘╓╓╒╓╫╫┌╪┘┌┌┘╪┘┘┘╪┘██┌┌┘┌█▄█▄▄▌▌▌▐▐▌▄▌▀▐▀▌▐рр▐▌▀рр▀▀▀р▐▌▌▄▌▐▌▐▐▐██┌┘┘╓╘╘╤╧╬╦╚╚┼┼──╞┼┼┼╟╞┼└▒МwqxЖУЫгк░╢╕╗╛└┴┴╜╢гПКГxomuЙЭ┤└─╞╞╞├╖┤                                       ytttuuqstqmpsrrsrrrtsouxvuyА~wvx}ББoafr{woqy{}ББ~xnkkkjghhlu|ДЙЛОТЛye\UJDLWSN[ii`VWX[_``ehg^UW_kty{yqaRX^hnnhYPRUZ^^VHGMUXWNHLYefWEHSYYWLFQfjdSGGR\bUJOZfgVLKSXZcgYIJUbddUHKZgnppqqrs[R^kturmf]UVVWYTPXhopmpqqqpqsuqi^LHU`fmrzxponnpplhf]NHKSSW`ed]QIKTWUT\_ZOFGSXTRMLMOSWZ]]]\\_^ZMBCMVXYXXUVZhЙУВZ@F[ssiUMRUWY\_ac_PB>BILLPVZ__\YPB5/-5>LVXRK;7ET^``ZJ:7?NZbls{wl]HAKUXUOHKS[^[VQMA>FSZPEDILMJA<EPV[T@69<А                                                                                                                                                                                C)_                тУ~ГКПФЪЯзн│╗╜╛└├╟╔╔╩╠╦╬╧╤╨╨╤╨╤╨╨╤╤╤╥╘╙╘╘╘╘╘╘╘╙╙╘╓╫╪╫┘┘┘╪╫╪╪┘╪╪┘█┌┘╪┌┌▄┌█▄██▄▐▐▌▄▌▄▌▄█▐▐▀▌▌▐▀▀▌▀▀▀▐▄▐▐▌▄▌▄▌▄┘┘╪╫╘╙╙╥╧╠╩╚╚╞├├├─┼╞╚╟╟┼┼└░ЛztzЗТЫео│╡╖╗╛└┴┬┴┐╖нвЦНЛРЧЯп╛├╞┼┼├╣║                                        лuuvvvxssqoqssnptswvwqptwxvy~zuux{wqooxАvknx|{z~Гxsnkjifils|БИМПУО{g_WOLOWVYdg_SSX\_``bgg^RNP^hnrsnhb^bdili`TPWZ^`ZOEGRWWSHGLZfdUBNY^]RHETih_PFL[a_NCM_heWKKS]__`UJMZjheTKQ\hppnjhhdUTfzГДВ|uoib[\YUU_iopmnqstpnpppk]JJaegjpvyqkijlnqkdYNINTXY]``]SJJRTPNTYVKEKV[]]WROLJILPVY[\]\VJ@DRVZZZYWVV`uАpPBGQY^\UUXZ\^_aab^O@3-0:AMUSI@9AOZ^^[TG;9GU_`ekrqgVDCOW[\WPQU[\YTQI<;FUXJBEMRSL@<@GPY_^^UC8:=г                                                                                                                                                                                ?'w                  √─В~ДЛТШбзо░│╖╝┐┬─╟╟╚╦╠═╬╬╧╧╧╧╧╬╨╤╥╥╥╙╘╘╘╤╤╙╙╙╘╒╫╓╫┌┌┌┘╪┘┌┌┘╪╪┌┘╪┌┌┌┌┌▄███▄▄▄▄▄▌▌▌▄█▄▄▄▄▄▄▐▌▄▌▐▐▌▄▄▐▌▌▌▌██╪╪╫╫╥╤╤╧╬╦╔╚╞╞├┴├┼┼┼╟╞┼─┬┐мКtr{КХЬзн│╢╖║╜╛┴┬┴└╝╡░ибЫЪбл╢└├╞┼├┐▒ў                                        ╤uxyxxxttsoorsrrstuvtmpxzvqwВ}utx}uorwБvnouyvvwzАВ}sojhfhir{БЕЙКНОБh\WQOP[dje`XUX[]__`beaXOLP]gionkeeoohgkk^SX\^_]WNGLT[[RBBO\ecOAP]^\QEFYii\OHN_d_MDPbhbWHKW][ZZRLMZkkdSIP]hqqoifedSRf{ЖНРНАwqmfa\QT_iosmmprrqnmpqk^KOepooqtwqokklkoleXNIOUYYZ\[ZRJJTZTMSVRHBMY^`a^[YRPLKNOSUVWZRHBBOUXZZVUTT]irhNCDNVXYWXZZ[\^`aa\M?;DPV\]\\]]\VJ=2.1?GT[]^\TF=╔                                                                                                                                                                                =%Н                     ыв{ВЗМУЩаем▒╢╕╗╛┴├╟╚╩╔╔╠═╧╬╧╧╧╤╤╤╨╥╙╘╙╤╨╥╙╙╘╘╒╫╓┘┘┘╪╪┘╪┘┘┘╪┘┘╪┌┌┌┌┌▄█▄▄█▄▄▄┌▄▄▄▄█▄▌▄▄▄▄▄▌█▄▄██┌▄▄▄▄▄▄┌┘╒╘╥╤╧╬═╦╦╩╟╟╞╟┼┼─┼┼─╞╞╞─├┐иЙvs~ОШЮзп│╡╕╝╜└┬├─├┴╜║╖▓оп│╡╗┴┬┼─└╗╞                                         эuwxxxxssssrttlpvvsswrsuzytuВ}xwsx~qmv}А}tntzzzttzВБvqkgffkox~ГИМТСВi_\VQTblkaWWVY[^`aaei^RMMS^gklljkotsokkh[QXbddcVKINU\ZLDGR^ebLBSde_RHM^liZKHTdf_MIS`heUILX\][YPIL[lneSJR_lpsolhgcQQaoxЙСФКxqjf_VT]invnlnqsrqopqiZKRjqqpnqvtolnnmlkdWNLQYZ[YVWWPIKR\b\WWQGDM\`ca^][WSOLILNOQTUNFACMTVXWUSPNUci_LDENV[\XXY[[]]_b`YL??HOW^`^^`\XSH=5.3=FNPH<;BMY__`]TD9K[``afhg`VJLWepyjZW^a^ULKE?AITUKFKSXSE:;CKT\]\WNCAJSWWI838<∙                                                                                                                                                                               √:#═                          ї▓}АЕЛТЩвжлн▓╣╗╛└└─╞╟╚╩╩╩═══╬╤╥╥╤╤╤╤╤╥╙╘╒╓╓╫╪╫╫╓┘┘╪╪┘╪╫╫╫┘┘┌┌┌█┘┘┌┌██▄┌┌┌┌┘┘╪┘┌┌┌┌┌╪╫┘┌┌╫┘┘┘┘╪╪╫╓╘╨╦╟─┴└┐┐┐╜╜╜┐─├┼┼┼┼├┼─╟╟─╗ЯЕz{ЕУЭзо┤╢╣╝╛╛┴┴─╞┼┼┬┬┐╜╜╝╛┐┴└└┬╛┤╟                                           wxyywxqssssrssstvrqvtsuyyuvx|АА|nmtzvrrx~}wqrtxrnlmwБtojiklv}ГИПХУИmdedddcb[RRY_`_``bfgbRLLQU[cikhjs|ААyqjaTR`effcRHNSX]YF@JU`d\DB[hj`TJOangWMKZjl]JFUekaOLT\ca_ZNHO_lndSNUcpssrolh_LIT`kvВКККЖ{p^QQ^iopqppqrtpnooiVIVjuwsporsvrnkkjkcVLNW]a_\YVPLHHMNRVZVODDO[`aca```^[ZXTPOLOOJB?BHGLLJMNONSZ^UFDHPVZ[XZZZZZ]]a_WF>AFRZ]]_^[SQJB90/4>CHF>9@OY_a`\WOA:>L[_^]bfe`TEK\hnk`ZZ\_]QJIDGOW^b^WMBAJTYWF64:=                                                                                                                                                                                є;!т                             тТ|БИНТЩазо▒│║╗╜└├┼┼╟╔╩╦╦╠╬╨╨╧╤╤╤╤╥╙╙╒╓╓╪┘╫╓╫╪┘╫╪╪╪╪╫╫╫╫┘┘┘┘╫╪┘███┘╪╪┘┘╪╪╫╪╫╫┘┌┌╪╓╫╪╫╒╫╓╓╫╘╒╓╘╥═╟└╗╕╣╕╡╡┤╡╢║┴┴─┼─┬──├├├┴╕ШБu|ЗХЯл▒╢║╗╛└┴├┬┼╞─┼┴┴└┐╛╜╛└┬┬┬├║м№                                           Нvvvtwsssssqrqpstrostutuzyvu|АБxicjwywvx|}|zvsrtpnjjr}Вywsmknu{ГЙТЩЧНphijhed^SMP\ad`_bejj`OLJLSVbimjtГДДГ|uk`UWaggg`MJPU[\XFCLV_b\HI`khaQDPbldUJM]jl[FFWhh_OFRadcbYNIP`mocQHQaosssplj]ONT]gpwДИЛЛЕu`RU`lnqqpoqttqnnmfTIWjuxwrprsvrmljkicTMPYbea_]VNFDEKMMOUVMCCP\_bdcdcdc^\[YWSRONIB>@JKNNMMMOQQVYRCDGNWZZXZ[YZZ\^c^UCJY[TC66;K                                                                                                                                                                                Є7!Є                               √╚Г~ДИОУЫбелп│╣╛┐└─┼╟╔╚╦╬╬═╬╧╧╤╤╤╙╘╒╓╓╫╫╓╒╓╪╫╫╫┘╪╪╓╓╫╫╫╪╪╫╫╪╪┘┌┘╫╓╫╪╪╓╫╫╓╓╓┘┘┘╓╫╓╙╙╙╤╤╤╥╤╤╤╤═╞├╝╕▓░░▒▓п░│╢╝└┬┴┴┬├┬└┴┐╗░САyЙЧго┤╖║╝┐┬┬┬├┼╟─┼┴├┴┴┐┐┐└├─├└╡╨                                            ╢yywtuqtqtpmqrporrqsutstyzvtzБГwda_oz}urz{~~zvssqnjjqwyyywsnkrw}ЕСЩХПrmkhe^YYSLN[abb`aggcZSTSSVZckkkwГЕЖЗБwk_W\fhhf]LHPX[]UGGNW`_VEM_jh_NGScibQIO^noYDEXdg\MJUcgdbYMIQbnm`QKO]msrrqpl[IIUchhntzАЕКИwaTWdmqstrqqrurnmkcQGUftzwqpprvumillf`QIQ\cgc^\VOIEEKMQSWVQCCN[_bceecba^^^^\Z\YUI>><:;LY^_`]VNG<7?N__[WWZ[XMERagf_XX^`^XNLJD=?KTLAHS[YOE@DLSY_^[UH;=KTXSA76;q                                                                                                                                                                                ч5√                                  эдyЖЛУЧЬвем│╡╣╝└┬─┼╟╩╩╦═╬╧╨╧╨╤╘╒╓╫╪╪╫╒╓╓╒╓╓╫╓╫╘╘╓╓╓╫╫╫╓╒╓╫┘╪╫╫╫╫╒╙╙╙╘╘╘╫╪╫╘╘╙╥╤╨╧╬╨╧╧╤╨═╞┐╛╕│миизооп│╡║╝╛┐└└┐└╛╝╣╢зЛ{xБОЫи│╢╗╛┐┴├┼┼┼╞┼─┬┬├─├┴┴└┴──┬║к■                                            ╓uwwuwuttwsrrrqprsqtwsnr{АwrzАВwe[[ewАwjpx|БulsrmhilprsqsuqnsrwДКЙБtnje^RQ[[SNX^^`_bgf\WQSTUWYdkgeoАИЛЙДwh\V_ihhe\ILQX\ZRHGQX]]SEM`hf[JAQah]NGQ`klWDFWgdXKFUfibcZOLRbmm^LFLXiqrrqomXLOXcjecfmu}ВИv`XZgnswwtrqrrrpmkcMFUdmwyspopvwpjjkh]OGR`dghe`]UOJIJLOSXYMBDMW]`ccdeee``_`^\][UJA@FSUVXYYUXXWWTI>AHNTXYWZXYXWXZ][Q@;AIT]]ZWRJGGH>4/.49>=:BIOHDJTZVND?GOT\`_\UGН                                                                                                                                                                                ╥1                                       ╪Й{ГЙОФЦЮдин│╕╗╝╛└┼┼╔╔╦╬╧╧╧╨╤╙╒╓╫╓╓╙╓╓╒╓╫╫╓╫╘╒╙╓╫╫╓╫╫╒╫╫╫╫╒╘╙╥╙╤╘╙╙╙╙╘╒╓╘╥╤╧╬╔╦╔╩╩╩═╔╞╜╝║║╕▓лкллйн▓▓┤╡╕╕║╗╣║╣╕│кШЖxzЕУЭл╡╣╜╛┴┬┼╞╟┼╟╞┼┴├├┬┬└┐└┴├┬└│┌                                             ёxwuuuvsqsssstpnqusqxxonyВ{nv~vk]P_rzyqot{АВ}snnmffhjlnoooonqoqtx{zuojfbYLNZYJJW]^`cilfSSWZYWWYbid`j{ИЙКГscYWehiheZGLVY]ZQELV[`]LBOckdTIEL^dYJIScnjSCIVcbUJKYgkheZLITcmm]LILVhopqrplXIOZbhc]^diqyula[^lvy{{xvtssqomj_KETanvywrnquuqljjh^OMV_dgfdc^WNIJMLMSZYNDELUZ^_`a`bcaaaba``\VI?AISX[[ZYXYXXVPE;?KRV[\[[\[WPPT\[N>;CLVZ\]VLAAFF=2-/5<<89AMX`aa^WOGC:9BU^\UNJIQQHI_nlb\X]`b]THHHA>BLPHCLW[WM?:ITX_a`ZRD=AOTVM<6;>╕                                                                                                                                                                                ├0 "                                        ∙╗~ГИНХЫвзо▒┤╡╗┐┐├┼╟╩╠═╬╤╤╥╙╓╓╒╥╙╘╓╓╓╫╫╒╒╘╘╙╘╒╫╓╓╒╒╘╓╓╓╙╙╤╤╤╤╥╙╙╤╤╤╙╤╧╬╠╦╚╞──┼╞╞┼╞─╜║╣╕╡▒▒лизжилнонпп▓▒плклжЬПЕ~АЛЦЯн╕╝┐┴┬├╟╚╔╟╟╞╞┴┴┬┬┴┴┴└└└┐╝н                                              ¤tuvuwvtruusswtpquussspqt{zsw}В~r_PZlxzxuu{БВА{sjigghikpqokjiiklnpsrnfda\WNMTVKJU^bchki]OUXZYYZ[ab_`h{СЫМnaXZhkjkdUFNW\_[PDLV^_XLEVggaPDBM]bVIIVfldOAHW_^QGJ[hkgfXLJUckk[LGJWepqprqlVNR\dh`XY[^dkrh\Wbt}ИЙЕ}xwutrpmj_JGVbmuzwsonswsiiji]QPX^afggc_XLFJPOLT^[LAFRUW[^__`_aaaaa`a`^UJEELUZ]^]\[Z[YWND█                                                                                                                                                                                ┤1 ;                                           ьЬxЖМУШазко▓╢╣╝└├╞┼╩╦═╧╤╤╙╙╒╙╥╙╥╥╙╒╓╙╙╙╘╥╙╙╙╙╙╘╙╙╥╙╙╤╤╤╨╤╨╤╨╥╥╧╧╬╠╔╩╚┼├└╛╜┐┐┴┐┐╜╕╡││░ммззжгЮЯЯЮЭЫЩЪЧШФТРПОЗЕГЙУЫг▒╕╛└┬╞╟╚╔╔╚┼┼┼┬├─┼┬┬├┬├└╜┤т                                               wuuvyztqtvtqrrqswvstusqqyztuzАА}dRYhxААut{ВВykggffgknmljhghjloquythd`^VMIOPMNV]`bgjcWOV[\ZZZ`ebY[i|МПМ}j^[_kljh`VKRW\^ZLDLW\]VJGYil`ODFQ[`RILXgmcJ?GS]^PHO`kokhXIKXfnk[LIJSakprsqlUGN[ee]VVWZ_cdc\W`tВФШХСЗzvuqpk_HFVdmrw{unppstlhig]OOX[`dghe`ZLEHPPPY\XMEIRSRUX]_`bdddcaaa`\TH>CQ[\__^_^]][WMC=FSVZ\\]^ZUNILQ[YI<=ENX\[ULA>CJH=4/,4976=JU[___[RJDC?>IW\WMEBEKICLoЙН}c^_``ZRKMH=;AKMCDOXYUJ>?JU\^`]RI?9BRQOD97ALV[``ZTG=9CRSOC:7DQX]_a``^`^\ZSH?L[b`^]Z[VNFHJX_WH;;CMV[RE=:ALPI;1+.4768GW^dba^UJBFGAAIW[RHDEJKF>JlКУЗulfc^TNKMD:9AHFDKX^^TF=BRY^a_ZQE<>HSRMA66ENSTJFReprqhVKM\kniYHEJUZdossqeMINTZ^VRSRRXbd^QMS`hr|ВИОФЦУРКДw_HK`inpt{}rppqpplebTIHR]_]`fgd_MJPSRKT]VHCNY]YROMPV\^`bbcaa`]SHCDSZ^`ab_[_`]ZSF@O_bb_^\_ZLHMR\]VE9L\cdca\QDBNRFBLYYNFEISQFAKgДПИ|pgc]VJJKA89AGBCOY`\QD@ESZ]_\TKC<@ITUL@87GT[^_\SKB;>IPPL=68>Й                                                                                                                                                                                 U% ╧                                                        Ї│~ЕЛТЧаип╡║╛├┼╟╚╚╟┴╗╣╖╡▓▒░лмжжддвЫФРОНЙЗДБ{П▓╫щ│rnnnjmlnqwy~АВЗИЙКМОПСССУУХЧЩЬЮавежззииийкллкйзкн▒╢╗┐┴┬┼╞╚╩╦╦╠╠╠╠╠╧═╠╚╟┼┴╗╗                                                  ■xrwuxvtuuxrswxwrsstvvtpsА|vstz|wliptu~rnv{~ЗНЖvkjhjnnkhijpyАДИЛЙwh^^YVJILUXZce_TRX]`babbehdOMYelu|{rd[Y]`gkg^SLOTZ^\QKMSWZXNJVhqePFEMW[SDCRblkWBCJRVQGEWiqtsjUIN]kngTGGPVY`horp^HFKQWWVUURW`ig[NIRdmonpos{ВИЛРМ}`DMmz~}}zusrpoonl`QHIW^b``cfg_NLPRQMRWODCO]edc[VOMLNRX\_^`a]PEDIY^`abb`acc_YOAE\ikmpu{i[ST[^`]N@69ELNJ@;CMVYTE81+-3:DR]cbcc_UG  ш                                                           чЬxЙРЧаен│╗╛└┐╛╣╡нлиеЮХТПНЛМИЕА{zvsАШ├ц№       ╪iilpty|АЕЗЛРЧЫагджйкккййилклйм░│┤┤┤╢┤╢╢╢╡┤│░▓┤╢╝┐┬┼╟╟╟╔╔╩╦╦╦╦╬╬╬╧═╦╚╟└╖Є                                                   |twtuuvuttrsvvspwwtuxwqo|Б{vmtА}jemssw~{ssxБГКМГnkeilmlihipyАЖЙТНzha^[XGFQZ]_a\XSV\acccdbdf^NO_hnswwnb_^a`img[PNRX]^YNGMSWYUNLZjqdNEGQX[PCFUfqlT@BNSTPEHXjstrgRHO]imdRIMRX\`flsp]FFLSVSQSSQWbheZLLVdlrqqnoswz~ААu[EUtКУСЗЕ|xutqrrk`QHPY`aa]_ff^ONQUVRMQMDER`efd`[UNKHLPU[]``[NCDOZ^`aaa^`b`]XM@Gbtxroste\WW]__\L>6;EIFB=?FS^\TD71+/7BNZaiecaZNDHS]__[RF=;DMOMF>9=?▄                                                                                                                                                                                 5  °                                                              рХГКПФЪбл░┤│мЧПЛИИЖБ~xuqonmrМ╣▌ў               Ўоrs{~БЗЛРХд┤╣╝╜╜╗╗╣║╝╝╝╗╗╝╝╝╜└└┴└╜╛╛╛╛╛╜╝╕╡╢╖╣╛┴╞╚╔╔╚╔╩╦╠═╠══╧╧╧╬╠╔─╝┐                                                    Фrxwwxwwsvssuvrmsxustwusv~Аxppx~pdirwuy|zsqz}БВЗЛАskhjookigpwАЕЙОП|i__ZXLHR^ccb[VTW]babbabfeWOS_inrwrhaehgdikeYQOTX^^XNKQTYZRJM]ll]LHJRYZNCFWiskQ?CPWVNFIXiqtrdRIN\hmdPFKU[[`dksr\JILQQOMPRTZdkfUJKYenqqomqtuqqsqiUFY{УЫввШПЙД~zwurocQISaedfb`ae^PNOU[[VRKBGWbehgfc^XRNLLORW[_YJCGP[^_bcca`a_]WK?Ievxmb_a_][]_`a\M?;>FID@=BNV]^UD5/*/;HVgppme`TG>9DQI@CMQK??NYXOC@LarБУУГ}{|t_SH@<=FGEOW`b\NA?IU]a`ZOG<9ENNKE>GRXVLEIWkstscMELYfi_SKMX[]]amppZHGMTROORSU[cf`VMM[gorrqrsuytqnkbPEYvКШаггаЬШХПКЖАygTLVdkihgc__[OORX\]\SMHM]fhjjgedaZTOLLLLRXUI?FT\]`aaa`_^]ZUJ>Kfuuf\]__`__ba`ZK:7>DFCCDLX\c]SC5.*/BP_nwyrf\MD>=DC>>AJMG>FT[VMEAPbq~ПХИАyxpYOH<:=@CIS[bb\LA?JV]`_UMG>9AOMKD;7?D■                                                                                                                                                                                ·3 )                                                                    ∙╠ЛДИД~tkfwН╕рЎ                                ў╣}ЖУд╢┐┴┬───┬├┴├┴┴├┼╟╞┼─╞┼├┼┼┼┬├─├┬┴┴┴┬├─├╟╔╚╚╩╔╦╠═╬═╧╤╥╤╬╬╩─╝╔                                                     ▐uwzxxxurssqrssptwupt{}vpwВxjimsvtonstzААvju{}|}БЖНГvplllkhnxБДЗННi`a][RP[caYRRX\_c`abbdfb_QOVahnopkmqvwrlheZTSSVZ`\SMMTVZXNJSgplWKLT\^ZJBJ^hneL@KW[VLCJZjstr`NFLWdh^PGNZ]_^aimnVHKNPNMPSSV\dhaUJN]glqrqoqvwqokh^MGUhvВЙПЧЪЫЪЬЭЫЦУМtXQXkwwwvtqnia]Z[\\[UKISdljljhffe`[WSPNKPTMECISZ]___]\^[YWSIARovqg^[^_``acaaZK:6?EGADLT\_a^SA7/.5J[ht|wdVH><=CB>@Rbp}МТЛДzpbSMH=:?DGLU]``ZJ?ANX_a`VJB<;@O                                                                                                                                                                                 я/ K                                                                       Ї╩╓шў¤                                         сЦОЫз│╢╕╣╣╕╕╢╢╡│││╢╢╢╢╢╢╢╕╕╕╣╗╗╝╝╜╗╗╝╝╗╜╜┐┴└┬┬──┼╟╟╚╠╧═╔┼─└╗н°                                                     Ўvwwxxxuutsqqswtrx|vsyВ{lq|Бvic_nzymkruzГ|nnw}}}~|ГИ|okkjlknuАЗЛПМАk`a\[Z_dcXNPUX]bd``bbedaXORZbhmmlhox}~wokeXOPTX_`YPMMTWXUPMVjqiTHNYhdYKEO`hmbLBM][SLEL_muuq^KGKUag^QMQY^_[]fnkSFGOSMKMQQR\df^ULN]hkossrrw{upni`JHOXajqxАЗКТЦЩХдаЩБ[Q[tЕЙИЕБ}xvvsqpmhaUQ[hnoonlhhfc`^ZVSOOSND@GNSVXYWUVWVVTQIE[}Е|nf_bbcaabbaZH86=DGDISZ^`b]SD:62BC=@Q\_VLA=O`mzКХСЕxhYPLH=:=AEMY^a`WI?CQZ`a]UJB<=DLKJB99@s                                                                                                                                                                                 ▀) k                                                                                                                        °щ╓╪┘█▌╥┐╗╗╗╛ЯТФФШЩЪЩШЦЦЧШШЩЪЫЬЯбезлммо░▓┤╢╣║╗╜╛└─╩╔├║┤░к╩у                                                       usuxy}{ywwvssxxuvxuty}xnou~xnbYbs~qgorv{~ynov{|{ww|А{sniijns|ЗНФТВkccabdd`ZTOOU\``_^abcge\QOV[`glnmp~ВАzrnfUORVZ__WNKOXY\UMNZloePGP_ff[FCRfmn]KHSa`TJEM`nsso]KFKU_d[LGR^da][bjiMHHMOLKPPMPZgk^QLO_gmqusqqpvvqnj_IER^djmmlns{ВЗОЦбЩ{XO`Ян▓пидЫХРНМЙЖАyo[Q^msvwyvsprmifb_]ZXTLD@DMNNQQPNQRUUTRIEdИИВufbccdcdfgcYE86>HIKSY^`ba^RB=:;E[nsyД|aQC@DKG557>BA=DU_`WH;>L]huГПТЗtcWNJB;:>BGO[bc_UFAHT]_`[OJA;=EJKH?;I[c`WH?=IYesЙРИveXSQC:9=BGS[ab_SFBJY^_^VHD?:>HJJG@;?G╬                                                                                                                                                                                 л# ▒                                                                                                                                                                        ¤¤¤                                                               Эrtvxzzyvtsrtyzrruwurx{ukjszvaXZdqwtlls{~}|toqtz{xtnlopopnikmuДНЦТГvomig`YVSUWRRZ_`_`adhhaSMPRX^ekhixЙККЙЕzk_ROTX^c^RLOUY\[QKR`nn`JDScjhWDDWgnkWIIYjfUIERfpsskWHGMVZ\THGUgjfa^bhbIGJKLKOPQSZ`kk\MJUdgmoutsqoruqmg[FFWbhpsqoliiijglto]OP_БЬ║╘щєїў∙√¤■√Їц╬гx[e|ЖУЦЦУРНЛИДВ|ywsn[HH[cgjlmlkkihcZPDKuЛЗД{rprututtpeUB8:IY]_`acffb]^dbcklmsx}ДК~aJAERTH9558;:?Q_a^UG<@IUbpzЕФНygZROD;9>DMV^ab_SECKY^_ZSJD?:@HJHD=<@I¤                                                                                                                                                                                 m  Ї                                                                                                                                                                                                                                          ъrsuux{}vuuuuvzrruyupy~|pls{~l_Y_qАЕjcoy||~|rnvyxtnkihhmpokikoprqqlha_ZYRJJX[RPU_b``adfbXNPUUV\cd`_lАОУКДwbVRTX\dcZMIOW]_YMIUfokZJHZjmeR>BUgnfUHMamgQCEVgqtrhNEINVXYQDEVenldabb\FCFJOQTTW^ehheVLJVinoorttspqrrneUBF[dkrv{xnmnmprke^OEEQ_dgmyЗЩ╜▀ю∙¤■■№°┼z^А╣Ё∙∙∙°їЄь▐╬─╣пзвЫРmPMb~ИКМОПОММНИx]DHjКММЗЙЛНПППК|fVA4;Pbjqrqokidbgih^[Y_jwАЖМePLU\YI=9788;M]cfcWD:=DR`lt~ЗНКzg_SE=;?HNZbbaZM@CQY``ZPFA<:BIIEA:;@R                                                                                                                                                                                  O                                                                                                                                                                                                                                            √qssuyzyrtuusr}vrtzzptБrjr|~qd\`qАГsklv~Аuimuwrojfggkpmhddgilihd`^_[WOGLW_NMT`dbbegf]TPWXVW[ae`[g|КСЛВp]SSTXYccXMLRV^aVLLUdniVEI\opfR>BUcibPALamdQDEUhsurcM@GSVUTOILZipmgedbXE?ELSRUUYdkljdTLKYipporrutrqstmeSCH]elqwwxqqpoqrnh^LBFO\[bhntxВНЯ┬▄эЇя╙Чk^Б║рў·∙°ЎЇєёях█╒═─░ЭpLMfЖМЦЩЦУФТШЦХЕ`CGj~ЗНРКПППСУФУЗiQ>5;Kdlwzy{xumhigb[XT_nzГЛРБjWUZ]YI;7789@T^eeaUE;=IUclsyДПОГncTD;;?FR]bc`YLACP\_^VKDA=?EIJHB<;B{                                                                                                                                                                                  -  +                                                                                                                                                                                                                                            tssuz{~vuuurosussvvrv}~tlox~xkadr~}yros{}~}yplpvsokighnpmhgijlmige_\]\ZRJLU`OMT^acche_ZVU[[XX^e`W[gzКПЙk\USTV]feVLNUU]^TKJU_heRCK_kmaNADO^h]MHPepeQFFRfpsp_IDHSWYWODG\lrpiedcUDBDJRTTU[eopnePDIZjuqoqrsqoqprpeO?Jblqtwyzrpoqrsnb\LCGT`c`enttvy}ВЙХЭШФ~]YxШ┼╫▄█╫╘╥╧╦╞└║╢▒ойРeJPiМПОКЙЖЗКНЗx^@HgtАЕБ~~ВЕКОЛЕfM>8=Kgqx{}~}|v{БАrfhmuДНФУУВn^Y]^ZJ>878:F[eef^RF>BOZdlqt|МТИsgTC=>BJU_a`^XJ?GS[_]RIEA=Q`efd_PE>FR^dimsxДСНxiQBACILWaca^UE>GT\_[QDA?;;?CDC=88A▐                                                                                                                                                                                 ь' ~                                                                                                                                                                                                                                            ▒roruxyssuzvprxtoqwwuu~~ytsw~}hdsАБГАokt{~~|{{uqnoolhggjlllmsyАВ}pb][]\TKLSZUNU\_bgjfSMU_cb^aeaRL]k{ВГБv`WXXWW`e^SMOX]`]QFJPYe`OETfkiZHBHLU`VHFUlsbK?CPalso[FBQ^__\PEL^msrkhedRBBDJOQSX_fnonaOEHYhrrpqqrusnnrobL?Pgqrqrtxxurppoql[JCIWbecbgmtrhbaekkheWHN]ltyyywvtspnllkkmoePDGMUXUTTTTW[]\XI:?SX]`\UVSVVZ\\\WG:8@J\q}СЫЦТШЩЫгзбРХЪгиеЫОЗymecebWA:68>GXaefe^NC=JYbfgjqvГПН{mOCCHOSX`cb[SE=GT\_YODC>9:>BA@958A°                                                                                                                                                                                 ─! и                                                                                                                                                                                                                                            ╓voostwuttvvpsxyuvyxwsz~xux~|liuБДВumoyВА~|xqplmkgdcjlkkotzГДИБuc]_^ZVONOXXSTY`cgfbWSZbdbbde]NQbozАА|oYVXY[]deYNLSW]d]OFLPWa\PKVhlfUFCHLSYQEGYko^H?DM`lomZFETaa_XOKL^nsrmigeR@?INMLNT]elnn[MFJYirrqooqrupoombI@Tgossstwwusrppom\G>IYcda]_jng]USY^[WWNGK[krtrpmjfdaabbbaabXI?AJOTRSQPOSRUUOB3?<9;?AAB<8:D                                                                                                                                                                                  Н ╨                                                                                                                                                                                                                                            Ёwrpszyxxwxtptwtotz{wnyАГ~wx}}slqГА|wsru}А~~zrkkjheeilmknt|АВЕДwd]`\\VQPRZXUV\bde_[SW_eecefd[NXgpx}{wjVY]^\[`aUMLTZ^b[PJJOQ]YJI]jjaPDDJMSSMCJ_nn\HADO^hnkUFHUbddZMGO^nusplhhPCEJLIKNU[djmk]HCKZjpqrpnqtspnmj]FAUgqtusqswuomlmol[E>M[eeb^\chdYOLPWYVSG>FZhnoojga\WXX\^]a`_VH@DMV[YZ\ZZ]^]XN>48;?@BA768@WЯзРspuyxk]WVOB65?IOPOXftЖб╘фс┴ПАЕв╗╨╣Дihdghgd^O;27@N_hiifbVIABQ^dhhfhnzВЗГpH@FKS\bfb^YO>9MY]]SEC@=:<@>@>;;@Т                                                                                                                                                                                  /                                                                                                                                                                                                                                               xnltyzzxtuwuposuuwzuns|Вyngirz~tswxВolz~||~Аtljjfdhnnnms{БВЖИzf_]\[YVPKPZYTZcg_QU[_dfffkf\QR^kosuqiaabcb``a]TLRW\`^UMJOSVWNHRcmj`KDFLRVRHBNcrlUEELUZbmdMEM[mkhYJFOdqtspke`KCEJMSZ`_cfjljYGDP_krtusqpqromkeWB@WfrvxsoprvtqnnibRABRcggccb_]^VLHN]]WPE@FYelkiifc`ZPMHINTY\TEAER]`_`a`acbaZOA>BYЗн│ЪГtqsofa_[NA89ANUWVTW_qЙЩЭШЗulnu}Аobbbfjje^L978BVehjhf_TD;AS^dgf`cjuЙЙjF@CJR]eed^XK>=PZ^[ODCB=;=?=@=79A╔                                                                                                                                                                                 ·! /                                                                                                                                                                                                                                              Хnouyxwusvyxoquuvwzrrw{xrc_l{}sqwxy~Вvms|~}А}pdbccdjmklt}БВЖЖ|h]^[\\VMHPYWWZa_ZW[]`ehighdYNP`hmnokddmrlc`dc[UORW]aaSLMRVZVLHTfpl]MFKSVXQHEPhrjPCDLU[`hbLBM^lmiXIGNessplgaZIACKP[hgggikmjWKGPakrrtqqnprokgbS?D[hqwwpooqvwrnpjbP@@Rbghfb_][ZQIHKSZTLDBHZejiiggeb]VQLIHLQUOA=FT\`abaaaba_ZN@=FZЗп║аЛtabcb_^YM>58DR[_[SRT\jqrsm_Z_chjg_Z^bgkhf]I63:J]fhkjf\OC=EVbefbY\cpz{zcD?EKV_bca\TH<@Q[\VKBB?78<=<@=:E]jrwxsolnvytiliaNBDRaimjfa\XWOEDFLKKJ@>JWdghhgfee`^YTQMMONHBAFQ\`b`_^]_`_XK;7DYЖ╡╛жНk[\_abc[M?66ET]^XOIISehe`YQRZ^]YUQV]dhhhe\F78?PchlkhbWM=9HWbffaVP^krxqZCBGNX^ceaYSD:CS\]RF?DB:8;==@<7:BMWY\\[Z[_^[UI86CYГл╗оОm_^adccYN>8LVZ`deegigfedb^YYVRI>96=GKGABIV`gkkjdYC5=LZfjlkc[RH;;M]eeaUHETdijaK>BKT^gfc]VL?6FVZXNBCGB;:<>><:<@Е                                                                                                                                                                                  ( ў                                                                                                                                                                                                                                               tqmruwwwssyuqqvxoo{~uls~Вl`X]n}|nqrqqwГxqrzААБ||yxvof^`ehlrx~ДМПЕg`__]\\XX[\_\VQTX^acdhkngWMLMRW_lrqoБИЖДvnhZPSVZ]`ZTRTY]][QMSbln`NFP]ef[KFM]ooZFFMV[]ZYL?BVflnaNDDObje_]_`S?BP`mqrrnjljhbPHL[joprwvrqqrurj]J?J_hmry{voqqstqkf]L?GT\djllf^\VMEDHHDGA<@LV]]_befgebddda_b^SF;:BMMOPPNKNMOPMC85AR^gjkgaWNE==L^ed^PDERckh_J>DNVaegeZSK<6FV[XMFJJ>8;;<=98DNPRRRSRTRRPKB9=M^vЪ╜┐Щrhdbcc_UF:8>JPMIBEQY\YN@655:?=;>IVghjkhc\R84CVaijje\TLE6;L]dbXL@ETbgf^F@FR[ehgb[UJ<9LY[ULBDE>::::=:9;Cъ                                                                                                                                                                                 Ы  `                                                                                                                                                                                                                                                Яqlsxxyzuswzxqquuwz~yttuzylWWmАБvkkmppt|Аtot|{{zxqmjgebdkqyБОФСДhc`cabhiea[SONO\_dddgiif\SQUSUW^fhciДЛЙИД}o`SPSV\bdWPPV]ch[PPZgqoZMMVcllWIKSdroTDHWefa]ZJ=E[ntp`OEBNY\]Z\Z[L>BP_ktwupnmll]MGM\inpsturqrrutm_I=Sknoqv{ystsqrupaTDFS^gquvtpommYIGN_knpoorxvsqrrk[HC\mroprw~wqpqqssiVA6;L_inkg[NIEA>DXb`VLDEUaed^TEN`nqrnhaWNDMbnpn_I>CQZ\UNOSUD=GS^gnswtqqomWFFO]jpnomnsuspnohWEG\ousqsuyztqpoptjT@>P]bcccegji_PFIV[NC?>KY_\UMJLR[`efhigffaRCALW^bfecaac_[UE:;L]clИ│┼жВocbfcZJB9:FNMOU[affaQC5//3:=?JZbfgggbYLE=3=ObjmibVHDA>:GU_\QEAI[fid\OCRlxxvqh_ZPD9>UZSLEBFB;<<<<=69@║                                                                                                                                                                                 М S                                                                                                                                                                                                                                                  uspqwzzxuqwyqnu~vjtГyuuwtpqyАГАshdeiqy~qitz||{wtqmhghlnqqtwtqpmjec`]YULMPRQNU_ccffbXPYada_^a_YW[hwИРНБq[PRVWZ`d\KNV\cgbNIP_lmeKGUelpfHCHTdnbCDRcnqmdYE>Ldmpn\J@DTYVLGR_`D=FU^fkrusqolmTHKS`jpoqorvutqpneTBG]outssuxyurpnnndP?@R]cdb`cggi`REJW^PE@AL\c_[RLJLR[aegjiff`N>8=HQQX]beff_P?3//38BKV^dfedb\QEB;8?Scklh_OA=?==HY_ZNE@N_ijfZLCStГysifcXD7BWZRGBFH>9:=??>2:Aц                                                                                                                                                                                 J  Ц                                                                                                                                                                                                                                                  Лvqswzzytqquurswrns}Аzstvursy~~{qcbelu{}zols|}}zxunidehkllnpljhe```_^_ZLKNRNKU`bded]RS]dgea`edUR\ivГИИ}iXRSVW\adZINV_cd]JIO\gm`GHXenncD?FS]eZ@EVfpsldVC?PfmpjYC:HTTPMS^e^C>HV]ajqusqpnkQCFTcjnoonoswtnnkaPBH^muusrsuywsqpni`LABW^efea_bhg_ODGYZPG?>L]cdc[TOMJP\beihfe]L<>L\bffgbbeed`VE9=P^ciД▓╩╣РxifgaUF=:ALVY^dfghf`O<1/.373AScjidXJ@?=8:JZ]XJAEUdjidXHBXzКЖ|ur{nYH=IVUNIGJH::<=?>>8?E¤                                                                                                                                                                                √,  э                                                                                                                                                                                                                                                  ╣xlouyzwuprvussvtrvz~{ymis|ypv|АБvfdgksw{|{qnx|}ywunjcdhjmt|}zof`[^__^]XPLLPSNS`egf`SOW^figffh`RP^jtБДГwcRQWZ[_dcTGNV\ceYGHLVdg[FM]jpmZABGQ^eU=FXiqtrfUA?ShqofSDAGMLQT^fi^C=K[eeiqusrpljOGKVdinooooquvqnk`N>L_lwxtrqqwyuponi^L?FYbfgfd`^cg`NCGVWPIBAM^cfgaZRLKIQ[bfedbZJ=?M^eefffcdbb_UF9?S_ckА▒╨─Ч{ieg`SF95>NX^dfghih_L;10.5@P\cfggfaZOD?=99EVcli^QC=?@=?KY\TI@GYgllfWHE\~МЙВzvwo[B=LWTJFEIH:9:<=@95?S                                                                                                                                                                                 ╤% 2                                                                                                                                                                                                                                                   ▌xqqtwxxwnpuysmqyztv~Аzhem|}qrx}БЕ|hbcjqw{|wpszzywqjffgkpw|}wk^[]^^^][UONPSRV]dgdWPS]ehjighf]TRbmt|}o\PVXZ[`d_SKNU[_`VJIJTcjVDO`kpiU?CIS[^R:F\mstqhT@BWjlg^N@=GPSVYcnl\BANZ`dipstrrnfNDJYfknqpqpsvwqoj^LBObirxyqqqswwpkkg[H>GYdfhffb^]a]LCJUVRJA?Pbdgigc]UNIJNV\acbZI=?P]cefhfbccc_SC9AU`bf}░╟╞гjge`PC97>O[afgiiif]H8/./8GXbehihd_SF><:57EYelg[K>=AA9=KSUNFEN]iolcVDD]}УЦЖzwrfRA>O]UIFIKH;:<::=8:H]hlfTC<=A@=BKQRJAFVbjmjaTFH^zПЦМzqhZL<>PZSIFKNF:9<=BB:9C╝                                                                                                                                                                                 <  ъ                                                                                                                                                                                                                                                   ■{pouyzwysrvxslnyvsy}~nbboxsquz~~|xmbdpy||~}zwwvvxvunhebhryБГАqb^\\```]XQKQUUTW__YOV_efhijnk`TQ[gnsywsgZZ__\_bdYONTZ^b^QIJMS^aLDUfpqgPBFNW\XG:KcpttqfP=CU`cbYF;=DJSX^fmlU=BR`eehlqsutpcKCM]gnqrsporsyxpgYI?NdorvyuqprwzskigXC;FVcjljgd]Z_YKCIRSWH8DW_eghiieeeb[PA=IYcehzШ╟╩░Зokd`M>8=ES_fhhghhhVB2,,-AS^fimlldUC;9==6:M]eh`M@?EJF8AOTPICJ\ekmj^Q?E[sКЧНykaWL??OXQIIPRC9:?@CA9=Gш                                                                                                                                                                                ю%  *                                                                                                                                                                                                                                                     }rrvywt{xrswwmkt~vpw{{re]ctvqy|~||vdenv|~ББvqrtuuunjddhqzВБАwc][\___[[SMQUWZ^]XTQ\dhgiiijd[RP^gmptslcehib__`_WNOV[_c[NJNQV\]QKXippfMBJPY]XBRekns{yqnqsxvldcVB:EU_ijigea^VSICGNQLB=CP]afhiihge_ZSOKKIJJ=7DW^cffhgfgfbYM>7?N^ebWF?FNKE?FMMKEDRagkkeZLAFZoАХУxf^UG9@QWPJIONB69=@C@8;I¤                                                                                                                                                                                Щ  z                                                                                                                                                                                                                                                     ЫsqtyzsvwupptomqxvqsyБvi^^lА~msz~БВ}gfls{Б~А~xtsuuvplgejrz~ВГБyd[Y]a`a^[QKNU]`_WQRV`fiklmnm_WTS\foqqnjgknmia_c^VQVZ]`bWNOSU[_\JJ]kqoeJAKV\]VDDUhpsroaK;BV`]\TC;BXccb_ajkP;DXdghilnsuto^HEN^jmoppnnnry}teUDEUfmnqwzsqqqttpicUB;IW]cgjkgdbVMHFJLMJAGZk{СХ{f\TF=BQTKEJTP;57=AE>:?[                                                                                                                                                                                 F ц                                                                                                                                                                                                                                                     ╞urqtwvxxwssvrpqwxttu|{mYXj{|mpv{ВГЕqhjqzА}Бtntutrmhghmx~ГЕБwd]YY`a`\XRLNV__[URX]cgkjkmliVRRV\dlpomiiq{tiecbZSNRW\_aWOTY[^_YLP`nrn_JDPY^_T>BXkstul[F@IY]ZSKB@E\eec_aghJ:F[kkjijoqsto[IIO^jnnopooqrw}vgUCC[jknqwztpopqsrjaS@>L[`bfjhdac[NEDGKMH@?GSZ`bfjkiijgec`\VRMD:8AOW^abccadb]VG99KW[\_lК╡╚пМoa[UC;6;JYdgiggjf_LDQQKFJPM969>CF=7?Л                                                                                                                                                                                °' '                                                                                                                                                                                                                                                      шvuqqtvxxuopvwqkx|yuw}~rZUf|rptzБВ~pfm{БВАББ}usrpnmjhiku~ВГБxa`Z]```]ZUQRW\\VNQ]aehkkkkicPLNU[bknniiowxungfdXOOTX_e_VPX[^_dVGQbnokZIJU^_^O@DYlrrlfWC>IUUOID=Lcnoe^^`]B;K`mniiloqrrkRGKSakoonqpqqqqtqeS?Eetqpprwwqonnpuo`L@CSbd`chkkfb\TGCELPE=>HSXXY]bfkljjjige_^UD::BLOMOQQSTTSSL?47HLLOVb{л═╣Сwi]RC:6=LZbhkhfb^WE5.+.9L`hjkg_J79DQWP;8DV`XGBBRa`PA>BCA@GZhlljc[NBAL^jt}ВЖzgSC:JRMJKSSI=:?DHI<>Fє                                                                                                                                                                                Y ┘                                                                                                                                                                                                                                                       wtqquwvvrnpw}rjxБАztv|i_gwБАzqu|ВД~qnx~АВБ~~~ynljighgiuАДВВwca\XZ^b`a_^[WRKNS[bgfgjkki`TSTTUZahnon{ДГАzuog]PPTY]a`[TZdghe_RIXjpofSJUahf\MDN^ggfe\O=;HNLQYL@ASfnpf`a`Y?=NakoljmopqqhPEKVeknnnqrrronnmbOAKduwqqsvwsqqpnpm_L?FWdga_bijhe^SGDGKND9:HSUWVVZbfjiiihjed`YE79DNNNOONLKMQPI>69EMNOU\tк╧╛Ч{i]P?88?M\fhgeb\WPC6/-0M[ZN;7FX\PC?D[e^N=:?@KTQIKVYI8F                                                                                                                                                                                ¤+                                                                                                                                                                                                                                                          Йsoqvwtwxspt}ujuВД~|zywqkhr~В}srw|ВДВwrw|А~АВ~xw|wnjffhijvБИЖЖ{da^[\`aabcaXPNOOT[cfieikkg\UVVTVZagjjk|ЙЖБ|qi]OSV\^_]YV]imlf_NM^lombOIUfjf[MDM]befg^L@?GLNVYJBHUfqohba^V==PdoqpnronpphMHMYfloopnqtsonpk]L?Heqsqoqsywqopool_L>FYaeda`cfggcTGFHOPE9>KV[WSTW[cgihiihhecXH8:HVXVUSSPOPONH>6A<AHMPVYI?FZgstida]U<>QfprqkppnpneJAL[glnppopstpolgZJ>Hduwtooqwyrkkkjh\H?H[bedb^_dhheWGDIONF>AQ^\XUPRW\eggiiihfaWD6=MY_]\\ZXZYVQI@9BNV]^aatж╦╔▓ЙnbN<45AP[cie]ULJE=4/-1CWdhg_OB:@R^d[H:;:I\kmli`XPHACWdint|ЙЗoQ?BRZWSVZXD7>EHGA:DЯ                                                                                                                                                                                u! ╙                                                                                                                                                                                                                                                        ╪wutuxutwwwt{ysryАА{vw~~uioy{ss|~АБ~tpzББ~{zywrlebccitАЙПФВnhdcabfd]XSNJP[[Z\`dffkkfYPYb`\[]`fc]dtДОМД}oaVRWZ^cc\VXcnpogZNQeorjYJK]lneYGCN^da]\SDAGQUWVSEAJ\mvtkfd]S9?UhqusonnpnnaFBN^hnnppnsstonkcUF=OesywooqqvrnklkeXGAK\ddb`^aghkgXJGHROE?CUcg]YUOPW\efhiifebUD:CS`bcda_\]]ZTH=6FV]cehitв╦╬╝ФsbM;67DS\dd^SLKNJ<2./4AVdfcWE=?I[fe\E;>GID8@EHD>?Gў                                                                                                                                                                               █)  r                                                                                                                                                                                                                                                         ■zwrpxxsuwtqrzysrzАgfnyyqrw|Гlsy~}{{{zvw~ББ||zwpjfijnpsv{|wsmhfc_YURPNMMT\\WX`ffhlg\QWbgfda_fd\[arВРПЖxhZOQVY_cbUNZgpspbQHObqqeRHN]gf^N@EPTTQPQMBES^`^]SA>Nbpttpjf_K8EZhptrnnppoh\BBO_jnpqqnnrtqnj_NA>Tdox|tnpotvrkhfbS>:L_efed`]ZchfWKHJMKD?I[fhfc[TMGMU\bghhe^P@;G[ceghffeefcUE;7I\begghrУ┴╒╬йyeG;68GQVXUJBELUH:1-/8K[`\PD9BQ]ehbRB:>CDAAI[dgfZ@9<>?G[lpok`SJF==L[fhilsrk^KAMiyl]]^N?:AHIC=@O                                                                                                                                                                                З$ ▄                                                                                                                                                                                                                                                          Аytptwwusspsz{spxАБjfjuytns{АА}lowzyx{~wwzАДАА{{ytpjlnnqroqpome`^\XWXVWUONSYWVZafghe^WW^fhgfddj_XZcsАЙОЖrbWSWY\`ebQN^jorn^RJPbqq`QHP\ed[H>CLOPQQQMEHYef`_T@?Odqvxrmg^J8F[lsuronmophX?AP^iqrppmosuqmg^N@@Wjmt}xnnmowumff`P@89;89:@Qbmomh]QJEBBQ`ggfimphWC@Ugjc]][L<>DIJA:?r                                                                                                                                                                                <   "                                                                                                                                                                                                                                                           Юytmv{zutwpnv~tpxАБnhekv{rmw|~|snszysvАsrw{}|}{{yttqnmghkknkkea^[YX[Z[][SNQ\^ZZ_bff_YXYcfjhhfglYPWgr~ЗКАo]VSUXZaf`PQdnoqkXPQWbnn]LGT`edWJBCLOV`i]IBL^ihd`S@BUgrvusng]E7F]ptuspooomgS=CTbiorrqnnqvumg]M>AXknpsvrnnptrpgf^M<;N]cijfa_[^`_UIDIPG>AU`figbQ86;:;@IWcghfU>;@@HYgnokfZOKD;CTaecbeilbRGDW`^]\^YG=DXjoswxtpoptrmhd\I8=N\bknje_]\_]SIDEIC@@N^hikjihd]ZQNNPU[\TD8=Paefhiihhfe^PB;FMUclnWGFTdmpg]NAEWjsvutqlZCAOdrurstpkmmfK=HZflqsspppptwpf[I=F]hkov~xqmoqppkdXI>BOX`iklf_\YXXSJDEC>CKLI>=H√                                                                                                                                                                               3  *                                                                                                                                                                                                                                                            √|wrv~}rqwyqlx{tovААu^Vg}~hkrzБ{morrqmnv~yrty}}|yxvspoot|zzuldbb_[[]`_^ZVLVbd^\aaYVZafiklmmmg\PUakqy||p`Y\\\\`baWQ\kqpmeTY`dmqiRJGMPTSJ>AHNV_ilQHKVgppj^K@DZmruvurj\>=QfoutsrsplkcG1;Vcdefiiheeb[J@?FLMF=AT                                                                                                                                                                               ▐$ П                                                                                                                                                                                                                                                             ywsrx{uqtxspw}|srАЕw_Ybt~umqx|ААvnqupjlnu|zsr{|}{xwvtsqrv{}|xn`]cc]Y\^]]XVPWbeda`\VV_fijjlmlibXRWbkptvvj`^_`][_d`UQ`mqrld[cДЬР}mOHGLNPOHCEMY\`dfNDL[ksrm^J>G[lsuttskY<>Qgrvuttsnli_BJ^jonmh\G7=MYelnok]OFCA97PZ^VMIS[]QECISWZ_c^M<@GMKB:CЙ                                                                                                                                                                               ~ ё                                                                                                                                                                                                                                                             Сyvttvvvv|slv~tszВzcV]nz{wrrw{}rmpqlkkr|Аzpt{}zxuutqpot{~xo^\_c_\``^\YULS_ffeYSV^ejlmlnnogZOT]binrsricfec]_da]VVbmprl`]|│зШЖgLHMQZ_YECKU[^`dbIDN^nvsm_H>J_mtwwuqiU;>SemstqrqnjbZ@?PckmpsuqopnnptkXEAAA;:AL\\[agjkkkgedb^WROG92=S^cdfghheedZG;9I]dffgeeesЮ═╩ЧgI67:;S[[TJLR]]OBCUba`de[LB@HNK@9E╔                                                                                                                                                                               /  ?                                                                                                                                                                                                                                                              ╝|yrswyvu~vks}Бwt}Аyka]iyАxopuz}Б{pmnkjks{{vttwz|zxxwsqpt{Аzq`_ad]X]_^^\WPQ_dc]VQXbfhlmoomldTOWafkprulghnlga_`_YUXjllrk_eКТФИw]IKV`efYFKRW[[\_]EEQaouto`E>NapruttqgO7>SckswsspnjbY>@RbkopsurqqropofWE?UpupopqwwqnonnqfQ@;G[gdbejgge_ZSJCBED:9@GYb_[`hkkkgffdd_\VG:5:LTZ`beeeffcYI=9L\bfihddblУ┼╞ХhI68>JS\eihhggaL70,,6@>?IR`inonolcO?9=FO]hmlllgWA9FYdjnnnfUFCEA:BTZXOGIU_[LDJ]fkgedZG:BIMJA9Hў                                                                                                                                                                              ┌$ о                                                                                                                                                                                                                                                              ▐y{rry{wmorqtxА{{А{pcagxД|klt{~Г}ronkgjtyzz{yvvyywwurqot{ББ~sc`cgc[]_a_^XSW\^\WRU]chjklonmi\SUZafhjmmhjnsumeed]WW_|ШЮДl^[kzvriXIP^lniYEMW\]]\^VADVerusn]C=OboqsutpdL8BUckstrsqnleV:AVfmpnrronrupmmbRFDVnvtpqqsvvrpkiheR<9K^fgabehhhf^VMGDFC>>EMV^a^^cjkljggheb_WI94JV^diijhg_G6/+-8@=DO[ejnnnmjaM<:ANYdjnnnjdV>9J]glmlj_NC@A<:ETVQJEKZ_UIFRkvtoidWGAEJMH?=Q                                                                                                                                                                               t ¤                                                                                                                                                                                                                                                              їxztsyzyrrsqpuz~Б}z}xm`gqz|slqy~ВАvplkgipzzzzvsqsxxxwttru{АВВvebee_\]`aa`^[Z[ZWPO[dfhjkkmnmcXSV[afhimmlptz{rie`\YY`Ф╬┼ЪmWQZbfjhVJWfnneTDNZ__^]\Q?FYjrvslW?PaeihecgjjfcXNECFA==JVXW]^_afgigghggfcXH98AHNLKQSX[_`ZMB:JYcikmkkkh_L:8FT`hllmmjaS=;N`gkmlgZJCCEA;GVXNGEM`eVFEUrДzri`R?>HMMH>>|                                                                                                                                                                               + ^                                                                                                                                                                                                                                                                zzqqy|xnqyvmnwАЙ|vx{vdhlswxuqvzВtghfipy~|zwwspouyvsrsw{АБДxhcdfb[[`ca`_^\ZSLPU\efihmmnmi`VXZY_dhmojjsz~uljdZUXeЖбЩЗnSQ]bfibPJ[hqnbNDP_geb_[M>H\kttshT>Teeglhcbgjih[NDBDA=?K[_XVZZ\afighjifebWD79FQMJJKKKLORRI;6;JSTSSQNOP^{ОЛy\>36AP[eiljhidZC5.+/=CKXagjlnmmkg\F9B╝                                                                                                                                                                              ╙ ╤                                                                                                                                                                                                                                                                |xtsuz{qqwxlgsАЕsry~xeijrzyuqty{Г~kdchpv{zzxwtokovtsssyБДИzmhgf`^]```_^]ZQKMUY^cfhgjjjjeZTYZ]_bfjmhzЗГБАzpjcWV[dloqmbY\dlni\NK\konbMERbigd`[J?I^ouupdOA?IXgqrqpj[AP\edXWVW\`dehgghe`SB9?LY[TPOPPLNJH@979DLOPRRQSU^tЕБmT948CT\cjkijhbWA2,+2BMU^ehkkllkidV?6=S`imonje_VI9AWfkkli_M>CLH<6HRMHEJZhfUFG[tККzm_K:BLPLD>Dь                                                                                                                                                                              l                                                                                                                                                                                                                                                                  Юywvuxyvtxzngn{~olrz~meiozАzhpv{}~shadlsy|{vrrokknpqsx}ВЕК}okhgd``ab_^ZWPMO\ZX\dggfhklh]ST[\[[`eijjtВЗДА{siaZY[bijhc]W]inpiZLN`mpo`IGWflkc`YHBN_lttn_K>BNUcpsrqiXA7I^ehkqsturm`D6H^jpusppprqopleVH@KalpsusttswtsmlfSD:@Yjkihhcbbgkh`QEADA>FTbhg`ZUTX[`dghghc_RA9ASa_\YXXWTSPMB652+,5DP^egknlkkkf^O<:DVbikonjaZPD=D]hnmmdXI@IRK;7JRJEEQahbRDG[oМУГp]F;FPQLE?H                                                                                                                                                                              ■# |                                                                                                                                                                                                                                                                 ╩zyxuy{vnt}qfkxznllt~xkhmu}}olt|~|{zpaciqy||{wrrqmedjlsxЕКМnligeb^^_`ZSQMOUaj][aedbejj`WRU[[XY\bgdgqККГАsl^UV\aklf^YWdlsrhYLPbnqj\HJ]jmle_VHESdmstm^I>DQXbkqqpiVA=L^ghkntwtrl^D;M`iossqporrqmkdTD@LdlrxvrqqqvxtmjbSE=CWhjijhe`^enjbSECE>8DTbiie`TQSU[`dgfgb^Q>9BTca`aa^[XWTPA67?ORSVY\_b`bikdZD42?R^efkpstrrlZEAPbknpqsqnnqonkcQGBOemnu|wpqosxxngaSC:EYekkkhhb[`kjaUGCB=>GVcijhe]VPOOU\aefc^P=;EXdddeffccb[UA49FXY\]_bcdcecb^S>1/JNOKD@е                                                                                                                                                                              f ;                                                                                                                                                                                                                                                                  √zyytsxzwrutqkn}}qfiwБxaelryytquy|{jfjnv|}|~ztqlfaaehmu{МН~xrojhc^YUQNPRTTY``eiijebei`SLPZ\]acceb\`nСФИ|meXQX_agmaTU]kpqndXKReongVHTbmppl`SFIYirvwl\I?JX]_dmpmbM=DT`fgjnsrrpiV;;QcjoprsrppqnmmdPCCQfonossqppqvwof`PC?JY^fllifa^aff_UJGD;9EWdikieb]SMLLS\aec\L>9G]ghfghffed^RA9>N\addeffhffb_ZO?12>KZehikkhdYK3*)1?S^giikljidZNE=7LbrКХРz^A?IPOD>Cц                                                                                                                                                                             ■# п                                                                                                                                                                                                                                                                   z|wppw~tktxtkn{~weaoБ}aagq{Вwhqy||xmjkrzАА{yuoidejjhlszАxsojhb^YSRRSUVX[`cjrrsplhgdWNLNRTTX_c_[YXlНТК{jaYVZ^cgi[TXajppi`SIRblnaVMWgnppj_MAJ\iqtsjWFCNYbacjnk_L=EV_ehjnprpogT>>RgoprssqoqqpmlcSGFTcooqsrpopsuvnh]N?>L]adjnlgb]^cb\RIHB;=DSbgjkgec\SOHNT\`bYJ<:J^fffhihgfg^P=6?Q`eefggfhfd_ZUK>47BN\eikkgb_VF1,+2DU`jkijknk\PFB:1:SbhklkgTNJD?ARdmmg[IAAT_ZI7CLEBFXhliXGCNcqЖФРxXADKMME?H¤                                                                                                                                                                             ╗ ■                                                                                                                                                                                                                                                                   Сyxpmt}vkq{ykhxД{eakrtlfemu~mmsy{|Бwkgox}|}|{yvslikjjgjkhkkd_]ZVTRSUZbc]^fyЗВ|tlif\RJGGGMLQ]e`USXi~ЙКЙyf^WV[_ehgYRYempri\NJTagg]OJ\iorql]HBNanttqeQ?BRY_]`inh]IAJ\ehiinqppmdN7;Uionqrsrpqpolh^NDI[gknos{uoorswuhYK>?P`ffhknif`Z\^[SGIB78BM\egihfd_\QIKNV\\VH:\                                                                                                                                                                              H  l                                                                                                                                                                                                                                                                    ┴usqqqtrnt{ynkvД~h\aovtlgjpxzuqqv{{|}slmw}}}}~{yvqmljedhg`]\Z\ZYXTVVZbda]_oАzunhheaWPKKLNVW_df[QRXhzДЖГvb[XZ^`fhfWU^gnnldZOKV^eaYNM`lqrqj[HCPdorsqbJ?FV^baafkhXD>N`ihgkjnppmaJ<@Viommrtrqqrpjg\MEJbkpqppwxsoooruoZH=ATflbdimjfc]VUVQGD>9:CNT]eghhhedZTOLPSQNE;=Oaghijkljif_M==HVagiiifdhie\WSC2/5CUbilhbXRSK:/,.:IVbjmkiigZJA?<51AYdimlgWFCC@=BVdgg_NADRadVB9FIDDObnleQDDTcn{ДЕsNQajkklljiif^L:A?63D\fkmiaOAAB?9CZffbXH>HYcbTC@EFCESfpmbM=BUdkxАiJ:GRQFDF╨                                                                                                                                                                             К 7                                                                                                                                                                                                                                                                     ўuwwtjqyxsyБ{sv}~qb^fyВvebfpГtmqx||}|А}vsw|}}~{|yxvurrsx{{zqf`ceeb^[^cec_^]fxyfXW\ZUUY_cfghimndSLSXcr|ygY[[\^_gh_VXdlmmh^SNQ]`c^VOUboqrndQBBPakrsoYEBQ^fc``dgcUA@Tekigiglmnk^I>J]inpqrutrqqpneVGENfrqppqv}qmopmlkWD;DYgnhdgllhga\UMFDB:9@IT\[\bgikjidb]WQMLE?9ASbgijljjghg]G8;K[dhghigijjgaZNED74I_hkifXG>AD>9F^if\ODAO`eaP:8BDBJ[hpn_MBET_itws`DI[jjkhhkjjfa\SIB@B:9BMV]gbadgijiedc]WQOD<8BT`gghkihefdZB43=O`egjjhgjkje`XK9/+9K]mМ{g\XXWF1*).?R_gihc\NC9BNQI8;SchjbUH;@HE=:M_g_RC=I]geYH9=EEK[gpqhXGAIS[eliaOAEQRI??                                                                                                                                                                             D e                                                                                                                                                                                                                                                                       ╡vwtlhu|smwВГ}{{}wfjt~Аxnektxzvusx{}zxz{wmqv||}А~|zyvz|АВГ}ecfhhfb]Y^acc`ZW^ed`]SSZahjloppok`TOSY]bennkdehfb^dgaYYcmqqmbWRU]dgaWRR]kqrslXC?KT]fnpaH?HYhkhec_\WK>I^lpokjhjlicS?=VhnnnrrrtssqnoeN@FVfuwqpnqruuppmj]L=@PbikmidbgmjhbYOIGH58EX]YX_b_`fkkhhhfc]WD:7?IQV_eghiff`R=4BUbgihhiimjhe_XH6/-:L]xukc`^]YC0&&/AU`ihd\PBA>JXXH:AWeie\MA>HPJA=RdeZMEBRdjdYG>CCBM_jpneSC@JT\eheZIBIQPGBD─                                                                                                                                                                            ъ ┌                                                                                                                                                                                                                                                                       ▄tsspnsvuqw}Аxqu~}mjr|БАt]eovz|tivz|xwxztrw|{}|||yyw|БВГ}gadhifd[Z]`cb_YWW]a^WUV^hllmoonmcYSPUWZ_ahkkmopjf`ff`ZZcnpql`WW\aegaUNS`kqtrkTCELS[bnn[E?L]iplhe`]UE>Kanqpojiiji_O=@YlqonqprtuusnmcLBHXftxtnmpsvvojkh[H?AObkjjmgaaiiie[SLGA27GX__YZ]__biliihieaYC:9>DGNQYadedd]O94FZcghgghhhfee_UE4-2?KTZ^bfcc`X@/*)1CWbig]NF>AHX_XG9C[de_TGCFORLB?T_]RGDHZfjeVEBR^afd^RA@NVPIEP                                                                                                                                                                            ·  Щ                                                                                                                                                                                                                                                                         rovvnew|xrwАzrpx~ztou{~yjintz}{toryzytprvxsnrwzz|{zyw||АБАygbcfhie\[]aacb_[]ZTNMTagjjlooomdYU\a^X[`dghrz~|skfgbXW_hnorgZT\fkhh\OP]mprsndJCGSZ^afeOBETclpnlfc^M?CUhrtrpkjjfd\IITVNKMLKOQSOC55EX_defdb`^[\XUL@3/8DNT[fhigf^N8,+.9KZ``UH>8K]_YOB>FX\WJ?CTWOGEL[glj_L<:BCOalqqmZH=GW`dfc[MABPYOEEЕ                                                                                                                                                                            М ·                                                                                                                                                                                                                                                                         Гruwrjs{zsq|}tjrАsipw||tiku{}}{xquyytllmrwrmrxy{yyyy||~}}wid`fiig^[]beeda\WSNMOU^hjkjmknj_X\add^^cgij}ДА|vnge\WZcknnobVW^hlihYNP_gnqqm_FCMY\]`a`ICKWelpolgc^L@DYjtwutnlje`YH;KbqsoqqpoorsuoeVEDObnsw{wqqnnuuogcSCDJ]ioqneQBAKZfegdSFENTRICIў                                                                                                                                                                           Л  ┘                                                                                                                                                                                                                                                                          ╫uuyqhq}~rkxГwjioxvnnsyДxflv{||zopuwrnkilqtsnlnpsyyx|ААБА}oa]chhe`_[]a`\ZSMKNQROZgihjmmk\XYajid_`cejsЗНЛВzuneXX^hoqph\VYbknohUNVeklnphV>HX_abc_[BGWhh`NA?BHGEFQbmolfU@9?GSdmopoaNECP_jghcOBBPZSEAT                                                                                                                                                                           ■&  ,                                                                                                                                                                                                                                                                           єxtunkox{tmu|lbfsvqorxГwkptyz{}xssvupljlqusokghkpvx{ДЗКВna^_gkjeaXY\ZXUMHINSUSWfjkkmjaVW]gmlf_`ec`jЛНЖ|vmbVX`gnplbZU\fmoneSOXdlprqfO>M_caba_X<AShnsrsuuspqsvrk_MAAMalhgikkgeb`bbe^RH749BOaijhfd`ZUONSZ_a`K=:GXehfegfgecZI:4FTdijh^L@FQTQECЛ                                                                                                                                                                           г  д                                                                                                                                                                                                                                                                           ■{vwrkmv~xruzwoc\izzpmsyАuptz{|~xoovskiprvuqlheeekrw}ГЙМБrd_`aijgcZVUSQNKIHLSTSXbhjmohZQWajnmiceb`]hКЛИАwk^SV_hmpl`VT]glnk_OLWcjoqmbMBPdkhda^S8?VfotutsmeS>>Qdotuvxtoje]MCBWktttuqrrpqsrn^L?DTenrqrw|upprtuoaH;>M^mmhiklhda[]bc^SH74:BM]giigfc_ZMINSZ^[F;;I[ehhhjhheaZK71?T\_aabcdcbbbZL@804DVZ]ahkkhcVD/*-5AHD?DO\djlkhfVC8?HE@@GWeii^L?=@CBFR_lopkaM>=HRclpolhVCAIYflifZFFVfovtrtzypoqrrobG?BP`mjdgkmkec^[_c^SF41:CLV`jkhgfd`VOOPRVR@H[hpqrsw{|nnqqng^F=ETdjmcdhjhbdc][YYRC45@JNQXehhhhfa\UNLOPL<6?L]efhijkjieXG76I\dggggffefg_WK950:O_aacilliaQ?/)-7ADEKWbgkjkkiaR>6=@>AL]ippm[G<=?;DUckoroiYE;CR_nopnhaMALQJCB]                                                                                                                                                                           D  я                                                                                                                                                                                                                                                                             ╧rtxxpqzАДГА}|q]`t}unmou{wmquy{||{wpniikqv{~zuqniehghiknnoh_]\YWTUSRPX^bb\QIKSUW^fgfcXT]gnnnkikbVRUbwЗЛКm`WV\bhnobVV\eimmfYRU]`emnhZLM_mqqjaYD=Nborvwuup`J;GWgrssuvutlcUDNbimqrrsy}qlnpmdWECKYekmiefjlifb_YUSNA06GQMMX_efggfea_VPNMH83?Q^ghiikkkieVF:>M`lhiiiihhhf`UI612@Wmsgdfkig^M;**.7BGPXafjmmnmhaP<6==?IVcnpqiXE==?=J[hosqnfSA>JZemopld\I;DR`hki`OADMNIBDУ                                                                                                                                                                          ▐ V                                                                                                                                                                                                                                                                              яurw|rltАИИД~vcfr}vmlrv}zqnsxz{}|vmlhhinu{|}ywrojhfffddb]ZYTSQQVZXZ\bgeaTFJTXPWcgcXW[ciopnklmaRPU_vБИЗzg\VWZ_hlk\TW`ikmlaUOT]bgllfXLObqsrofWFBTenpsttql^E:EUepsuxyvtneSCCPdswtuwtsqrsokeTA@Relkorrqqxwonok`O?=K]giikigfiie`\WTQL>38FPUW]^`ehggfd_ZVOKE42AS^fhijkkjidTB6=Rdhkkkjjijjf_SD410B`rniggiid[G3*+0ER`imnmgUABUfswuxwuspppnkbQ?AUhooprrqpruqnkgaP=LXcnwxxywtocI@GWhtvtvwvtsqqrlbP?AWgkoorsrqvxqkji`N017QsББ{ohhgdWD3(,6FU`gijiiklnleUF;;HRZahnqskbM?BGJXcjnproh]HGZjonmf]TO:@Pbkjb[OB?KUP=AЭ                                                                                                                                                                         ▀  =                                                                                                                                                                                                                                                                                 ╒xrtywolxsdk}Дxhr{zlfnsxyuoouz{|yvxxnego{А~z{{{{|}Гb`baaafkje]\bhgd_WSNZ_^WUY_fkmoooopdVLNUZ^fmspe_efc``fg^UVblnmk]VV[^`c`b_XRR`mssqk^JCJ\jpqttsoeO8AT^ckrvyyuql]C?DSgtutuvutsrpskXEQ^bejkkllkkf]NA=HV]ilmppohZDGZacipxwutqhX?;GVfrwvywussspphYD>I_hmpnopqppornhc]C:CR^hljghgfb`ehe`[SG5138CX`_]ZZX\_ffihh`U?4;CEFHGIOW_c^SB88J_kiikkkilmjdWF817Gyн╚╣П{qyzmS7*(1AT`fgllkloliaWI=AO]eklmmomfVC=IYelsqonlfXJ=@Sdknmf_VNE;EYgke\UG?CQVL;G■                                                                                                                                                                        ┌! 4                                                                                                                                                                                                                                                                                  ■yqry~oer~{lkvyppu{qjkmqxАvhqz{|zz{xtlgr{БАА~{{~~zzЖifddb_bhifbabfhfd_VT]^VOU`jknnpqqneTPSUYY^`gkknoqofcde`VV_hnoojXW]cecdebXQOXiprqpgUDDLZgnqtusj\I>LXbejouzxupeS<8IXfquuxvutusprgVGBMckpsmjlrqoorqi_YD=JY`gkjjhfb^_fhhd]UD468:DZedb^ZUUW`ehieaQ=7COUUPKFIMQWWL?89Maiiijkjhklh`UD728LБ╛╒─Ю|jnoeL6+)4EUbjlnmkjkib[SEAEWcjqpmoqobP>?O`hoqqolhaSF?HXfmqnbVPKC9I\efcZTE?GRSJCq                                                                                                                                                                         J  ╩                                                                                                                                                                                                                                                                                   Иuruwpin{~qko}ztrtyАЗtgihmpywmow|}}~zyxvmlu~АБА{{{~~{zАГ|icdddafjifb]]fghfb`]XQMOVdlmnpqrpk]MOTVZ\\agintwxrkedd^WVcjnqodTV_hjgdedXNR]msssnbOFGOYcmqvvtjXFAPZ_bflswxupdN:9O]fntwxvyuurmibU@>Qgmpvsmipqnmpvo\UAIZglnqqong\L=@UckppqsmdZOD>I\hnpj_RNJA?L^kh_YN>4D\lqsrqmjorrrrrlcO>;N^kjdhknkfdh][`b[N:1>EEJZchge_ZTMORX`^XG9:L\bhhfb]\WQOB417AKOUWZ]\\\][VL=03>TА╝▌┌╡yge_R@2)-?Nalnnnnoi`TD?J]jpssqnf[RKB>N`kombSMKD>BUdh`WPE>BMTPFG                                                                                                                                                                        ╙%  O                                                                                                                                                                                                                                                                                     ·uqv{vjq~~q^as|tnqu{~neefkxulpv|}~{xsqusllsyyz{{zz|}Бqgdfffbbfheb^_eed_VOIKQUYalnppondVOOSWZ\^cgisЕНИАzupg]W]bkppmeYT\hopqje]NPYfnrtqlZFFLV]_gnqro`IAJbkihfgmvwtl\E5F\cfjpuwyxuwvtjXF?I\mqrpsqojpoopnkaNAASahkhegmmf`b[\abZJ91BIGJYefffc\VTKLQXYTC8?P^eikgfcb\VTB626BEHFJKMONNRTPG:/1@X}▒┌р╗kg_N:.(.@Sbehlmje`WMHC<:BScmooomhbYMC@I]kpsroj]SOHACQdlmi^OJIAOeomiffjuvsiYB6I_ggilsyywxxxvkVD=I^mqrpqusjkmpmkh_ODFWbgifbeilieb\X\_WG;5ERROTaggeeb^WNINSRM>8BS^fhjggeec\V?56CVfkjeWJFIA=I\d`ZUK??GPSNJ╚                                                                                                                                                                       ╬$  f                                                                                                                                                                                                                                                                                       пzux~Бmsz~wcbdv~yomz}Гvfacisw|{rlxА}|wnjhkkhfmquxxzБГИИyifggebadhiea]][VNNODGRZYZfklnmhVPTXWVXZ^da^eyЙЙДАypfWWahknnh^VWdnqpppjZRUbnrrqneOGNW`cbciqriXIETipomkikpusgV>8NbhkllpvxxuxwvkTB?K`npronoolnppnkdZLDJZegjhacgkiea^YUWRH96FPONR\egggdaZRNLMLI96DV_chjikgfd^T<89CRUTTTSUUTUVUMB2/3DYvв╪ш─ЖpfYH42,1DWaglkf_TLDCFE:;I[flnljcZPKE??Oelpqqj]MKE@;FWfmh_PFEG<>N^f^USF>AIOOLK°                                                                                                                                                                       H °                                                                                                                                                                                                                                                                                       рyvv{Вwuz}mcdqpeu{|xqe`irvz{xrpy|||xmjdfjhdaglpvzАЗЦН{ojjhedegihd_]WTOPWYLJQZ][ahmmk`OV[\VWX[^_\X_tИШПД{ocXWcilolcZSZfmqrsqh[NUclprqoaKHS[aabbhppfSDGZlpokifgnroeR::SeiklkptvvtvxtgQB@McnqstpqqnlmpplbVF=K]dfhigbcjlgc`]VPMC54FVVOOX_dfgfda\VRLIB96DWbfijkjgge_P;5>N[^c]__]\[]]WM@3/5G[tЭ╒ы╔ЛqcVE3.)3J[bfhi_TGDAAEF?>L^emmlf]OLGA=CShlpsmcUHE@:=H[fgaWKCBB7@R]a[RPD>DKNKM`                                                                                                                                                                       ═ {                                                                                                                                                                                                                                                                                        №~ywy~~zxy~zi_lБthsxzzwkbjpz{|voquy{{umjfjkhdbbcfmr{ИИЛnhjhfffeed`[WQQU]a_JFOVYZ_gjjcYU]`]ZWZ]c]XW^tЗПУИykaVWeilom`TQ]hopqpohWNWemsurl^IIWcgca^anqbPHJ_nsrolgfjpmcP=B[hklifjsuvwwwtfPAARdlooonoupjlnnlaRDAI]ljeehfdfijea[SMKA47FXc[PU[`cffec^ZTOJB88HYaeijjkijg^M88CS]cffhhhihi_XK@619JZoЧ╒Ё╤РucSB1-,9K\bdd_UIBACLVJ<>PafkkiaVGDB=:EZjnoleYKAAA;@M]gi]PF@?<7DS__ULL>>HPQMJЫ                                                                                                                                                                       ;  ¤                                                                                                                                                                                                                                                                                         Н{ts|~xw{}n]hzБvhnu{{lbinw||zursw{{wokgjqnfcbddejr|ДБtoojhe`]Z[ZTJOV]bedPHMWYXYfhd]VU_c_YW[^bVTU_rЕППИwg\QWeknmh^WVdjpsqqnaVQVdntuqi\GNZdhea^`ko_NFMcpttrmjhikg\J>H]knnlghnuuuuuraN?BTekopoonopmkkmk_O@=M]hliefdbdhnkc\UOJ>48HV[\YPR]aehhgdd]VK>46DX_eiihijkf\H6:FUbgghhjjgfgcXJ=522,+=M]bd]RKCCJTaWJAETbhkkcXJACC=H[gkorpoqopkikmi]L=@L\djlhhebchlje`ZSK;/;GLNSYYV[_dfhhgfbZP=26APZaghgiihfZE46HYcghhjkjhghbWI<23>O[kК╧ю▄гaM;1*/@Q\]ZSHFEJV]_XG=GXcgkgZNEACB==K_mnoeVLB?DC>EWef_PA=@B?57@HQ[`dhiiidWB39I[dhgimnlighaVH<12BS]iЖ╩эт▓ЕbL<0-1CQUSOGCFMW_ecWCKbqppppopnqsnjieWE>HSZbilggkjfaeihe^WG:5;CEFLW[][X]bffhfd^N?7:?CENX`eghgbT@4>P^fhhilmnmjiaTG;54DU]hВ─ъц╛ЛeL<1.6DMONKGHNV]dgbVB=K\ef`RF@DLQF?CUdjjdXJFFIJ==JYb^OC>DJD=CSUTTQKB=ISUQM╠                                                                                                                                                                     ■0  $                                                                                                                                                                                                                                                                                             │{vrx|rlq}~riho}ЗtmrtzАncmw{zvzzmktwplmqy{|{yywsssuvoc]_ccb`abfgeba_bhiheYIIU_b\TU^fikh`\^eaUJNV^it}re\\]^_ini\SYgmpqssn[QOU]`dmnk_OK[inpnha``YGAO_ltwvtrlje_VMDF]mqsrsopkmqruujQC@LcrplprrsqsqnkhcTC=HZefhjkhhhgaafif`XE:7>FJJKSXZ\[Z_egggd\L:5=ACEFPX^dfc]R;5ARbgljgjmnlhgaRE<48DT`jБ╝чщ═ПdK<32:GLLGHLRY_dfeaRB?L\caXJADJROHAGXdif]QIFMTK;>MZ`ZH>AKOERepsklpqqrssohc]P@=K]fghhkkifa[_gfeaVF:7>HIFKX\[]\\[[afdbYL=6AJJHHHJOX^`YN96DUdhjhgjkmkjf^OB:7=IV`k~░цэ╒РcJ<65>IMNLPVZcfiie^M??P]_XNEDLV^TE>I[fgbUICHV\O<@Q\^RDADLMD:L_efcgjlkhc^Xaed^TD98@INIJY_]XY\ZTZbc^TF:7FSURLEAEMUYUJ66FXdhlhjkkkjhg]L>97@KYcl{гфЁ╫УeJ<:9AINNOYaegikjj^FBMVL=P_hjddhljhd`^[_b^Q?7=?FMSW[cgiijjihYH@DQWOD>DQ_fePAEQ]d`SIDHUd\E9EY[RC=GSVK<>IMNQRQIAELPLKю                                                                                                                                                                    °)  L                                                                                                                                                                                                                                                                                                ╫Вvsu~|keq}wliiqДВpiquz|~upsw}}}{xvsqedejrw}~}{zyxzy~xmeimookfgihgfec`chljd_\YOLMXfklnlhfeaTOOTX\\_hlnnqqpkdbgg`T[enqponn]TYaeb_`adaVN[isvwumea`UJL]lqtvwywtmgaOCFVituuvtpomljnpjX=>L[gmprpnnpsronmhYG>ASahkkegjjgcdc\Y\]Q>:;AQQII]ed`[TONORY]Q<6>P\`ccZQLHGDE>5=K[dgggjjkjjhbTE:47GS^foyП╒я╥ПdL?ACIU]_dhkmkjikfU@9;CPSNN[ccb^XONLOUUK;9BT^efgfb\UNJE8/9IV^fgggiikhh]OA86:JS`gmuИ╩я╧Л^H=AGNY`hgkllkjkkeRC?CGCCDOY`fg_G?FT\[OCDLX`cV<=LTLC>ES^ZJIOZ^ajГ┬я╧ЙXE9=DO[dhjlkkkkkjcJ=>CB>?IYafij]C>IVXSGDJTafeT?@LQIL^jpmhe^agige^ZVQOD:7AB?:EVbgklgX?LPIECL\dhh^LGQWRKR]adggd`]VNI<1>BFIP]gkmmlbP9AJLEBJTckkeYH:@DA;@Ufc[OEFR]t}s[FHIFGK╤                                                                                                                                                                   ╗'О                                                                                                                                                                                                                                                                                                     иВyuxБtccltyvjhsz~yqkkoorwwtoszА}zuqkfedirvyy|АГВxkhnnplllkhfeba_[XTRW[ZMDKUY]ahmndSNRUWYY\^b`]`qВНКВzpf]W^empqoni^SS`ionljfi]U]entuxwssshYNLXksvvwwzyxsfM@HWdpuvvvuutqqtoaW=;N_iopoppsrnlnpni[A;?Qbkmliddbbfije_[UK;69PdorsqsssnjklnmeYA8ASdlnmjfea]afffd\VL;69DD>IZdimjbR@;?@>DTeieVGDPezЕГnQEMQKJn                                                                                                                                                                   Х"  е                                                                                                                                                                                                                                                                                                      ■~zvnotunjpЕohms|ЕГrmpposxuoou{|АА}zwpebccbdhmv}ГЗЗ|hcopponjhdc`^ZSQPT\agd[MGS[]]_caVLNTVYXZ]_^VQ[nБРФЛ{neYValmnooke[UZcjnqnnldUR\gnqttvwsqbRKO]fntutuwvun`HCP^fouxwwuxutpol`O5?UfrsuqsqtunhjmjcT?>GR_jllkffe`_afgfbVI88:?BKUY[\VUX_eedb_YJ83@ENY_fiffff]M;6DVbhffffeded_TF8/0>LW^eihgkv~mS>-):O\flnonmlhf]R@6?Q\dgjlkkifY<5@DBCRbkmnh_J;;==BO^kmbRHJ[vКН}dPKNMIK╗                                                                                                                                                                  №7  ,                                                                                                                                                                                                                                                                                                        Фxfjx{mgm|ЕxlkqyБЙujlnoinxyolv~БАА}yriddcbddfks|ЕЖzgemppnlifc_[VRPSSS^eihaNGPZ^_a^YSORUVXY[^^[RPWlРУЛzkbXU`lnmpoj`WV\flopookaUT_ipqvwwurm^TLS]elquuxzxuk\EDTcilqtutswvtqrqdM9BYjrsssrnnqqlhgh`P:;JQ_gmnmfbeeb\`deaVG669?CJLPRY^ZWZfffdb[I45=CFNV`fehgcZH<:KYbfiiiiiihe_SA4/4@OYcjmkgjrrbI9-';P]hlopnlg_YPK=5CVchjlnmkhdP==BDDJZhmnmi\G=;;=GYeki^NFOlЕОЖr\JHMLIL∙                                                                                                                                                                  (  ┬                                                                                                                                                                                                                                                                                                        ╥А}nfs~remw|{vpov|В|rljljis{ujlw}|}|zvmhffeffgfgmpsqiilljhfa_\WQOOSYXX_gkkgTHOY]_]XUSRRUVWY]cfYMOXk|КПКxj_YY`hnonmg\UV`joprrqk_TRakoruxwuqjZQNV^binruvvvphXDEVejjptuuuvvupomdJ8E\jqrssrpnnpnjjh_L9@QX]bjmmiecd`Y[bd_VC367P]ehlnkkkjhf^N>1-5DS[elopgeifVB6,,@Q_ioqpni_VPKF=:IZfijmnllh`O9:ADJVemopniW?9;;@Oclmj]JGZ|ОМ|eTKQOIId                                                                                                                                                                  є,  6                                                                                                                                                                                                                                                                                                         ∙~|wsnttnlp{|xqsy{}xrlidkrwxtmozАА~}wpnjklkljiegggeceeccc_][XROPVX]]\bgmplZOQX]^\YUUUUWZXV]caPLR[jxЕЛЖvf^[^bekoomeXU\cimonqpg[SU^lqsutsrrjXPMVbfinsuuvuqdTIKZeggnsuvuuutrnh_I:H^lorssrpqruodff]J8CVadbejkjhfa]W[cb^R@168>CGGEIRW_c_[]bb`VD5:JMNHINSY_b^R?DKUahnpnlfSA::>GXgpoiYILfЙТЛu]OHJKIJ╕                                                                                                                                                                  g!  ╪                                                                                                                                                                                                                                                                                                          И{uqttspmtБokrx|В|rllheqxzxtor|}{vpnjnsrpojhdc`\ZZ]^][YWYRSY[\]bc]_flpo_OPW\[URTVVWW[YY^_YMIQ^juЖВod\Z^bfiooldWU]ejnqopmeVPV`horuutrvhSHMXbhinquuvtnbNGN[fkjlquuwuuxtphXE;J`knqttqooqsqfbbVD8DY^abfijiieb_XV]`]M<259AFIA?N[YX]a]X^c]P>3:QUTNKHLNV^ZJ:CHKIEO``ZXZ^\\^[N;2?U^^YRMGFHNNB29HXdhillkmlkiaWE9//>PYdhmolhe]R=1+*:O\gmohcTMKLOLA5CWehlmlljidU@9EQ\ioqqqmj]H<;BL[hmkiaRJTuАВyeRMLJEJf                                                                                                                                                                  S   я                                                                                                                                                                                                                                                                                                           ЄБЖfoБqco|zspov{~zpiekouwxtrspw~Аytoinsw|zxttpoi\Z\a`cefgjhgeeadfebeknqe_ZWYSQU[]]ZWY[abZPNSX^bjtzsfb^^bffimmh_WYbmooolnh^UV\dhmqttuss_SPXagmhhnsutqhYKHUglkgjlqrstutsodQA@Sgpstssrqppongb[Q@;J[dgdadjjkif`a^VWSF969>BKLFCQcb_ZVVXWYWL=8EY_a^YRGACFG=.5LY`eijlkkljgaSC6.1ARZfinomkh_Q:/+,?P\hjec^PMMQVQ>;I\fkllnnjf]O<;K[elmrrqlgZC=BJXclokf]MIYtwsiXLGHGFL╗                                                                                                                                                                 ─*  h                                                                                                                                                                                                                                                                                                             ЗЗ~kn{Аuhmx~|vqnsx{~xj^ejryzzxuquy~zwrklty{|zvsqpnfaejlornonlkigcgge^`hmnha\YVONS__[ZXZ\_\VNMTY^agouniihddddinlg\T_fnnommn`XRV\egjpsuurqZQU\bhkiklswutgXMMYjoomjjmqrqssrncOBFWfqstsusqqpnondZM@>O_dfhd`cgiifa]ZUTOD87>ABKQKCRbbb^VQQPRSE46JY`bcbaZNGEC8.9LY_efhjikkig`P@2.5DSZgknomkh_K8-,0AR_tБwb\TSUYZT;6K_hkllnmiaYJ;?RbilnpsrleUDBHT`immmaYLLZnhaWKFHHFEMў                                                                                                                                                                 B ·                                                                                                                                                                                                                                                                                                             пДБoku}umnr}В~pipu{~padirx{z{ynrvwyupjmsy{|~yxvvsgchlmmonqmmkifdgfgb_ejnhd]UQNURUYZXW\^bXOMRW[_cgmrmhikhdadelka[YejnpqomnZVRU_fhiorttqmWRW`jjkghlqstteVKL]mrmnnkmpssutsm_M@FWclqtruurqokkpj[J>=Tcdefdcbfhhhd`\VPLB::CEFKPNGS`ab`YSOLLH<54,6IU^hknnnli]I3)(0DUiАДvg]ZZ]b`N9:Maknnmlg_YOH@DWelopssrlaO?AO[fkmjf]UFH\h_TLECEDCGe                                                                                                                                                                 з&  Д                                                                                                                                                                                                                                                                                                              чБwmku{tlqxВДwjmt{qefhou{z|{tppsuuqmmrvz||ywutunchnnoostpomjd`cec^^bhkg`XPNSZXVVVWX[_]RNNQW[]\dkooqnojfbeghe]WVeknppokjXVX[`gjjnrsrogSUYbikjhijnuusaQIQ_qrmmkknqrruurl^HCJXdjpussrqqoogge[I<@Wegfbdbbfhjifb^[SKC;>FHEOXTHT`cbb^ZSMLF>7SelnlmhaYRLB:I[hnpnrrnj^JBIIIOVZSX]abcac[SLF:7=S`cfghffc_VD208:>FMU^`defe_TD92.;KZcfhkhfgcXB/((9KS_jhbchjmkg[F9BWfmmnlcXOLIC@K_jnnopmicWHBM[fjjjie_PEKV[VNGDGHDEOў                                                                                                                                                                И& б                                                                                                                                                                                                                                                                                                                ЧДГxiiwАskqy{ztoosw{{xhaisx{|{{zxtpnljjlsw|zyutvwpghossruusqnla]fkfda]^_[TKGFNWZ\YVW[`^VNPSVZ]^agkr|АБxpe]dkg^Y\_hlonoondQW_gigfehnqqk_PUaioohgjjlprpZPNWgrspprrpnrttrqeSEIX`bflqqsrrrpnjf_UG?Lbjihfii]\bhige_ZSKA>GKKIPXZNUZ]_ddb\XPE<5BBCHGKRY]^^YO?722FYfklkfZOIHD:>Sdlnnnnle\O@>Qbgkntw^LGLVZWPHGFCBIm                                                                                                                                                                ў.  $                                                                                                                                                                                                                                                                                                                 ┌ЕД|mis{smnr{Г~lmsx{{~qdfpx}~|yyytjjhihioy}zzzxyxqiioutqrsrpnj`]dghe`^^[VPNKJMX\[WW[]]XSNRUW[]`dgj{ЛЙБyrh_fke\Y]inoqpnnkaTZdggffehjopj[UXdlqolkkgilpmYUPZjtuqpqrrosttrpeQLMXilhhotsrrrqnje^SD>Nehihgbe]\aeggid_TE>?GLJLPVXTOW]_cee`]TE:6;Q]cefhhgfaUB19GNQOLIJJJLQTSJ;514?NVYZ[XURRRJ:1.3@JS_gkknnnomdQA=G[glje]PEBCA9CXfnonkljbWJ@ARagnv}Гv[JDKUYZRHHIGCJ┐                                                                                                                                                                k%  ├                                                                                                                                                                                                                                                                                                                 √ГГukjx{plluАЗrlqwzzytpjmx{А}|zxtplhecgny|zyyvz|whjpuussrrqnkb]ekhd`\ZQPWZXMMV]_[]^`^UNMPUWW[_egfwЛИГ{tibgjcZZckllnlnph]W]elmjieehmpjXP[gmpolillhkpjVPR]lttqqqqkiqtssocPIPZirlekprpoqqmif]OCAOekkkic_]Z^aefgf^RD@AHLIHPW_gYTX^beea]SD76O]fkomkd\VND?IYeq~КПБbOJJT`cXKEHIFIz                                                                                                                                                                I  █                                                                                                                                                                                                                                                                                                                   ╞ДЗБuahy|nfkt{uqqux{~}pmty~А||yrkhfddhqwwxzzАГjjnqrrusrqokb`bb`^YRRVZchePBM\a\\^\QLOTVVXY]cc`]cuИНЗ|pihf[V\eklklmmjaUX`hmmmhjiijjaRT`jmqqnmlljjncRRYfostsqnppllpsqk^ONVcjmgcfnoooqonieYG>BTcilmlfbc`ZX_fgg\L@9=ACFIPVTQ[aYW]bcbZM@77CHKOX`fihd\N<5G\bcccc``^[XSKC3/2=HOQQRSSSRONC5/4@BBHKMJHOX`c]Y]_UE<E\elmkbVLMOOJKgВЙИАti^GFQ\de[LIJHGHК                                                                                                                                                               И% p                                                                                                                                                                                                                                                                                                                      ╡ЗЙБskeovo`Zhs{xqmsyzxyyumswz}}|z{wqicbbdfms{БЕ~iilrssspojga[WUVTVY_a]cilhbUKSZ]\VONQUYYXZ]`ZRPR`uЕОНВxsi_XX^fmllopm`UV]elpqoihkli`ZU_hnrsvrrpmlmhWOW`lrussqqppupkmlfVRU`knligehlmppoli_NDALU]bijjifc^\ZY\`aVD:-0;HV_fgikihf]G;20JNLGFKV\c`TD;M^fjkfZNIJMLKVzЖЕБwfWOAHU^cdVGKIDDMц                                                                                                                                                              Ў+ √                                                                                                                                                                                                                                                                                                                      ыЖЙВ{oeltuhX_jqxxpnwyyxyyroqy|~{wofc`b_bemuxrghlqrlkkhda]VRSUV[bedYaiokd]RPW\YOMNRUXYW[_^VONTatГЛЛВwuf\WZ_fjhknoiZUWahorqpmgjnj]WXdkorrtqqponndVTZdnsussppnmppljh`RRXcmoljpiegknnnkh]OECP]_aeijkhfa\XVV_aRC:>FHIIKOODEUYVU\]ZVL@;?N[^]VNJJMRSJ=7AWfiiihhljhfbXK;-2;IWbfghkkhdWF:32A_ГЛqnpnnnnh\F7AFGDFKT`ei`SDAQekkh^RHFMSPO]zГykYMEDMZdeaQEFDDHV                                                                                                                                                             ы│Q М                                                                                                                                                                                                                                                                                                                        ЕКЗДq\gtyk^[\j{}sotxywvxwsorx|~}yskecb`\^afgedfhhihfca_ZTPQU\`fhgfY]hnnh`KPYZTKLQRWZ\YY``TMNWetБКОГuqbYW]chljnomdXX[dhmqpqmkilgYTXgnqrsuqpoooodRQ]fntursrrqprplif^NQZenplglgfghlmnlj\KCGM]ecaehihfd^[YPV\P?:@PMGGINPLLR\]WUVWSF<:CS_a_[WNKFDGD<9EYeiihhijjjgaWI7-4>KZehiikkh`QD849KfУиНpjppqpmfVA6BEGKNT^ijf\N?@WfkjdXKHKNNIG[osnk`RD@?O]bb\MEHFEKЮ                                                                                                                                                           э5)  #■                                                                                                                                                                                                                                                                                                                        вЗЙКxcdp{scYUdv~oirwutsvysnqx~А}ungcee`^__^^_^]\]]]\[XSQSZ\bcegee__gmojdTQUUQKORQUVWV]c]PKS]goКОЗtj^XX]dfhjnolbT[_ilnqssomkldUW\flnqrurqnnmh`UT_hotuqqssqopsohc[KQ\elpniheddgjkmifYKFIO\fcaafjhfb`\[WWVL?=EQUMJKQVEER[`_WRROD9=GWbfc_^\UKFD>28H\dghhhiijihaVE846AN]fjkmkjg_PA84=Szж║ЦvoqstplbQ>8ADJOWafmmg[K>F]hkh^WOQSOLJLU`ec^WND=FS`ebUFDDAEMё                                                                                                                                                           J,#  м                                                                                                                                                                                                                                                                                                                         сГЙК{mhiqxpVP[m{wmmutsqsupnsvy{}~|{wqkhimonkfd`\YZZ[[ZUUTWZ^_fmkiffe`_ckljdZVVRNMRRSUVYZ^^YPNVafk{ЙМБshXX]`cffhlniaW\chlmqqqlmnj`SYaknqrrusurooh]PVcmpsuqsttuqlstjaYLT^hmqolhhebfknnkeWKKN[`b^Z_chgfd_[XWTQF<=HQWTQOTYKFS^``ZTNLB8>IYbfedc_\OFB<6:I[cefhhihijgaTC739CR`ikknnjh_O@76C^Ъ─╔Яzmpqrnj]M=?GJS[dgimogXE=I^efb^[\ilbLCJR[\YWRLFDKYbb\NDCDBGj                                                                                                                                                           {($! -                                                                                                                                                                                                                                                                                                                          ■БИЙАtjhkvz]QYblwxplpqolottssuy}}}|ztmhlortpjjie_]```aeceeeegkmmjigfd^_gnkhaYQMLQVTUWYYZ^]RLP[cgkwДЗ}qhY[_adeegjlh\V]glmprpqnomf]RZdjopqrtsussqgYRXepsuvssqqsporslbXOVdmrtrlijkdbgmmjeULMS_ccd]Zaggged_XTNN@8?MV[WRPTWMKU]__[WOL?9>KZcefddcb\SH;8;DT\adgffhhig`PB419GUdklmnnkf\K>23Glп▌╓нpooqnfZJ;?IS]fjkmmofVDAO^dcbcl~ИБbGCLQUUQNKIHGQ]_]UHCAA@J╩                                                                                                                                                          ╤*Ы                                                                                                                                                                                                                                                                                                                           ХЗЙД}i_et{dXVYdr}tklnpkkqwqlnuy|}ytmlkrvwwstslbbhlnllkljihhlpokiiffd_bjkhcULLMSTUTWZ\^aVMMT^eeesvoe\`dcadefkje[U_jllnnpoopneYR[gnpqrsuttqpneVMXfosuvsuttsrqrtmcWNYemqtsmigjebflmh`SJNV_dcd`^^dggfeb^XSP@8?QY^YSOV_QIT\_`^ZTL@8AL\cfedefb^UH=:;BIQY_dfhgggf^L:.1=KZgkmmnnjfYG;18Qw┬Єц╢ЕvppsrgVG>DS_flonmnmcRFES`fcgwМЪФ^@>JMOQNHFHGKRZ^YOFDDFIP                                                                                                                                                          √6"°                                                                                                                                                                                                                                                                                                                          ▌ЕЙЕБo^]nzj`XV]orrolkmklnsvsmquz||{wnlgnwyxsv{pdforrqrrpnlkhkoomkiedb^`ff`ZTNOORTWUUXY[YSOOW^eihp{|slfcfgga`bbijbWValnnpqqoormcUS^hmnpqstttsrlaUQXfqsrrqsssqpnkpocUR\gptwuplgecbejkg^OKOYefc```_cefgec`]WO>9DR]_ZSQTYRLRZ_a`]UL?:ALVbddedee^WG:6>CEHMS\bdeeb`YI406BP^hlnmlljeXD:5>W}═°ъ╗Йyu|~}lTI?I\ejnnnoom_OCI[gluБСЪФЛuR=ALPRPJEDCEJTZ\VLEEDCIР                                                                                                                                                          V O                                                                                                                                                                                                                                                                                                                          №ВЖЖГqcaeuui]WXapsqmnnknmrvwnhmvyzzxqnipw|~xwxqggpvuturqnlljlpppmihhb\\b_ZTNMORRSVWXZ\`XOMRY^gghoxwojhghhfcceefd^Y^fkmmnnonmol`UV]gpqsststssqi]TT]ekrrrrsstttskjh_SO]hoqqrpmigd`agkf\NMS\hif`^\X`dhhfda^VM@>FV`_ZRQUZVIOZ_db^WI??DJN]ddfgdc_WD;HOOLGFFHNPW[YP>14>IV_jmjjjge]N=:I^А┼·Ў╘г~dihcZOEH]imqqppoj_MDOj{ЛНЛЙЕp^LACPVWMB>>@@HQROKGDEBEL─                                                                                                                                                        ▓,о                                                                                                                                                                                                                                                                                                                           √|ГДАyl_iw|mcaahmtxsjijinsutolhhnstqngluyxvx{uhirxzxzxuqoninppponmieb\POV`b`]XXWUVY\[VJLT[^bgknrrsx|xwohhhhfifa^\cjnnnpprqqlbYV]fhjnqrropqrnaQR`ffelrrssrrpppnjaWRVdlprqponlhb_^__^UINXcgigfb__]]bfiged[J<=FRYYVSRSWYYXRPY^ZPE?CJLLLNV_eeb]QDBIV_d`[WUOKFNSTI;6;JPU\ddbac_YQD7:AL^y┼·ў╫Ъ{fkmhYMGLblprqpmkeZFBSlААА}yrk]QE=CTZQHB?ABAIQQMHDEFCEO¤                                                                                                                                                       ╜.#  W                                                                                                                                                                                                                                                                                                                             ЗЖЖБ{oajswwmb`gkox{rhffktwspnnhgjopoklsxxxz}wffqyzxyxtpnnjnrqrsoje`\UMR]dgd^XWUVX[\VOMSX[_djnprv{А}|zqhhjklke^[^illmnonqooh`WU`hijlpsspsqpl\VS^iomkqrsrrspponi_TRVblprqnnnmiec_ZZ\UNR\ehihf`\[WW_ceffcZK=HSRHCBBDB@KRMGDDEFEHК                                                                                                                                                       ╕-$ ·                                                                                                                                                                                                                                                                                                                             ═ВЖДБuggow|weYaemyytjddiqwwspnieehmkjlquwy|Бzggrz{z{ywtpqimrrsplf_YVQLRbkjg_VWTVY\YROLTVZ_ejmmnqyЙСАzqjjlookb^^bllnnnoqrnme\VXdnpkhmprpsrqiYWZ_hppmnpqpppmnnmf[RNS`jpsrponljfefc[VNLS^fklkfc`aYSY_ececZK?@DEKQTTSSNLNNRWWURMFEKWYSMIINW`bZM?BQ\beedcd`^[XVP@78AIIHJMMNOMMNH?8CIHGFKMIDACGFGLщ                                                                                                                                                      И,$  ╝                                                                                                                                                                                                                                                                                                                              ·|ВБ}rhkv||m^^djrvuphbemsywtoieddgihjnty{АД~ifs{zyzzxtpqjnqrroi_\WQNMXfjmi_VVTW\\XMLSXY[_dhjkklyМЛВ~qmklqmf`_`fjnmonopnklbZXXclpompptqqqogWY]ekominoqqqqppoqfYSTY^ekqpnnlmkifegaVNLS_fiiigfb`[XY]befcZLCEGILLOTTRMIJJLV[VQJDHMX_\TOKLQRXUHAFT_dgfeddeda\YP>4BCCDHMPKGGHFBA?@EGG[                                                                                                                                                   ═F(" K                                                                                                                                                                                                                                                                                                                                 √yБЖВЗvlnty}zaROQ\fqyod_agmrxzvqkfa``djpzЕКБojr{}}{zwqokdhgb^ZUQXbhllebfjha[XXYVPIIOUWWX[_gc\WYh{ОЩТwqmkf_[[_ejllonomnmf_\^dgglnnllonqpl_U]homnmmjknqqpoonl]TR[febglmnnmmkjjgd]RMQ[dikkiiige\XUPU_^^SIHNUSGIOUVTCHV\\ZURNIHMV^_`__]XOLKIDISZdgihghkieb^ZM6>@DGJж                                                                                                                                                 ╙N'  ╔                                                                                                                                                                                                                                                                                                                                  К|}Б{snpvzБn`\[^acqxk^]^ensuwwvmfb__acgt~zporuxwwwrplhcb`\[\]]diopreYclhb\ZZWRLJNSXZYY\^b_UPWj{РЬФВytrnd_]]_bhmnnmnookc[[`fjijnonmpnqog[Wajnnnoqhhmppnqrmj[TVZejiegjmnmmkkkhg\OLR[fhjkggghe`ZTQOW\ZRKKR[[ILQUWVKJW\^]WRJEIPX]``]__\VURJFHQ]egihihjfc`\UJ9?FNW_dfheeebZJ=7;DR^k}НЪ╕╔╝ШМЖjMJt┐чэу╨╕ЩЗr_I?ARahjmnnnj`J?>@?DLU[SHEGFB@==BEIL№                                                                                                                                               ╤O,%                                                                                                                                                                                                                                                                                                                                   ╬{АБ{wqnrwwokea``ajtuja^`ghkptuuke`\\[_ekljmnrsromjgd`[[\[[bdeimrtwh\`gh`ZYYSMKLQUWVVY\^]WST\m{ОШТВxpoje^Z\]`hmonnoomga[[ahhhlqsjhlmpndWZelnnlnqkeinonpqpi\TX^dhjffimnmmllkhe\QNS\giljgijifb^VONPUVPKPV][QQUVVRJLW]^\[VGEIPX]_a``ac`\TKFGLV]bfhihifb^ZSE8AIQYcfhihhg`WG>6>IZoИЦл╜╚┴лФБfJKu╕╚╚┤Т}re\NFAHYfkmorrpg]E@BCDHV^[OEDFB?>?@EHKМ                                                                                                                                              ╘I)$#!H                                                                                                                                                                                                                                                                                                                                   √x~ВА{qmpsvupjfhghjnsti]_bdcgmptojfc_]^babbegifeda_^\XVW[`ekkmonptxncabd_[ZZQLIMWXZXXZ]a[SOT`o{ЛУНГ}wukca]\^_emnmolnng`\]bhkjjnurklopk`VZfmnnlkljfgmpqrsrk[U\bgge_bgmmnlmnnidWMLPZdijfeghifb^WOMLSRLLQY][UQTXZVHKW]^^^YFEFIOZ^bedcdb]SKHGEHV]dffhifa[WNB8BMV]dfiiihhaTC:9DRhГЪ│╟█цф▐╠г|]FLj{ЙpigcZRF@BM]jlnpqrogWBADCEQ`aXMFFF@=>?BFHMЇ                                                                                                                                            ╤G&z                                                                                                                                                                                                                                                                                                                                    Л{ВГААrjkptzxiejlkkorvoc\_bbdgihjigfb[aaa`]\]__]]\YZYWZ\bjpqnprrsvxqgbcc_]ZTMKORVVXXXZ]cWNNZfp{ИФРЗ~vqhba`_^^bimmoopme_]`ehlliimlkjmmg^Y^hqqpnnoiegkooqqqgWW^eihhc`djmokkmkj`VONSW_fihhiiigebYQMKQTPNT]`\WPSY]WGP\``_`VEFJMLS[deddedaPFFHFEJSZ_cffd`[ULAK_hgb[XXWUSCEMXelnmopni]KBFKT^be]NFED><;?BEHK▄                                                                                                                                         Ё`(#╝                                                                                                                                                                                                                                                                                                                                    №{АВwuvunktyywrlkuttuutnia_^^abfbcacdcimnniabhkjlnjheeelrsuvsssstrwup`X\[VPMKLQRWTVVXZ][KMXfoptВКНКБulgeghe_bdgknqrvja^^dhikmijmrleif^WYekoppqmjihefjnoql^TYfjjfddfehkjhikkm_SSQSVV`ghjihiggec\SOSRMMV^_]VST[[UNRZ^_^\SFILLJKPUZ_bcaWKGKQQOLJJMQX^__ZPD>BPU]cehmБКЕ{gL96:P|┤Ї√їёф╨▒ШЗpVGAShieZXVV[[SDGR]gmnnnonfVFBIQZaedXNFD@97:;@FIh                                                                                                                                        ■З*" !" ! ─                                                                                                                                                                                                                                                                                                                                     Ф|}{zzxplqwy{wqnqtvvttpib_[]_aedcffegkoqttibmqrssuqojhosyyyvuvtrqtvraY\\VNMLQSVYVXX[ZZSJR`hmntЗОНБrkgilnjcddeimnopc`^`egiknljiorlje[X\fnppnokheefejlnmh]Y]gkjiedb[ciigjljm[RRVXWS[dgijiigegc_YVSNMPX`_\QNSY]\TPX^^^ZQILQQOKMPRY_c`UHJOTYWQLIFCFOV\YL>>FMS]cedjВОАr`G44@TiЗи╚пЭЩЩУИuMEFYqqcUW]ccZPFLU_iomnnmg^PFGNY`dfdSJFD?7:DMW^gifh|╡ущ┼|PHLXaeeeijg`RDES^ejmkgbZPJCGS^fihbTFFHD?@CGJKU                                                                                                                                    ■t.# $! #"$)%$" !v                                                                                                                                                                                                                                                                                                                                      юx{zvtwxqmrv{}Бqgnutoi`^be`[WVVWWUZcotw|zifqxtqponllopvyyxwxvrqomhb[VOLORUVUUUTUUUSOMT_ilolnqu{yvqprpmlllkjgfdgmrf\^fikjjljjllhjog\W]eklonnpnnhghgfhndZW\dlmkjkgdb`^cfhjgaVVZ^^\XSV\`eggeghfa`_QMJINZZSRRRMILNNV[XZSKNU\__^XRJCEMOIKPW^bgfgcab\YWTI@CIKJKNRUVUQPPME=?CILRY\[XYrи▀я╩wTNR\fjihihd\HBHVagkjfaXPIB?HXagge]RIIHEAADEGIз                                                                                                                                   єM-!#$ $%')*)($!b                                                                                                                                                                                                                                                                                                                                       Бz{xvy}jhnuxw{tlkqrplc\_bb^\[[]\VR`qvy}|lnsЖХЦХУРЛЖА{xvsrppppllhe_VQPQRSUWWUUUUUTQLOWclnpopquxwtqputoolnmiffefkia]_dhjhilmkjjikkdZY^hpqsqnopoklkje^c`[Y]fmpkkjgda`]^bhhg_PU[_``[VTV^bdggcdfca]NKGEMRSQQROJINPNTbd[TKPV\__^^XOJKORJHNX_befebaa_]VRD=DJLKGFGFHHHJLKB6;EIHIMNPNUlЫ╪ё┴nRQU_gkhihhcVIDNYdhjibWQLEAAKYdghf[KDJJHDCDFIK№                                                                                                                                  ╙<+#"'"#())')'$J                                                                                                                                                                                                                                                                                                                                       ┐y~ytyslltzwsrsomnpoe`bfee`^\`dhdeqx{БАnluБРЭзо╡╕▓░нжЮУЛДzwmhb]WSSVVTRUVWVVWYXRLLR\fjnooqoqsrrry|wrpnmmjedelnj^Z`ehihjkmliinnh`Y\bhlnpmmlnnnllllfa\XZ`glknljh`\_\]_eif]TV]cda_YWUW_edbceec`ZLKHFGKMLPRNHERXUQWb]QKPV^a_[]]WRRPMHJQX]_dffdddb_YQHAEJJJGCDCBCAEJH@8;DJJHIIJKUjТ╨я║iRT[bhkihhi_PEFP\dgiaXOHDA;BN[bfeaVIJKOLHEHIHН                                                                                                                                  Ц2'! ! !')*(%)'$!0                                                                                                                                                                                                                                                                                                                                       ∙vЕ~jmwtmmtyuttqnoorkcchmjf_\_`cfjqwДБocafmxГРЫлп╖├╚╚├╛▓дФЕrf_Y^flhaYWWVWUUVUTPJJT^gmoqqoooqqru}}|tnlllljefnme^^chliijjjijjklg^X\ekomnnnnmnljggiid[YZaikkkllkf`_\^_dfdYNW_acb`[XUTYcccefdc_YLJIEDDFJQQOJKWZZVQVXNKRY__`^_^[XWVQLKNV\_dcbddbc^[PCBINMSWVQMJGFHJG?4AHIEDGKORZlО╛╔пeQV]dighihf[HEIT]cd`WNGCCB>FR]bca^QEIORNFCHJL№                                                                                                                                 }0%!!$)*)'($".                                                                                                                                                                                                                                                                                                                                        ИzА}omxxninutvupklnpnjdhpnhb]]^^blrzБЙЖpe[\aflmuМЮйм│║╜║▓йЦra[XlВЖИkZXXXZXYXUSONMT`gknpnnlnoorАИДАzpljmnlhihfc]_ejlkjkmlikkmld[W[cklnllmmnnljieekbYZ^dimljlkkeca^\[`e`WSZ_cccb[VSUZ_abdcd`]WOKJHDBELSRKHMY]]ZVVSMLRW]_bb`^][[WPJIFLV[^`bab`a]XKDDKQRY[ZZWURNMMF@:DHLRTVWY[`kЖ┤╙Ф\RX^ehgfhgcXDFKV]_]VNEEHEA@IT^_a^UHDIOQJCDJKЛ                                                                                                                                 z3%!#"'))(%%")                                                                                                                                                                                                                                                                                                                                        уz}zsryxnhoxtkptpklnpoigkqoeca][]hrzВЗЖrfhopoolopwАЕЕЖМТЧЦСДfYUXhЖШДlZUUVVUWXTNLNNU_gnrqqommljoЕОЕАzsnjllkkllfb^dilljjlkiijjkic[Y\aimmlkmomlllkihg^WZ^dknllkkjihe_\WY`^WU\ddfff_WTUW[_adcc_]VOOQKC?IPSPKHR[]]\YVPKLQW^_`__^]\\UNJFDEHQW]baa``]VFAGNSU[__aa\[TSMF:8FIPTZ^_a_ci{ИЕvPRY_fgeccc`P@ERW[YTKEEIHEACKV[^\VNHGLQPIBDJJЇ                                                                                                                                z4&!! $&))#!(√                                                                                                                                                                                                                                                                                                                                        |{zpv{vllttfiuxnalqpifltzokf\XZ`iq{{wlhotwuurrsturqoswwqe]WPVdotsh[TUUVVVUPMMPSZahmppooljgejzНСНДyqmnlmmmia_]bhlljkkljghkoh^Z]_adjklklnnlljihfd]Z]_fknkkkjkhfb_^ZX\YSU[cffecbZTSTV[_bcb`\TQRTSJEJTVSLLU\]]\YVOJKMSZ]^]]\][[ULIHDCBGQX_`^__]P@?HPSX]_`ab`^[UMC;=HKTX^cdc`bbmy{aKPX^bdb`^^XLBFSXWQHDGFIKIDGQX\[VOGBJNPJGEIKА                                                                                                                                Л7( "$'))# #√                                                                                                                                                                                                                                                                                                                                        ┐y|}vjw{ulkqljowuleooiekswtpkc][^`fmtxqmkwyxywvpnmmnngghhe_XWWX_bbf`YWTUWUWSOKKRX]cimppoolgcagvОЭЪМАxjnnopoj_]]ejnnjjkjihhjld]\]aacikmmnnlikkjifcWV\afjmmklmlkhd`\]^^ZTU\beedcd^WSOIU^`aaaZPOVZVMKMSXUNOZ]\\^\WOKJKOV[_]]]^\ZPHILLFBAELSZ\]]VNDAIOT[_`_`bb^ZRJ@99>EMSYZWIADKPS[aa``bb^VMD;8?JNV[``__`_\[[VMMPTZ_`_[ZWLABLMHEDCITXUJEGLWZYTLHEHJJIFHJKv                                                                                                                               Ё?,! $$'''(%!ё                                                                                                                                                                                                                                                                                                                                         лy}xquzzpjnpoknrurgeimkmvwwvspke`\]]^befknonlid]YXYZXWXY`eknrtrpjhaZWVUVSOMLMPTX^bimoqlk_ZV]jyМезШМАpomomifcb`cfkjgijhedhjj`\Z_gfbdikikkkikiigf]VVX\bihiiiiihfdb^\[ZWTW\`bafeea^WNHMTX]_`WRTZ]VRQS[`[ST[]^`_]SOMLKLNOU[]]][UPMPVYYRJB?CFKRUQIDHKMS[__^^`b]RJA:;AHMW]^_^^__\XSIFSXXZ^`^[XTH??FFDACIQXZTJDIMTWSMFBBIJIFDFHKш                                                                                                                              ■V0$!#%#!#$я                                                                                                                                                                                                                                                                                                                                         °t|Бwsvzsklsqhhqupifgiikrvwxwvtqnjc`^^^[[^_``_ZXUSTUW^bdfkikospnid_YWVVUQLKNRRUX]`hmnmidZVW_mwЖЬдЭСЕwrosnidbddeffigjjhgfimm]\\agjgegiijkkhiihhbVVY[Z`ghhhiiifffc][ZXSSZ_``acdcc^XOLGMU\]]PQVXXSTXX``ZTTZ]_`_[RPROMMMNOV\]]ZSPNRY[]YTOFBAGQYPDEJQQU\_]\^`^ZSH>:=DJQY]^_`_]\ZTKDMTVY\_ba^ZQFBCGFBDIQUYZSHGLPTSME@AHKHFDDFFr                                                                                                                               Д5&  !"$&% я                                                                                                                                                                                                                                                                                                                                          ХvАБupsztjnnifltspjgeddouxyywuuvrnigd]Z[[YZ[\\[XUTW^ejmppminrqrmd\YZYXUQLINQSWY[\fjmmgaSQXdowДТЫаЫНxppmhddddhefggjhgffkniZ[^bfgfdghhiiifgihe_YWY^^`gghhhjjhhed_]ZTSRW^aa_adda]WQKFENX[YTRTXWUXXV_e\NQY\\]^[SRTTPLKKLRW\[VQOQTZ]]]ZUPKFKRYH?FNPQW\^^^]^^YTI<9?GJPWZ]\]]][YRHFYtsd\^ab_XOFABFGINSVYZVOKILRTQIB@BGJJD@CDDц                                                                                                                              р<) ! "#!$$"!ў                                                                                                                                                                                                                                                                                                                                          ·t{В|qpw{pkihhjpvskdccdiqwyzyyyxwqnnj[V\a_\_bcbeefhgntrsqpmmrsqnf\WWZZTPMQTTUVVWT]gjfaWMPZfou~МЪзбХЖ}oojgedeecbcggihhffimi\\`dgif_cfghigegijf[RW\^]_ffdhhhgffcc`_ZTOQUZ`_`dcba_[VOGEHOVSPQTUTRVXTW^\SNT\^_\WQTUXXWSKKOQWYXORRV[^^\\[YUQPSXD>GOQQTY]]]]]\UQF99AJOTZ\^^\\]\WPBFlyvk`^`a`WK?ADIOPTW[]ZVLEIOQNKE@@CHJFBACDh                                                                                                                               N-   !" !√                                                                                                                                                                                                                                                                                                                                           ▓z~xqqrwsmkhhgnqrkeaaadovzyxxyzyuqp~h_gmrpnnonjlmmnrwwuonnptutog\VTUSKJMQTVVUVUUXafaZSNU_imsyГШнмШЛДvpkhfggfjfcceghgfgkjbW^afgkmdacfgggehihc[VUZ^][_fgggfdebbc_^XROOQ]`a_cbbb`]YTKIKNSRRRVTTVXUMQRSRKMW\^YSQVX[\ZSHKNNSVTOSTX\^`\]][XVVVTAAHNLLRV\]\\]]TNC:=CGMTYZ^^][]]XQIKqУЛreaiecVHDFIOSWX[[\[RJHKOOIEA>@HIDBCCEFц                                                                                                                              е1$   "¤                                                                                                                                                                                                                                                                                                                                           ■z~~uortrqnlf`hqqnhcZ]_hrxzz{{|zwsr|ibjuwwwwxwtroljryzwpnjiorsoj\TSSQKILNSUWVUTUX\^[VLPZfjmou~ОенаТЕxpkieecbggedcfhghjlf^Y]cedfkiecceeggiiiaXWY[^a_[`eegggedec`\VPPLOX^^_`aba`][SLJJMRQRTWUUVVRJGLMKJTTY\YSQVZ]^[VNIJKOPPOUVY^_^Z]__][[VQCDILKHHNQUWY[YOI<8>BHNUZZ[]^\\\THAX}СЛyify}kUEBILTY[\\\[WOIFIJJDA>=;<>AGC@@CEGц                                                                                                                              Д*  #                                                                                                                                                                                                                                                                                                                                              Аz~yjktvmda]^mnlljd`X^iuzyzz}{ywtwidmw{y{}}wxsvmmswxqnnnklookZSQPNNSSTTUUUVWUTQSQMMXcjmlootАФениЛuoiiggfehlfbceffgihd]Z_ffbdgjf__`badgig^Y[]][[[Z]`bddcccdb_YRNMMNTX[\]]\]]`^YUSSSRPSRPTZ\TLHLSUVTX[XXUTWX\[\]\YWRQRRQNTV\^^`__`_]\YULEKONLHG@A@BHILGA99CHJPVWUXYYZYTLHNvбвХАofthYLHKQW\[\\^^[OLMNICCB@?ADDA@DGGn                                                                                                                              ў5" +                                                                                                                                                                                                                                                                                                                                              сwyvmjjqtk^XZgkmmkgdY^iotuxxz|zxw~mfmw{z}{}|wuroilsutqnmojklliVRPNOPUTTSSTUWXWVURLGQagmmlnjq|Ка╡дЖsjijiifegmmd`bceeffa[Z^bdddeig`Z]__bfgc]Z[\\Z\\YW\_b`aaaaa_WQOMLMOUY\[\[]^_^[WVTSPPQRUXZYQHHOVXUMLTWUSTX]^]]][XZXURRQPUW]]^__ba`^\[UDBHLORRMIFA>?HGC<6;DJKLMPTUSOORKFFVЕ▒мЦwb_XVOGFOUZ]^]]^_ZNFHJICBDDBABBAEHIFEDDEGGFFEEH]П╜┤Уt_XXSJFJQX\`b`^__YMIMLHCEIEECCA>>BGs                                                                                                                              №6$  j                                                                                                                                                                                                                                                                                                                                               °v}|mbfori\Z_fmurmkebadltvy{zxvyshlv|{||}|zxwrnljowwwpkga`^ZRONPSTWVVTSTVYW\[SMIM]glmmlmkos{ЗМДrorrrpnhecdddabdfee``\\^abcaaacba_\]adc^YZY[[YXX\ZTX_ba__b`\XTTROMFHMSXZ[YXY^\\\[WQPOT^d^TMLQX\[ZVSPONPU]]__^_^^^]\VQMKJJOY_abcc`]ZUNEGLPUZ[[Z[ZWQLHA76?GGD??<=>?@ACAAIcЦ─╝ЫycXWPIFKU[_ab___]TGFKLJKMJIEBA>>$   ┴                                                                                                                                                                                                                                                                                                                                                 В{ug_^dijc[^goqrnhdb`adpuwyz|Г}pjqw{}||{{ywsnlikrtqmg]ZVROPRRSSTVVUTTVVTRTRMJITdkmmnnnkljnsvrjoyЗЙ|qihgdcgh_^bdd_`[]^`a__`^^bc`\[^_^[WZ[[ZYXYWWUVXYYW\`\XWXVWUOLGFNUY[YZ\^]_][VSTV^c`WGISY\[]]]ZZVTTUUX^__bbbc_ZTPOLJEBHNWacc_[UMJJOOSY^a_ab^YVKC=;?EGJRTRQRTSRLHBDNiЬ╟┼мЕg]QHIKRZ_bc_^^\UKHJOQSQKHGGC>;BHHъ                                                                                                                              ╞-   э                                                                                                                                                                                                                                                                                                                                                 чzwne]botcZ[alsvrnjeb_`fmquz|ГЗАnbjsz{}{zzzzwrnifjqlh_WQLLQRSSSVXZVVUWXWVQRLJHGPbhlooonlkkknpljvГЛОЛ~fecb`bg`^_bd_\[]\\\^``^\]aa\[[^][WZ[[ZYWXWWWQQWXY[^\VUVWXVSKECGSWYYY\^Z\^\WVYbkjaVMRW[\]__^ZYTQQRSW]`cccccaZRPSRNJEEHP[cb^\WJFJPSU\`baa__[UL>;>BGHLU\ZYZ]^YQHCGSkЭ┬┬оЗdZNHILV\bdd`]ZWPGDKSWYSJEDCB>=AEu                                                                                                                               W$   ■                                                                                                                                                                                                                                                                                                                                                  Шzui_^cond_ahqutppke^[`dkr{БОТГo_boy{{zyzzxsppmhghf_[VSTSVUUUWXXYWUUUWVVSPLJIHN^fhjlolikkkkieezРЧЦЧКoigc`bccdccb]\[\ZZ[\_^ZZZ^]Y[^^\ZVXXYZYWXUSURPPVY\\YWUUWXXVRJHFLRWWV\`][\YWYalkhcVMTX[__^^`][WSQONU\`cddddaWOSW]\VOFAFLW]][VFFMRTX]bd`baa]UM@;@EIJS\^\]\^_[REDJVnЮ┬╟▓ЖbXNGJPV_cca^ZUOJGINW\[RGGHB@?@DJэ                                                                                                                              Ї0   >                                                                                                                                                                                                                                                                                                                                                   ¤}|p`\^doka]fqtrrqpi^Y[_dku~ДИЕp]]jvz{{zyzurpnlhc_[YVUVWXZYWWXXWXWWVVVTQQMKMPQQWbfhjklihhhge`b{Ып░вТynhdaadgeedb_]\^\\\[[\YWY^_YX^_\XWWXVYZZWUQPRRSUX[ZWUVWXZXWTNJIJNV[\^^[\[YX^knkfc[SVZ]^^^^^]XSPMKNT[^cefhe_VRV[a`[SJA;ENUZXSEHMOSY^aa_cd^[RI<;CHNPZ^_^\^_`[ODAKUrа╜┼╡ЕbVJHKR[`bb_ZULHFJMTY\ZMEIHD??IMw                                                                                                                               Ъ(  Й                                                                                                                                                                                                                                                                                                                                                    ╦zuh]Y\iumabnrssrrm_Z[\^bjr|Аq_[grwzywwxvrole`\XTRUY\^^^[XWXVXWWTTUTTQPMLRWVTV\ejkmkjhggfbX_}й╘▌┼ЬИ{nea]agfeb`]\[[[\[[YZ[WW[`b\[][USUWWWYXVWTSQRQSV[ZUTUVXYXZVNKJJLSZ\^^]]ZX]fsolkcYOV\]``^^^YUQSRLMQV\_ceed^VRY\edeb[PCBHNRRKDMQSU[_`dbfd]WPE=?ELOR[_`^_`^]WMEEKXtб╛╟┤Д_QGINV[__^\SIFEDJPU\^VFDIFB@?FJя                                                                                                                               C   ╤                                                                                                                                                                                                                                                                                                                                                     ЕtpdTVemlhehpsvtrpd[[^_\^cluskd`cnsvwuuqokga^YUQPT]`aab`]XXXWZXVUVVW[TLKJR[_SOXbiknlkjjid]W`н╤чр╗ЮИsha]^ege`^ZX[\\YVWVVWTVV_fd^]\VTTUVWXYVVTTSPMNV\ZVTVWXYX[\VOLHJRW[\]\\WW_jpbWY_YMPZ]_a_^^[UTTXWLHRX]`dfaYSU\_eaec_VKFCKONHHQSTW]`ccaaa\ULD8@IMPV]ba_```^TLDHPZvв║─│[NHLRX]^ZYULBBCINSX[XQHGHD?>EKГ                                                                                                                               я%   "№                                                                                                                                                                                                                                                                                                                                                     ЇttjXT`hlonilosppniaZ]^[WZ]_baddbgkkjjieda]ZWTQSXchkjfea]YYWWWWWUTUUVNJJLO\cYOW]ejlijfcb][ZdyЦ┬фЄ▄╝ЧГre_`dedb]ZWXXWWUVVWWUUXZ`db][VUUVWWWZYWWVSRQMT\\WXZZZZ\]\YSMEFKT[[^^^ZWajdZVWUPOSW]`aa`^ZVTX[\VGMUZ_`a^XSV^dgggfd_ZVOOOLDGPRW[_cbdec_YQHA?As                                                                                                                                  m        p                                                                                                                                                                                                                                                                                                                                                               сtl`Xajnida_[djjigejmptzwbaikffinuvsssspomje`chkhaYVWXYXUQLJMUVSV\`bb[UW]aXOLGHO[^`a```aackxМж╤щ█аqpwxthffd[X[[[\]\^adc`][UROOSX[[][]]__]ZZ][UMIOZ_`aabbccedelz~na]XVUZ_cfffghfeaZRQQSVY]bgiihiige^YWVOKIPT`fgggb^XQKMQTQZ`deca_YSJDB@HLJIEECEHIHHKLIHGDELYtОХФБdVTV[]_^___XPKMMJDBDEFE@:=╩                                                                                                                                   д         ║                                                                                                                                                                                                                                                                                                                                                                    дqh^agieZ[_abceedeoz~|{mhlllkghkprstppnnifb`aa]YWVSSRRSSUWZbi\RUY``_[TRLIDGKT]^`ab`^``^Z]cflljbhЮсЇЄ┌зМБwka```__bedc`_^_[UQOPTZ_`^]__]ZZ[^ZUPKGIW^ejjfsЭ█єъ═Фvc[SMOX_figijmjhhfb]WYWPNU`hiijhe_VV]^ddb\SFFFHMSRONQTWZ_dfhihfbXLIHJLLMTZ_`]^^_ZSOLMQUW\`lАБr_UUV\\_^_^ZWROMKKIEAFJHA9:J                                                                                                                                     ■&       (■                                                                                                                                                                                                                                                                                                                                                                         ~oicdljeaab]Y[_hr}ЗК~mmpnkkibensrpmmjfdd`^XVRQSVZYYXY]ccY\fh[PUZXRKIGJUZRJMV]`^\[\YYWWY\]YVVe~Ф─°  ■∙т╕ЛБkhfgifd``ccca`^ZSMNSWY\_a`^_`_bbc`]TZhДЮ╩єЎ┌Фwofb__ef^OEAFUbijjjjid^[[^`[UKFIPZa_\[\_fhijkkheeaXQPQPRSSU\cdefhe\QJFGJMQRV]accdb`]TOOQVZ]]blsj]VRTZ]^^]YUMEEKOQSRMKOH@<<╧                                                                                                                                     Ї#     ╪                                                                                                                                                                                                                                                                                                                                                                          яjklgfeadeda\XWY_hwГtttqnjd`flprojfb^[Z[XWWTUVVYZ[[\^`c_]ch`VUWYNIHHMTVQMLOW]^][ZXWWVZ_^XVW`oВЭ╤°  ■°сиЩЗukiieb`adccbc__TNMOU\]_dd```deffea[lГз╘Ёх┴Нxofcb`eghdVN>@N\ehklkie][[_dd^WIBIOW][[]_fgijonhge`]XTQRSPNPU]`ddfcXMIHILOSWY^accca_WPORUW\^^elmbYWTVZ^\YVQOHEHMRTRNIJIC=9A°                                                                                                                                      ╬!       .                                                                                                                                                                                                                                                                                                                                                                              }khggc^^afhfdc^[\\^`cedca_]^_`]XVTSSVW]\ZYXWVW^ba``]]``___]ZVPKJQY]SMSZXMJTWYUSQQPSUYXSNU]]_jtАЦ╔·   №тнСsfecbcfdebbded^YQKPT]beeabdhgffirЖ╕рт╘ЬАomghfbaahjkih_LECHWehjie`^\_dhigg`[MLSYXY^cgjlnmmhhbYWURTTRNHCHKOTWYXPJJJLMMPW^cggcdbZTNQSW]_]_dc[VSQUbhl_[WPJCGMRTRKIHF@>>└                                                                                                                                       ╞       ъ                                                                                                                                                                                                                                                                                                                                                                              Їijlfa][_fhddeb]XWZVUVVWRTUWURTSQPQRZ\]]\[YYYX^efca_]\`a]\][UQKNV^d\OOZ\RJLRSSPOOOPUXUPNSYZ[cozДПкы■ ■Є╩Чuhfccfffeeeddd`_ULMOY`dcadeeghjuП╖╤╠╕ХЕmgihfb`bbhkllieXKDFO]dgfd_^^afhhghfdUSUYYZ]chkkllkhb]WXUTUTRMMMHGGHLNNLIKKKMNV]_bffde`ZTRUW\^^]_edXQRSXfvvg]XPHHOOQNKEFC@;;n                                                                                                                                        ▓        У                                                                                                                                                                                                                                                                                                                                                                                ╜mjb^[Y]chefihg[Y^gaYXWUPRQPQQRUTV\^_c`\[ZZY\beb_`a_\_^\XXTRMKO[cd\RSVWRLIKMNNOONRSSNKMQWWW[fqwАНв█Ў√ў╘Шsiorsmigigfeddc_WPLMV_eeccccemzЧ╗┼нЩМЕva_hhfedegmnnmjfcXF@HP]fe``^^bgkjiijf\\ZZYY]dfjjkjkfa]XVVYVVSVYXPHDCCDEHILKMPSZ]`bddaa\WRQTX\]]^bb\ROQRY^gd_[UNIFLNMKFCEA<9B√                                                                                                                                        ║"      W                                                                                                                                                                                                                                                                                                                                                                                  ДfdbZUYafdfjhe`\gtoe`___][YXX]]^^__aba^\YXU^adc_^ba]YZXVTSMKJO[bbYOMRXVOKKKLOOPMMNMLKLOTWVV`jr{БЕТ┤╪╪┴Мpn|}xrmjjihhhifc]UQRZ_bcccecfб║┴вЖyrlg_]cghfefikkmnmigcRCCHR``__^_ehiiijhjd`]YVVW]afjjjid^YWUUWWWU[b`c\SMC@DIJKLLMNV[`cedb_YUQQTX^\Z]_\WTQKGJPUVWWROLJPQPIDCD@9=═                                                                                                                                         ╨#     ,■                                                                                                                                                                                                                                                                                                                                                                                  №jjf[UW]efihfea_hywnfbd````]Xaccdcdddbaa`^WY`caa___\YWVUQPNOLOU\ZWRMKPYVKJJKNRQNRPMKLQQQRTWZagptvw~ИЛГxmsИСРЙАtmijggfgfc]WX^cb`bfgpВЯ▓кСДwlg^Z\^afgfcejmmkkmljeZOEBLV]^_`djllkkmmlhe_[VPQV^cikjgd_[ZYXZXWX^cda]XTMFEKLMLKJGHMTY\[YWVSROQRSRV[]YTRMFDHOVWWTPLLNMQOGBAB>??=<<╒                                                                                                                                            2      М                                                                                                                                                                                                                                                                                                                                                                                        ufa]X\]aee`]ZYfГЛ{fdfdeb`ZZ]`acfdc``__]ZZX_`bca`ZWSNKJMVYXQQQTOMKJLPRPLHDHKMHFGJLMPSSRRTTQXdjkkihkeWWtа╞ц╤╣зЬУЕztpllnnkgdgknyСУК}pjdejjkkhkfceed_aeghjkiljhgffb]\]``cdiihhhhlkihda\[ZSKKNVbha[[\\ZVVU\agjkjig_WMKNQNMMQOLGDDBDIOVUNIEDDJTVTOMJIRWZ^_]VROMKGC@<::<=Н                                                                                                                                             c"    _                                                                                                                                                                                                                                                                                                                                                                                         ёig`ZYW_`d_[ZXdАПАlgegfc`\Y[_aeffgcbaa^\YSZ^``_\WUQKJLRVYYUPOOLMLKFDMSRIFHLKEDHLPOSTTSQRRTU\cgdaca\WXdБЦ├╨╟║мШСЖ{rmnmolgflsyЛЕ|tmeaeghjlkkkgfge_^begijihihhggffcaba`_`fjlliiikkie`]_]WOGGQ^d\VX\\ZVVW]dgijhfd_TMKQRQORV_a`[WTMMRVURPOMKORRNMNKMUX\_`\SRQOIB@<98:=j                                                                                                                                              │%    _                                                                                                                                                                                                                                                                                                                                                                                           ╝lcZWSX]^\[XYd|СНwggffeaa_Z^_eefdbbbb_^]WTX]^][URMLLMPSW_\SMNKLLLIDGSWOIIID@DJORRSUVXVRRTSW^cb`c_\YZdm~Т╣╚╦├маЪУК}vuvkhhowВ}yndbbcgiikkkjigjid^[_dgkjighiihhfgieea]Y[^ehijkkihhd_``dc_ULJVXUV[]\ZXUX^ehiljfbZRMORRQQW_cccdd]UQSTVX[[]ZTSQQOIFLV\_`_VNPSRI@;878;I№                                                                                                                                              ·,  P                                                                                                                                                                                                                                                                                                                                                                                             Жi`ZWYYZ[]\]g|ТЦКqcdcb`_`ZY]dfedbbaa`\\XXUWZYVROOOROOQU]_YPOKLMKEAHLSRLHD@AGNSUSUVWXWRNONU\`abcY[_ekkqxАЧ▒╢╣лЬЦРЛЖВ{kgfkttwpd^affijkmmlkjjigbZTS^ehihghhihhhikhe`UNOV`fikmkife_`cffhc\UOLQSV^]\XWX_dfhhijd\TPNQSRQV]`eeeed_URUWY[\]^[VRQOLEIRX\__^SNRRKC>8758=ы                                                                                                                                                e!    =■                                                                                                                                                                                                                                                                                                                                                                                             №lj^XWZZY[^alБУЪЦ|fffeba_ZZ]_efa_^_a`][ZYUSTTTQONRRQNOUX]\WQLNMNKIJKQQOJC?AJRUUTVYYYWVQOMQW[^]ZU^`filkgip~Рв┤░иЭЦРИ|iefbabeg_^`dhkkmmmnkkigd_WNPY^dghjijiijlmrid_TMHO^ehkihfda`bfijijc^\UQRW\^YUWW^egikjgaYSPNTRPPUbffdeec]RPSW[^__[XSQOLJIPUZ]^^XONNKE@7567<╕                                                                                                                                                 ш'    D                                                                                                                                                                                                                                                                                                                                                                                                ┌jeZWWYY\^eqБСЭЭАifgffeb`ZZ_bedaa___^[ZVSQNOMNPSVWSNNRUZ\\RJLMMLKIILLKHDAFMTXWUVYZZYWTNINRXZ\YY^dgkljabfkuАФеебЫХКvhfiea`\\XZ_dhjiklljkhge`[VNMOV]bgjjkkjilmnfd_XNFJS_eegfec`achklihec`\UWX]]ZUXZ`ehikie_VONOSQQS[dghgfdaZNNUZ^_``\XSQPLGER[^__ZSLNNJD@857;                                                                                                                                                   k     K№                                                                                                                                                                                                                                                                                                                                                                                                 Фa`ZVWX[_dsБЛУЫНrecfedcb[SZ_ababa_^]YVTQQNNMNRTWYYOLOSY^bULLNPPQLJKJHCBADKSUUVX[Z[[ZYVLLQVYWUZbfgghe_[[_bdm{МЦЬФБohnrqjd\YVX^ekmjjkljhdggc]XPLGO]dehikkhimooeb_]RFIJT^eeffedbfikmlieeb\XYZ[[VQV^behijib]VPNOMPRV\cgihfc^WQRY_`ba]ZVRRMJFLV^``]UOPQLD=;46;\                                                                                                                                                    ¤4    "d                                                                                                                                                                                                                                                                                                                                                                                                    qc]WUUYZ`ku~ИМТ~jacdfcb`ZY^a`___][WUURPOLNOSTVXX[VPNQV_d[RMLMOPMLKIGDC@HOUWVWZ[[\[ZYXQNOSSSV_ghghfd_[]bdffjuАДВvkhr}ЗЙАumha_cikklmmmkgggeb`YQGIU_dhkkiikpqkfd``YOHFHU_gkleddfgjlkigdc\Y[_]YTMOZ_begig^WPNSQOQSZafhiigaXQQUZ^```ZWPNQNLLS[^^ZUPMOOHA<767R¤                                                                                                                                                     с    (Д                                                                                                                                                                                                                                                                                                                                                                                                     ї`\WTPUU[_ckyЙГymfeddbb_]]]`____ZUQSQQOONSSSWWWUUXUONTY_\XSOORTQOJHFGGACLTUUX\\[\]]_ZUQRTPPX^`bdbb_^aejoxvmhiikleepБКЛЗyoha_fiiijknpoifa_c`UJKOX_fijikoqokdcdc_ZPCEKZelidbfhilmljgd`^]\]]WQLLNZ^`fheYSPSSQRTW]eehiif\SORW\`cdaXTRPQPNP[`a^ZSILPLG>:78H°                                                                                                                                                       ╣     -б                                                                                                                                                                                                                                                                                                                                                                                                       ╚^[XTQU\]_ciimmieefcffca`]^]ZZXSOMNNMNOOSSTVVWTUVWTQTVX\\UPQRQQLIFGJPIBIRVWY\\[ZZ[\ZXSPOHMU\^]_beejlmossslc`bed^`m~ЗЛКЖЕЕГ{rmljihnvwoheb`ac\SNIJV`fhhhkqohbddfc`YMHKXejgefegjkkiigd_]__^[YRLHMQVW[_\UQOQRQQRZ_ehhjfdYQQSX^bbb]VRNOPRUamkga[WKLLE@<97FЁ                                                                                                                                                         ╘   &=╧                                                                                                                                                                                                                                                                                                                                                                                                         П]VQQOX^][^[WW[___\`_^][ZXWURQPOMPTSRSTURUUWWTWXVPOQUW[^WQQPSNIFEHKOHGIOTUY]][Z\^\YVSKJHMV[]^`dgjliiiihif`^bc`YWcr}ЕЖЖИИИЙЖ~wrppqwwndadege_[PGFNZdgfhkmiecdfghe_ZQQ^mlebeffikmmjgf_]^_][UQNIKLKLPVVNJNRSSTW^cefgfd]TPSUZ`dc_ZRNNNSW^fjk_XTPKKGC;;:?▐                                                                                                                                                           у,   .l√                                                                                                                                                                                                                                                                                                                                                                                                           o\XVPU\^]YVRWYWUXWTTQONQOPOOPQSUVWUSUTSOSVWXWYXXTSSUUZ\XSRQOKIFFGIRNIKORUY^^\\_b]UTOLKLS\eklnjjhb`^]Z[b^WV_b_SSSZblv|ГЕЕЖЖЗДАzx{viecfgihdbYMGKO]dffghgccdfgggdbdinojc_behijkjgdd`_^^]ZXV[\YULHLMLLNSTSSV[befhge^VSTUV]aba[UOQRPSVVWYWTNJHJIB@<<>╕                                                                                                                                                             ■t   %8╜                                                                                                                                                                                                                                                                                                                                                                                                             Ї^\VPUZ_`[VS\oБ{b[XVRPOMNKNQSVXZZ\ZWVVTORUUVVXWWVVTTTV\\WRPLKIJLLGJNOJKRSWZ___af_VROOSXcdntqkgd\[[[ZXRSUUX]_\UWSSX\ckrx~БДИЖКПТРАoiijijkkgd^WMHIS_eeffdcehhiigefhinjf^]_ehjihkjfecdb_\ZZ[`da\TMHILNPSUSQSW]_dffb[URRUX^a`ZVPMMNKIIIJOPMGEFGD@=>@а                                                                                                                                                                ▐D '4h°                                                                                                                                                                                                                                                                                                                                                                                                               ╞\XRRW[]^XP_БТР}kb^\YXWUNOTZ\[\[\ZYXXUPTUWVWYXVUVUSVSUWWSMJILORTLIKTUTW]dfhglnmdTOJLZhooyzmfa[Z[\_a]XQUWX[YZ[]^\YYTUY`fotzЕМОЛzolnsrqqnkea^WLEQX_bedccfgijihhkntuj_]X[bfjjghfedddd_^[[_gjgfaXPNOPTVUPMORV[^_`]TNOQTW\[XTPKKNKD@@FKOPJECCCB>>@Я                                                                                                                                                                   т\ (4:cс                                                                                                                                                                                                                                                                                                                                                                                                                  Н\XSTX\]ZQ[zШЯЪДjd_^]\WQSY\^^^\[[[[ZVSRWWWXYXVTSTSTSSUSPLKKQUVVSMJS\beknqrqssmePKIMYdinpoh\Y\]]_deefXVZabZZ]bcc_[YTSQUY]bjxДЙВqhiu|АzuojdaXLGKV`edccehhhiihgmtvsg_QQW\afijljkifeb_ZY]fhijjiea\USRVVNKKLLNRUSPNOQRMOPMONLKSQGCDHKQRQG>?@A=>Bг                                                                                                                                                                      √╡]!#%)8IУю                                                                                                                                                                                                                                                                                                                                                                                                                     p\WTTY\WV[jМ░╖Чxoheb^ZWVY]^`^^^^]]\YVSTUVY[ZXUVVTTRTUQKHHGQVXYWQKUhvwvwvtnkliYJHGMVY]`db[W^``ceecdc]\\\[WZ^cddededaWRTSV\k~Вwihjs~ДКММЙЗВ}uoiceijdafdhhhihghpurme^RORW]ehjkmnkfd`]Z]`ekllihe_ZUSTTPJHFDCCDDFHMOOMHEDHKMMJMIGJOUWYQKC=<><@@?Щ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                            ╦_\XUUWZZ]mЙ╖╠╜ЦАuphd[WUW\_ba``ab_[XUPRUY]^]\ZXWUSSOKHJJLTX[^_ZUYcnquvqh]WVTJBIPU]\^ZVUX[\_cddeb`^ZZYUPOQX_cffcbeda]]][Y^dhd]POW\dlsz{~ВДЗЗЖАtllpy}~}{yyrljjkmnmkgfijjijmkfe`[Y\`efhjkhfb_WVTTTTTV][YUPGCKQTTQMJFHFIKOJCIU[]\WH@<<=A?Ч                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              Х^YURSY]\hХ╧▌╜ТВwnb^ZWXZ_bbbcddd_^XTRSW[^]^\XXVTQMIJOPNSW^_^\YXY_hlqk^ROONJINV]__c_XRUXZ^beefca][YVOORTUX_dccbbc``bb`]]`d_VJJMRU[chlsyАЗКЙЖ~nhmwГДЖЖЗЗЕ~vkegnt}ВВГЖИЗЖ{plgdea[Z]dfgiiihb\VTTTTTUZbceb\ULKRUUWXURPMJIKHEDMX^\WL>;:;>Aи                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                x\SRQUY^dsН╨▀╫║Сukd^XUV[bddbfffa_^XTUW[^`_^YXURMKHGKRSQTZ``^__TOV^`^UOMMIEKU[_acd`^ZYYWZ^adfa]ZWTRRSTQPUZ_cbccbccc`_\]^]XPKIKNLMRUW[bjuЗЙsidlzАИИЙЙНЛВohfho~ЕЕЖИММЙГykbbcb]WX`eiiiifc[TSUTUSVZ^eehh`UKMRUW]\ZUNIEGGFFKW]]YMA=;::@║                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 №fXSRUW]eqЛ╠┘▄╘╕З{of_ZURWaeghgfeb`^[WSU[^`_]WWSPMJKIMPVSTX^`^^ZWOELUSPLKHFIQ[`ddddc_ZYXVY\_ac_YTSRRUWVRPQV[_b`aaacda\[\]\ULEFINTSURQSU]eqxrib`dmvy~ВДЙПБkgefvЕИЛЛЛРЦП}mcaaa^YV]dfhjjkg_WRSTTUSW\dghge]QLQUY\]\WTLEEEEEJV^`\SE<998<╞                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   ю^YRRV[cqЙ┤╤▀у╒дЖyoe^XUU_dgghfgfed`ZWSX^^^[USPMLLJJLSUSUW]`_d`]TFBLSPKHDKOW]addcbb`]]ZUWY\``[URNNQY]YURQRVZ__bbbdd`ZY\\WNJBAHPW\[YYVWY^`eje_ZXZ`dgmvЕzha_aisy}АДЗФФsc`__^[VU_cfjmpmhZOOQSRQRX`ghgfaXPSVXZ]_\SMJIHDEIT^b_WJ>8:9<╧                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ─]VTUZalВФп╘т┘╞аВvncZSR[bfghiiggge_WUVYYWUQPLKMNOLMPQRSW[a_bc`WJFJMOMIJPT]`beefbda]\YVRUZ_]UQMKLT[^]ZURORW[^``abb^YZYWVTSLGJKQY]\\]^[Z\bdaYTWXYWUX`kphd`ZZ\]bdfltxwi[[]][YTPZdhhknmdSMMSVROU\dfggc\SRSVZ]`]XQIFGFFL[eb_YMB;:=<▄                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ЦZXXZ\evГПо╥▀▐╦ФАqg]UVY`fhjlkihjgbZUVVTSNOQOQQRNLMLNQSVX_bbba[OGHHGFEIQZ^cedcffhd_]\XSSW[WNLGJPW]_^ZWRONPX\^_`a^[VVWWW\XRMGFMV]_aba_\X^`]Y[\ZUSPMRV\cb^ZXYY\]^^bieXW]]\ZVOOU\cgjkf]UOSVURRU]fhih_UKMUX]^_\VLDBDHMYcgd\OD>99Cш                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         y]]\\\gxЕР▓▄ь╓йНug_[VW[ainnokjjhd]YWUTPORVZ^]YTOOMOPRUSZ`cdc^VOJHB@BJTZadeedfeda`__ZOPTVSLIIMU[_b`]\WPMKPY\^_`^XTVTUW\_XSNGMSX]bab_XY^_`adcc`YSOPSZba\Y\``^`b`__YV[\]\XSOLOUXabe_TNNSURMQZchjieYQOQU^a_^YQH?>CLSZdf^TF>;;FЇ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ¤j`^ZZ_kyДУ╕┌с╞б|ha_[WY_djonljigcZYVUQOSW_ab`]XROMNNOSTV\dggcZTNJDBDISX_cdfedcdb_`_[SSTQNIHIQW^`b`^][UNLLSZ]]]\UONOU^__^\SMJMSYbc`^Z^`__defee^WRPQX_^\`edfdbdd`YVWZ\[XTSPLIHGJRSQMLNRTMMU_egig_SNORW^]\[WKC==_■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              ╘g`][]]`js{ЕМБofb__^WV\dfeba^ZYWTSRNOU`fklkf]WRNLLMPSTV\dfbYSIF@?CGINX_deededc_acbVRNJFBISY[]^_\]\]\XQMLLOSTPMJOW\_abdc`\UNIJOV\[WWY]cfjliif`[XZ]XTV^fhiiii`YOS[^\YVX`edb]VOKIHILRUQJO[ccd`WLGJNTZ[ZXSIA<<s                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ╢fa^\[Y^elstkc][]]]YXYZ[XWVWWVXYVTSQR\fkmnme]XNLKLOOPRZ_^[UMCB@?@BEJS[adbbfdbbaa_ZSMIFBLX\^\]__^^]\ZWQIHHLMMJKQX^_bbedcaZTNHNTVWVY^aegjkhge`ZW[ZSOSYdjikjh^TQV\_\WV[ehgc_ZTMFHKRTTMIMSWWWSNIEGKSUVTTMC:;>AFKJGC@;<Ж                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   Чd`^Z[Z\aea]ZXXY]^\XVTURRUWXY^die[VUW`imnlgc[SMIKKNOMQY[VRLIKD@@ACGMW_cbbcdddeecZRJEABMY[^^]_^^^^^\[YRLIGIHILX_bb`fhfee_[UNLNNNTZaehhkjhfd]YZ\ZTOOUZcgghd[PN]__WVZagghie^VPKJPTSQKBGJKMMJGGDDELNUUNEA<>CJLOJC?:<н                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     Лfc]XVW[\[XUUX]ggfc^ZXWV[^acfhkhaYUW\emnpmmcYRLJHJNOQTUPONQTSKCDBBFP[^ebbbabcb_VMFB@BLPV[]__]\]^__]\WRIEFGIQ[ceecfggfgebZOLLLMRYdghhjlkgcZUY\[XSMOSZac`]WQTaa_YW_ejhhif_WLINUVTLKIHHFEDDCDDEFLSXRFB@?HSXUPJC=D╓                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       Зh_ZXWYWSQRUaИТОri^[X[dinmsqrokfYVY^flnlkh_VOKJJJMNPOMLRZ\\TD@@BELV]aeecbbccZOHDDAALQX\]\^\\^`a```\UHDCDJQ[aeaaeeghihf_VRMKKOXdhhijjge^TRSY_d`VPPOQWYVRTYab[TWchjiiif[OFLSVSRQTTQMFA=?BDEFMW[QHB?CHS[YRKEBPя                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         Бe^ZWROOMPXmк╤╧░Оxjd\]elpmoqqokh^XW[clommkg\SPMNKLMNKFMZcdcZKC?>CJOV]`c`_bb_TLEDIHGHNRV[^^^]_cb``^\TGA@BFPX`edcffggihe`XQJIGKV`fhjklg_YRPT]hid[SKILNOKMS`c^WU]eiihih`UKJPWZWSW`a`XODBKTZ[VLEBe¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ■Аe_YPRSOQZsЬрр╔оНqh`bfkprpsusnmibZ[`flmopmcZROQMNMMMKO^dfebUJ=AEKQUVRIB@BIS[^XNEE~                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              Жe]VQQPT_sХ└╪р╫┐Рylkikorttutrqmk_][akmrqmgaZOPKLKKKLQ_fgifc`I??CHJR[___\WRHHJMUTSKKJMT[]^]_`_][XSIFFHEEKQY`cdfggefhe]SIEFHHHNV_fif]QOQW\dikjieaZPLIKT_e\RT[diljih`VIDMXWSQXbfd\NB<;BINTXXQEAEIRZ_[PHH▓                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ПhcZUTZcqИЪ┐╥╪╦╡Пxsonorwuwvttqpa]Z]fknomjc]SQMLJHIMP\ffggc`OGAADHNU[\\ZVQJJOV[XXJGGJOV\^]_``^\UNIGIOSJHMPX^cceeeggdWMIJNQTNMQY_e`UPLPZaflkjifc_RIFKW`]RNU]dhjheaYPHHOVVTV^decVHA<>HLTZWPICCIS\[RNKQы                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  Шf`ZW[ai|БКЫ├╠╘╥дЙ{pmmsssrtsqqhb[[^binng_YTOKIGGJLPW`eggfbYQE@@CJOTWWSOKIOW\^[\QMGFLUZ]^__]ZVPKCGRY`TMKKPZafgfgge^OHILXa^WQNQUVWNILS^ejonlkhf_MHIOWXTNOSX`dheaZPGCJUWQS[beb[NC?@HNX[XQFCACS`[QIFo¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    лkhb``bkw~ИЫ╟╒█╠зИvnmpqsuuusqlg^WTXbkg`[UQNJJJKJLOU\adfed^WH@>@EKMORMKJMS\_^^]XPGELRWZ^^^]YUNHFMY_a[ULJNT[eghhe_ZJEGS^cb^YSNONNIFOZbgmmnmlidZNIJRVVOHHLPY^aa[SGADQSQOU]c`^TGBCHMZ_YNHC>=GOQQICР                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ╚kkd^\_iqyДУп╟╒╧▒Фyjmoqttsrqpld\WVZ^][WVROMMLLJJNTX[`ffgc_QGC>CHLMJIHMWZ^```_][TLIMQVZ]][WPHIKT\cc`\VSOOW`egfaZSGGNYchedcZOJJHDHR]dijkjkhd^VKJOSUMILLKIKPTWQJCCGNMOTZ`b\RHBDJPY^ZRICA?<@IKIK╫                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         яxpjfdbgoxАМе┐╤╬мПrjkoqsprrpmhaWRVVVQRSTWYVRNKILQUW[cfec_XPE>BHKJHGJSZ^_a`a`]\XSJEMRU[ZWRLGGO\beec]YSMGQZ`fc\RLFJUbhkjhe]RLFBAGTafjhjljf_WMHHMOMJOSOIFGIMJHCACGNLMTY^\UHEEHR[]bXLC@@?>AEIp∙                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           ■Кpnle_bhmt~Кг▒дПzjgkopqpolhebWRRUSQRV\cb\WOHFLPRUW]eheda\PEGIIGGCJU]`ddaaa_\ZXOGGMRVVQLHIOU\dfecd_[QGIRV\\TKEFR_gkljjf\QJDA@DS]diijifaXOHDFJLLOX\_]WRNHF@=@EJIEIMTUUJGIQ]gjl]SGBCDB?ABк                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               оqole`__elrzБЗ|sf_abcefc_^\ZUTUQPQV_jlie^VLIKMOTWZadeca]TNJHHECGOW]adeaa`_^][VOHHPUQLGEMV[`efeced_VKKNORSKDAL\fmnljkfZOHCA?EKU]dghhaZSJECFIIJP`cba^ZSF?<<@DDDDEEFGIEFUcmuzeTIB@BFGC\є                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 чzusmd_^`dikhe_\ZZY[]\XSRSUQTSONQ]fmjkhcZNJJJMQUW]`dedaWOKIFBBFKRY^ababcdc``ZXQKNPNIHKRX]adefeefea[TKHJJGCJTakmmllldVMECEIJLNSX]cb[TJCCACBFO]dfeea\RD<9;@BBDDB>==BFShАТОoYKEAAGHFС                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     зpmhb_]\__[USSUTSTZYUTUVVOPRROR[elmmkf_RNLJKMPSW_^cb]WQJFA>>BHKPW_cbbdeccb^[SNNMLHIPX_bceffffeecbWOKGGBDM\dklnpnf\PIBFSUNJIJMQXZSLGA@?ABLYbeffd^VIA;9:>@FIIF>>AFR]cegf_XMC;9:;>@FRUG==ETxд╣жМrVHCDEFМ■                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ┬nh`]YXTQRX__bgpРДymgeeficXST[chooni_\TOKLMTTPSXXSKMMKHB=>DBFMV[^abcba__]SQMKFEKQW]acdbddghffc^XQICBGR^hlnkhaYLGIQY_ded^WOJJJGD@?>>CLY`cfgc]PD<9888;ENRMHADRkТйаУ}^KGCD[щ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ¤жhe_WRQV^``ak|ЪаУК}phegh^VWWZchnnidaWTNMNPSOPRSOJLSTOIA8<:7559AJMJGBCRg}ИДubSJFD╡                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 єЖd\XVY[^]Z_iuЙЛМЛ~mkgf_YWRTZclnlhd[UQNOORNOQOLKR[aZTOA;:@EGNV[adb`]YUMKJJLKFINV]cdcdgggfc_YTJCDGJLQXaeb]OHEGU`ggijggaWKFA=;878@JV]dee^ULC;8436=CGFC?CQfmornd\VJGr√                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    ёХaYYTTUWY^`jwВКОЙВxpgb\YYV`hlkhhcYSOOQSPLLJJQ^`a][TF?89857;?CDC@>Nbgd_\XWURU╘                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        ·к]WQQQTY^_dir{ЗННБunkhb__dlliic[UPOMLKKJJLT`ccb^]VK?;>CGHNUY[ZXPMFNV[^[XPIKQYafeigfc^XPKINV\_RMMMNNJGLS]giiiiif_WLGC=;999;=CIMQSUMA:9776BDFKRSURLHLU]bb`]UOHJU]cgikgbZULIMV_b`WPIHJIFHP[eklljig^UNJEA<89:BJFGFEFIFA;76537?EE@9;>;=>HT\aa_[SGA;73106899=>@DFFACGT─                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ╫jVSSSTWW[]YVTQOJMW]hwАГГАzsnf_^`a_^abeec`XSPKIIGDCEIS[aefggfefecdsажМiVOIM[eghfb]UOJKLLLLJLQW^_VNKJC?;:?EPZ_`^ZTJA<972168:;;<>@EHDAK│                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 ЁСSQQQRRSSPONLIKTcrДИЙЕГА|wsnmkigegfec]XRLJHIDCDHJLS_cdgkkhhfde{ЯжАaPFFT`fhe`]VPMMRTZYUMHHOQQPKEC?<:=GLS\__YQJ@847964579;<=>>AELп                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                     ¤─iSQPNNQONLEKOZeq|ДЙЙМКЙЗВДВ|wsnkh`\YTRMMNJGFFEIINX^`cfgjjgfbwЙВoVMHIQZ^b`\SMJMOU[`c^WNGHNNIFEB?<:856899:==879L│                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                              №╗_RTTSPNPPPRT\decegmou{~|vmbVQNR[gpwzsdWOHDFGJOW^eegg`[\`[QKKHEIKPRPMKIPY_dehgd]VPFBDABBCEO]iopjcZI@><866:>>>?@@=Q╟                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   яУUONNPRQPRSWY\Y\[Z`dgifd_XQLNYgpАЕЕВvdSJDCDDFLQV^``]WWYXOLOTPCFIKJKLLZ`cffge_YRJCCB@<>ER_pxtg]SE@?=<979?B@@@Ak▌                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        уИLOPPNOQVVVTTVW[ZZZZWTPLMR]jsДЗООНЖtcOHB>?DHJQVZWSTTUUUSUVJIHFGKRSZ`deed`[TLHFHA;=IYb~}{n`RH@:9;:<<=ABBBДє                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             рПTPMLOQQQQTTRSTSRPMKJHLPZdmyГМССЛt[MA:9>EKNQSQNTXZURSUQGHGHIO]`^\]\]YXPLIGDA==@KbwБrk_QDAB;9;HLMMNJKXmiWMMKKIHKORV]h\VWTSPMGECD?=:>EMWda[RJC@==;:;DIGFFB@>:;=>?@d╠                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    эгbKKNPOLLJJIHMQSXZYYXUPKHEEEBACDDCGJGEB??BEOUZ]_]TNJHGGHFC?>>;87?DB=<>>;=>BKЩЎ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         №╘ОWNLIGJHGGLONOOQPNMJFBBB@ABAABFGDA@>=>DKNSTTPNJFEFFDA?<>>;614::9;=>ABЖ▌                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                ё╝oQOLJIHGGGGHFFGHFDBCA@@BBDFCAA=;>CEGHLNNGDDCCCA=:76:;94058989<|┘                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ■┘ТSJHHGFFCDEFEDADBCB@BBDD@=>=AFGHHDEHEDDFHDA@;97689756;=>Г╤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ╙]LIHFCBDFFDEIEGEEFCGDCBBCDEFFEDDDA@AACCA>;87789::[лэ                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  ╗QLLJGIJIFDDEEGHHHHEDCCDCDEEDEFFBA@?>?>>:88Hvпт¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ўsPMKLMJHFDECCCCECDCCCCCDDEDEFEC@ACEFbЕ┐ш¤                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                             ─_UOOMJHGGFCBBBBDDBCCEEDEEIzк┌є·                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ■о[SPNMIKKHGFFFGEFFGIHu┐Є                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               ▀Ц[VSNLLJJJHIH`Т╨Ў                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      ¤їх╪╕▄уё√√                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      endstream endobj 8 0 obj << /Filter/FlateDecode /Length 36046 >> stream XЕьЩ]Пm╔QжяыWlа1▌x║:╫Gо▄╙╥w[т∙H╛░╣ёБ╔▌сГМ°ўє<Щkн╜лNПy<А-sк▐╩╠o|ЎуЯФ█?╛{*╖№яЧO╙\ЯKnkЩЮзi║Н╙┐OїyY╓█п сщы'v ю·сЫз╧╛n├э═╫O├Ё╧4/юрИq}З}╜╜∙╢}`р?√|╪┐°╗7їT8p┘wр7/║╛ЖЦ/¤┘╟? ·У°сєaь╚пЯзmъq╠Ї┼:╖Х #V╧├╝ючВ}1l∙е}\G┼N№/┐иїюфсyЖi<д╪№0t ~▌eZ·Я■▓ P┐X╟╤Я?]Яч▓/єэS┘∙┐█ЫЭ▀8яє∙░5qY│oэл/юН╘qH*7Хg╛6,/7¤░>┼уsйuXПu┐·фвмT╦Ё<╬╟К~3╬_╫m║|╡▌юK\р╟?я}и╬╖eє3ю3>o╖u╞#ЦtЮ■о? ЇЎ+╧Ы╬єtЩQ_▄Pс▓п╧√╢ю╖oЁ╢e▀Ю╟▓П╖▒М╧ы4lБL№∙6ВМ■w o┘VЮ╟}╝м·цК╒чi]╞└О╜wX√B├N!ъє╝7аIZY╗─'\z┌╫yЛEы╛э ╦єTчї┘╓╛нAыє┤╫Л┌Aыє║,╫П5╡╝}·'6╬|fма3F┘*Лx┘зчН┐╞▐КЎYъД)╕▌PышuDц░юЙWз)с╞й9╩2{!?шЩБT,-2Оk[│а╔эЕкИ╣жБцuA~РХpЪFEо╨╗ПЁ@Rя╙TЪ]√кi)}>¤╥eЁ$vЄд О░ьф▒ж#▒ам ╞;├f<єКв─╗_Ю╫yЁн_░∙y▐xТЧC╚т╡!эS╪┤Ц╡э+!7/бкФaсДWС║ымЩ├├?т6NШ┬А╟киюN┬'Ў╕яхs<в╜▄ 5\пrwрr╣К?╖▌▀iL∙Ъ4dюС?^$цiqэы╜т╛уЎ╟коауаGГEд6nН;.╕я^з5╠H╘╦Z┌[`п╤r├ёJё,Dря¤ў╝ъJs]cЁ/~я8ЕL│р╥╟╖▄G4 WЮй╡Щ┤ЪЮZ╝8РЛfМpW╢лЄ У╓tў5t├єКmЗL\ИDFH╣uю═H┌ю┐6╥╫"W4фвЯуФCЛЧoёТWуE"RБ▒∙"ЇБ\оv`ЗОУ%=Z-Г√Иўьc^oК 2╧э:├d8бюq щdЩ╣yц*z"л╔МhnXв ▐ Qс5ь∙FФG°{FH▀°┤R╠╣uЩзв%ОB╛hВЦ5r■3FGм5·Ё2.ъ*Ю╪fк╥я╞-Пиr▒*шИ√(╤LОчвС╚Y╝5ЗА@╚fkвB%▐║═М╙Q%$ аз┤═Lт╜"dЙ╣s[├░є╚[ЇЬ-╩b╠@_[Zш╫m▌ЕH╝Тp*╥"kFюH>c3WгЄщЙ:#8 а[iЫлP╥ЬСкiЄтёю┴* 3г┴Вlщ,[Нu▐╬Pи#ь╕nD░╦/ Э7OIlж pЕeє┘Uz╚D@ ╥зЖРh▄ЪBЁц║р╚QaR+2Mhя@▄зm)/лиk8Ч~mФ)[VпуЮQ_є├ V"╦^2эL3N|A°Fб╝╠}F╚T!Ю!]Y▀°╣=hКL1з(TИ╜uk>╣ЖwЮ+▒7n7DU╥Р4хFк┐отH~=щ╤n∙Єщpыъkхц<1iчёюоXїКP╝∙ BjеYзx|9 М┌IМхл·вы) R╪ЁrР╒7q юЫ,╛╘╫▒ ЎЗf╛єЙВ+г)'╢║l4меШг-╝·в░О╦╘\dMуЁН№▄БЭU╓┤<єфя+п;├Ф{ў(%_├иOё╪Оm:g┤7)╔е*╚└ ∙Ч╕$┴─ъ?eЎxf╦╔МL└р5ФВN░ H о% BcЇЫ▄╫Ъ?b╫l 2дWЭ +ю├SgыCхКFЧт┴=╛O─!@┌ЩW╪"e.т│ееЪq3iН╞▐@TJ╫%iЩ╤"RB─к%Bзa═мy┬sWBЗe(,g─мq!БХ║▓X&-УВсг'B╛рiВМ[д#ЮHv(@┼af6╫═f╨%√ ьВcБМk╝ёЖ╕їФhЧUжЙh5э3ph╘MR{К4f1╢С│▓нX╒╚:╖2С(а#╚┘в^▒ЧИUэ$B╗~╢╚╗дЬC▐╧k@ъ╛_ы@я7E3rVЛ`°[ZлнBS2a?EБъ╔}╘#╣/Ик┤a1kkЧ^SN│╒УH$vy^╡╗H CФX уБQ╥фгOў!│зф5┌Ь┘H╤Р▓p╕gMXлu[уФsRQG▌╔х·ф╗ъTхщJч*Р!Ъ*T╘┴┤Xщет╔ъn█╨J─╞H╫┌Уv┼|Хё?№р@░'q#ЎШ═°bИрд)^▒Э{╝╞ єП┘ЭDчЮbтЛЩё╟╒@ G┴sdwэЩ╟Yhлy╝Ўz ;вч╙ЇD47ЗZ@2щч─i┼Р!▄│╨$\Ъ!Н7э┘╟kМцВuЁХGe│ц=0к █S═Lc ╡ЁМ▓vF9bи╟╧╜О]Ўв ╔ж╫▒&╦▌▐╫0Ь╫Ш|Зсф√вЪ@Ў▐АYИ |/Э`"└и8:А9J335 Gd▐Вц8Ю5║T┘▌├█|─ўЛ%SGCvDКЄ ▓-Ь5E└╬ЪДДЬ╚D∙qQГH╓!f░∙╠+O¤┴р╫└pдХ╒Тy k╖Мэ-╚╝─ХЛХz─-0╛╤Xt┼зq-Э#,╚YшЬ╪aЬкГХ┼#тTbsиХV_ ╚0юyєm▓б`N&"2ВU,█4F9(▓cб@иH╚cU^з1ўM╔o^VЧ╓(цбAк║Щў▐k╙3╞>Уf╟║с5█┤┤ЁI°╗Gvк┴╢нaF[ LЪ[54╩!ЎЇЮ#ы#0▄?╦# х^iТ2╞nф╘╨@НфJБ*%щ6d кЧ(ъС8Vы^м ╞jq╥ЪmD╦пiёиK)Xf;Y╚Є╣nvд'BX▓h╝bКIz╥w4№L (cУ▄в╕mR.Gш▓с*d░FIA╫┼uзl Т:aekОrХdJ4'Эб№m╠Y ╓UЄ-nЗ╧Sэ▒КhXBu№й╠*╙°b┌╘рё∙╜%<мA╝#!ц1╔═╓JOх'jIпўpїlXvbm=├омФU2ДрMЄ~│]╣Ж═Т^NЁ╚w╘VQ.Lсн Y[dn4*№z┌У│FB6╩╖7х№)щфp╓ R╟|╡W хч╫h╛│Ъ┬1Ж№Z╥▐ш~>дД╥Mgбiє{Ъ/█▒USчУ апТ├lEўЫШ}а└6I┌кУ┌%■@Ofюm30Jч─шbz╬зAN╗(!k█╒░Ющ5∙╨т═╝O !3юI БР│О╨╒┬р╤ъGеСЦЬI╨Ї┐Y$k RsчР#жQД,k6ф▀╝Х╕M╘C1╫!:╢╚Чaч@Z 5]╓6;ъбqуu╙O~ FНb√х╢;█((я0 ▓─▒qй╖{МЖё■║lЧ-┐├$НЁ░ы▐┼jЗ`Ё*FnZF°ўдfў3ЭёdnpZ╧;O║aГIї│▓&I\ў╥~МVщпbз,(p├=LРъшwux'F' Ж;2├║Й ╡Э╛BM Qt╣ж!o┘'┴╬Є╦*К╝Э,HЗoа╘╕ ╩\ў┬╚·{╥р█^!()эfS!)tЕ \VBШ√xм█y[D ╚X▐!╛▒┬KСpЗР<я'S%╙х╛╟;oДKq0ец╒ХBд▐┘/X 4у╬nСъ°Ж>СРПт.JЯЛN~b#Жe`█╬Jl"$╠Е{ЖwВ;9 ёЦAЦgн>с 4м╤ыЙаБЕ▓BоMW!!╠ TtЭF╕╬О!3:DлFm&JД.ЪzZхS;Я─│dеИFЧU]н4╓ФК~(▀!`К~b.бiytЬ$wжfЗХJ╤иAсa═РW&[юы·3╝╬х╬ШЦО▀}С!Я╤Щ√:Жq╕┌╞*йПxФiо▀3┤АbЪАЇ°c╛╗c╝Ё18ЇШbўhз1ИМ ,U╡╩т╧Д╤ШЁvьЇ#g]e?zыкHl,ыF#╓┼° ┼л +z┘w*#(╢╚q@ 3╧5жЮHС╨┐Ф°oМЦ╣═Ръ~ХsO▐ЬvnШUВz8эb█0z )╓╤Х├i┌Ж:фM:╘╡▒CБЁ╔оЫ ╠D7─╞п бQ'd ┼Чg&$u╥░╝Ах~Зp┴дн═б▌l╕)▌7И╠Зq║#ны▒]╝м┬─ЖxT╦н}ID │н=▒&╓UЖГХ&; #_р╛{╬иhЭ╒▒C╖╤╥╘? // яq Ў╫┼╚)Fг└┼a╬Р█Л╖╨r"шkь¤|╟Ё╩║д;╞░7*Yп+*И╖Рн\с|1#9lЩ╠W`─lУ?ЄY[яCдR∙FфЕRш'кZN,[╣╩'у!КZ╧╣П╚рЇ▄х╩░ФТ┘ЖдШmб№╜║яш┤ЖПД3пH╗r╥ KыДg.ш&√ю!/в&┐,( П┘√n<|╛KНМКе]│;0пPf▀йУ8O,Kя>0▐╠i╕-{╟╚:w╪╫OхЦ ¤ЄЙ НM)mXьJHМ▓EСC╞{<чon8|╤э_oэИсЎ╫┐╒яОї┐|R ╠чвDб▓╦? &Е°уz#н,╨эhh╔╓ЫUЁьыn┐┐}▓SrЮy@┘Z▐З л╝ ╚PhsЙ cЖy╨ ─шЖMЪ`У∙й`▀-3-$:) FQС^мi▌ц№гf╕ ╛pрs{-╣╩m╝сбL/╠/V╠┴щОRЩfh▄y╗сVФў═y7ф╬ VТsХаaълц ┘T╔рYыdG+їж√x?5H┘╪D╣0эС╥q+¤м°▓╔JBыLе,+ш"bъq╬бпС╖ў%═оЦ∙}з╙╗СЁхBVЮмСъэ╙ъD1V╨░x╚iL╟шї 4ыЪь)tьН╖)╕═7°sГwбtж╫юуУ39А▐-ЇШq:tўд┴и~╒дЙ╒вIПц┬iYи╞кm╔dЪIлЄ0jY9УTЭЩdI,>nТ┼Е■░╫И ┘яо╝ц╩H5LIжSc─ЕЫ8оЕXЄwжК╘ў6 1юТ╡&C╟ЮЭ╟Т№╜o╓Qm╠'╕┼Нd╗s╒Е└a`dFцBУ3х▀╒wgБЇ[мxeКм LчЫдЫR]°&IЄ`уNjА5└~W▐ъ░Zc╢.ж=ш/▒- 8ып╞нсzсmN)^ч┌ф▌#жщУС▀╤║cО@n°╥o;ўЄ┴Ы?xєo~з>╢Y 3ъНzў█'&RШVн9гз цйТKЭв╞╓╩wТ}╠\У4╕▄~є┤z)л╞L\IефЖU+╧dE│ў┐%W┐рДw#Ю▀ляЮ▄╟D4GЭ ┼╠╖▓с8C╬█pb?╟╓e!o╙вС7GШ┼.RдT4┐yr╜ЛоJЗЕ╨╦м4╬мczс▀ч╫▐=╔Iж╗mцQЪвЄЪ│Ь*ЮDбf▄Ё%┼nр|!╗їФx.╛Hcуpwч4є╜мПs╞,ЛЇТ!╠■■┐∙ОУd2ЄР╛НцТ7пн_6Z}@,+W┘9ч╪Їи7┐Цco\ol1Щ╚└Д9q,8%╖)Y 9{ф%{э я"╝{ж(│ёtC·и7┤]Врэ╫щу╒aF╗Гcш╢√Lэ╔Ў9194bёцlKВMДК─Z╫@├И╕Жяvф-√╕о╜ eХ/Рч^b?AxTсm_├.r=й╜Жёёй,Б┴%╪╘┐ОaЗЙ╞бaЎw▄ \H`о╥F╟8m╒)7Зр╕ ╩+БЯЯлe█aPЧЯА#їNT╧┤f8╜\УЬP░Ad[И╨с╚╜y8ZУ<$ШбС╙B╟*о/фA█р╠ЄD3║SюkШD+яKдьLaЦ`TЬт°={Лq╬▒тїЧUЗрф Ью┼х▐>¤√'e▌X^┘▄юcшЦшШўС8o┐>@├R╥╓╠~╜5[╦r╡Д│╚%╫t{С┬╫EфV▓j:Г═ ╪Ўs~┴╠═Z╞ЖП╫h▀Ф#>╡u"nгЫЕf║оRZЎВ+S4С█5Г#X∙n╥:є─,/|`¤tХ^0\лBЛ┘Г^Я{┼7  яvЯ Еи╤1─╣╟шzyУ▒wТСк~е╦ўкцYcЇхЎХ6▄є▓КG 'EsAфxGю;░єs■XтЎпaЦ>|№ий╦DhШ╙Еk░qH?п(ї@№жC∙╨ф▒Jb2▓&▀0┘с#o╣нA▒їF!ySdЇу╞`jЙ.?▒hвE %▄k8т $∙5Тa°ш2╞ыd.ёn═ОQпH5ф╢ЖY}─╛ [№╖'╩_°^вб█ю▓bб╕J╚t╪!w&Iw╓чsc┴┴/╓зT^Dd5кСQД┬5?'▀С√жi╠░*=1lAшП о Шh1RД╘zC<╩aЄФжЯrХ╘l╕2┴м\2ч╠═г<б-R╬J▀╡r■~DЇв╔ЄВ№O╜жDм;╪5йK╗╛╦*|a}п9├бY:='Є╟ВV╩т├╦ЁзХ·jbVwї╞├О6Ъкє╪√F1зХю0p╬ тИ(_¤ЙжIa4+╣гprb╞╝V ┌!В╠╣КZz═9c6<ГlsпТ[e"╢╡'ZGЪeС}└щcпdа∙жl╫Tэ┼║Нd0G─=_ёЫ*)GМ:╬┴nfнz·ФIП ьВХд╧ТH▐╩х8Єo▒К╕╢ф√Ї┘П2▄■ё▌╙??¤Ё═╙g_IД╜БJ╣■█o°√╕█8o╖7▀>uжьЧO?√|°сўцпа╤кэC╣╜∙{┴ ?lёГC║yj¤°П?i\┌,╨w╬э8╪з╛~═ї??№√єП█K√ў┐╡╦'уПЁЪЬ]√A? E√rIб∙a═╬? ├}│ЧМ}{;ў№╖╓╢?пЁ│П?k·и¤;┐O╓┤√ЖуcЧн∙╜ЎЗс╪?уП_bа d╘ZiЙЄ\▒┼TВ▓0Цпт├m╖╞s┘e╧Yр9a▒x█н╥7М│Б _{Ю G4фЫзЯд?р═WрQUёФ ╛ r╖(с]├╟¤>╛j╚╖√№I╖Т╝ьЇЮЇБ╦Ц▒/u ╦ ╗=┐ю:k ▌┌ФЇщрыХ|¤txa√э═П\▒FН╙O·││▓СЫ6+╠&┌∙б.┌Я╟В╢уC√ыЯ╝╝<#m4╫Лk■к√├'╬№|КB╔t*йвЛ■зёп┘їc┐╫?GмЗЮ:wOmўў'[╫н9╫щTНS╤%Ф ПШты#riхDЇС=^ЛУfb2pЪЕФuB.woЎ№°┐2еi щ┤║Цz░y`║WСї 4¤·=┬▄вй╝Їгc¤/о Л╒р╦9'--КM{б╬x5ЧУМE╘╟К_ўП╢У.B■т┼ц╦Ы?M2Pе▌Ыд!┐╜IЬо7У\mрwmИ╗O№VЖ°Чўвй¤bИfЪп!^ЪЇ; ╤нЁYЙЯ2QаTаПТGv╚ўцGwq∙e╘ Э┘-=щ╢]HцеЗ(╒в╔╟Я╢-░5╙╨ °Q√c╤╣HжтМ_=║°╡Эзэ>Ш¤ьу?z Г_╛б0аа=╥_n├JcГ`уJw@QB~∙щэWмqиL°ЩВ'КАL1╤у┤╖Ю-°ШPцE 1B┤Eг Yi=Аьл8И p┘ y ы"╣;мiб╞AЩpь─{\oв═^ЛQvЕ┴зра(TТР8ф┴H Ф╤№╧ЁС╝╠.┐Gygчц*╘Xчmr9S b╥МE+?╨╤╩╫мОєёOфЖ╢Кй"?н╓╢,ужqVИcU;0ЩR GLPУ╨pkXkK╛аZТO│GY/;Qmkw┘0╬dб╢ ┐A ░/rс-3tШ╨╢P┐дЧIт н1"├О╬їbQNЁN╔гАжВ%╨И"┼ЖьЛ MП.2дЭ╔╞╘№ЁG ъУТdQеrШ+*p═}dлW4ЪИYVhF░y▀c-xK┼БЙqUnСши8n ┬╔тгz8M┬FtПS"х╨ яАЮ└О:NТGx(NsOЖ9МrUГй╬[1DbТcнЙWLTYb(pхuщbp2ё╥╜└ФъЙtд}/]P╤ P═иV█═`tsмKCХ#Ib╘ЗЙI╨┤К-Ф,m 09▓█ЫN`ДМhРmдDxCJR8∙ОЄмд╬hО- [┼д╙dжД▒6■nвЬ"цLxoу_═╥\[x╗ArФ╒eNъЇ11[dЧбм<Н╕S|ЁXD╪ж$Xрж╕Тmt═■НoЇq│б╦YМLbЪX6╦<нХ2С7H р╪─VOбRj_╢у╘`фВИuBPn┼╟╤}ГJE2D$┬bм╚┤4*│РМD╝ х'№AЦ╒vMЫSD.йl■8═|{F├╥IИсС,#6M%▌@╠bМк;4/Bq,Ыpn0▄Ж■╗▒═=аxэ}┘L "┼ МЕ ь\ RO─ б╤Ыє<╧ЭЁ0ё ├■[н√┴ ├nЬИ'5*QИC+4 ЙЁУ9Y╚)^ГbСФH█}▓│??7аУXD╥╠з─╪YXДoПГД&▀ЄL]┬╦ ╤┘IHЛДФ╦╕kU Щ6┐и2√*╠Шхp▄Я&Ву)#R ДRштNW8 Ю╩J2msjЗРвlm\Ю ЩЗIrзы@┐°IДН,ьs kp:!u$╢╚bqB╩№╝EЁ$▒HХ╨8эБР4├єБ╘ХЎ─yи╘MbA╙фaNАHОDйФ╛ОdNDЭНїДМ┘rвЮ╪╚Ў}зq╛WK,$єО{з╒Зм,°_l$ubЬщ6∙№Щ▌╞cwNmQB.╚шcЦ▒║▐9uЛыnvщbb)-▒Lh▒ШсНПRN┼q╝ ╪J╚гZ┌└X;5LlBmB╢ыБС╥d▓rNСgQФyЪuзХ∙Mи/v{zК6╞х шэZ═╒╘%1(ў╞Ы ЕS█фV|Ш0в]╞╛У Г Ж¤V╥aSхШY}i╩t╞╥08кю SЩ╣йд$ХZЛ8у║ыHD╜ЦЬ D@└▀ дэ;pct▐\0жЕ@b-·╩В|A╖'Аўej:_sйЯ\гЪqvm9H6k╣)F╧"s/TKБЩ*т5Оk▐╔lj б`╘dЩ9 KT░╚ПГ0фn┘╣т~▄Э╕╥bсД├5nрY∙·:└┬QK>лЙЁ8р>z├b║╔2;eн╝7y╣ ЙOФ╩ў=ЯИ~УoУ ЖсtЛq▐}°Сc░tг╝ хwy Ы4╜╡■РU╗%Q╠№m ╚YЗY╙gу╨Кт$╧/┤>еЗ ьо ∙цщзNsЄ╖┌Уэ╔ЗЎфC{Єб=∙╨Ю|hO>┤'їC{Єб=∙╨Ю|hO■C┤'4'Д╔ect4r+к}╛Д╦─жX>тЭo┐}·ь~;▄~Ї┐шh№я╗}╘ер╡ rєш╟╟╤ыэnht7Ч╩∙3╬>∙XHр#cўб╥╟эФ┐h ~я]чй.√ъ╡A°Ц√s╧бў╓чnуї╦ъcFЮ3/╦d╝k-пБ¤р№╨Ё ┘¤ў·╔DЛ╜Ё█ъ╝╧∙я┌вWT╘яy~by№─ЯГ╥є ╟═ЖЎя▄>A~<■╜ЗEЯїгs7ї■i╞√Г║yр№╛√┐▌А─  Г╬R╧}hhRзК═E╓iп┘яё{]%#uщq█П╛ЧЛ(Э.z√╙GхnПD░ц┤хєЭХ╧╣ч▒Ъ0|▐e|PaЧ╢kэ°h}°ў^ ▄-c▀лЧ>8Ў∙Й~Rў╝Gзъ┐?К╥g┌Dнлu·}ч╟m╟]┘▀ПIкшC╠оАїс╛я√:}╞╒а]ЯП╟Ї╦їKuщ~╨d╨(ПgЇ==╚▌╧╕HBЦЄчO+ П╢a╣}╩╦╜╜∙╤%О▄┼д■к▐sK2╤\╧░v╝┴№+┘Э┬№xЕўb╤iЦя╥я0OЇr■зўьЩ╝ДП^У ё╜P╣ ї╤Д]O▀ ·║цv№B~;Nш;║ыuЯJ<▄q ╛x}ИXПё77&J,┤═)гдtIЁZ&zМЪЧ8╕ўї╫X¤╤Гi┐ ЗюВF?Ў/ =T№∙0Ў5_B╜ √╨]вL¤╧┐ъr}┘Lqj▓ЗшЧл°б∙╘ч├╨СЎЦ■з╥╖wй┌Ўг¤ФxЦ3▄ОrиЖ▄GЗ=ЯS┴▌;wХЪ╛шТЮ╫■ш¤ ╦├вчЗR├M├√>┐~зсс=кд┘C╝ш%Рёў°уc▄}иOуBЗмуwЧ+З'╚╝к╟Дu█▄ЧЬя}6/┤rЦєLы\~_}r_#^ К┼їtяn╒■|8╝Є╛ ?LrMш4vL╥┴2Я ё'эA╜╟╠З $ёeЪ^8┼wy╬ч├WM╢їAЙ▌L/т├c=°√╗0╥ АП┬╠Пйy%▀╝╖t ш╗█ киЛЛ|▄s┘c=┘У°5.OЎєaщ?L_╘┌KЎЛP]ИоСўU╨█ыBЖ╗┴Ё<∙°Vо╖B&~СИл═┐8▓J-%¤З\ лvqа╧K н▀}g╦н#╔№№W]Ьyх┴oцrтЧ═'Hї~HЛЎЧ° ы√╝сKF8rm ∙ч╗нE╛Ё1yї▐KЩюav■▀Є╖ыnc╟ў▐S+╛7 tў╓╒БМ╪┐зў<▐рў▐Sн-ящ╙Ц└Ч░2?■╔(A├│М╖:┴Bу3|[n0k +n┐■ЗзЯB▒tr)Дь3Уаn" _Ъ╞╒▐у^Nu ^▌Q╫╒#7╢╓ т\aГaz Я▐▒Vmvук╙WиaЗ!ччЁ6Ж"AлkЖT|ш<цD╬ПЭXН!0лОГ║╪//ўЎщыз∙Ў77ъ№ж°_oU?■├S┬;о¤ПyэЕ8эЁ{т┌ЁЮ2╨юoШ├Ыew╞╦,rE╛ "▌ш(Щk├%FпTд╟IЁ┴Ф,╚v|п#^▓╪Сє╣╩щФ╝цy╥БЬ▀;▒.╒yRЧ№х¤4 р═sР0┼8Чrжzє╗L}a ∙ '0жВ╩XМ$&'╠Г¤VШ∙JХ(}N#Й√0GXЄЎЫ╦Ng CЩРЁ@4┬▀н jШ√ЯИЦg╪ёo▒j'╧ЬTr[зKhд!ЬхЭЬЬ]V=▐№▀╨IxГCЗ+б╤ЭрбNШR1═:1lтЙ╝е~y"╨┐#J╨:╢2а╚ёЎ[ЎUYО╙W░┌ЁРб!∙4Шoz╙Жх ж№В┼э╙╟щ$d╚│╓d═│v▄ш8¤╕ї!CC┬УNiЭxмў Kшrы▀ЭЇцОр?e┼ЪW}-VнCo.cнЇй<dЫў<+%ш╚U_╗ъы▄┘o}Ю~ABЖл╛║мw·:ntшл_·PW╟╗sX┐эj╠Ё>ъ)'пє¤Ф ┼Jцfй╣ЭИАZЙКХQgG|qBL@МОёFП├yP╧s)D▐О№ЖGь/╝ДsИ!W█2К╫u@МцIy8оХ┬YU,█Ж╠LСИ7*ХтB'Їёо°G(L╬fuГ╥В╞EрЕ|p'цФhеOЎ№╛є5М╜╒Й││gC~[Щэ9M:фH╕lоШпcLШ\ПЎ╕╫<╠CHLЩmЮ├z uЪўbФi█h$dугБ0НЄV┬уr▄Ч7и╠╠B╣iУ#А╥N▀P╓e.@f;╧2L √ф─+eее┌#aIьдЗд:─iМ┴т 5BhдuнюDЦ?╚oX┼W╤сuТ1y╣wООбEвkhМ/mзUрл"ТэРЧчsЩ┼o:Ю╚╥qг╫й ╠¤Bsу∙├r("-LY└Ўu╠G-сШrмЕ ╪┌╓!я^L═h╖═8╗КЬ╨%╚$╗чЇИI▓╥ё#_ф┼Й _}^yg▀&╪▄▓К╦ь┤▐"u╠KuГ+т лО▌Z┼и║jvОb&▌тмHЯv║,╩яїгЇНС* Y╜9┼юF?`Х╜▄vЖ─Dв,мЙzj.Го┐^|u'Ю╒-?╛М╦tєL▄∙M╘ЕеZ═]WхЧO_╜HУ¤-чuи╨їл╪)З╪:с|gРф4┌└ вZИ▒сф╟╠|б╬CОsьЯ╙■п)∙edNлgЄК╥ ,е░"┘╣√жИ[J█▒uq2о╟¤nOkЕщBР1ox┬RЧ8Т┬j-щ╪%)Г┬J&LДDH!з╖g2д@& ╖УЙ ж5;$╟>я@Хш╙Дтyn├;3kC√°5ъH 7фk5Р°Ж√6Sво@╢Р|Rю:╡ ╩eyЄ ╦мy`D_жY■╢X*QF.lЪ5у╙Н┬°D|pлd┐LВЮДД√Ф╔z2%ч fНY╫т*╡╗╗Н|╧─К4 XF╧▒НG3З╞!nwnzZ═У*sт╔Зzчofj\╖i╖ S lС$y┤hў╫РkНc╩ю╟и7Q■O√ї┴╘ еM¤О╦UВ┤q╩╢кР`мТ)ОLNК╡н5Х=zхЕ ЕЙ┘√bnczеыX╪мР╤Еш╦вh3K1Ш7р╚cы@■sб;ўВгшэчб┴╝Zi[ёй5>Б╥P_`d°хDC>p┼ИЖPў╒╛z!o+>ьnяЛCeЎгЎЩй)▌Me2qP┼█f∙ИlqШP╣w{╞УsЭtшПG┐Ы╫@tS^IЎ├T▒╩Kў╖вУ╖╤ЧgОwїBЎю▌y ╡wє;4■aХvL╖О├уЦ<&ЪлDр╠╙Ў▄∙9╢жї╞Х3У-п─ КЭ#UR(ЫQ!я╤VЮШ╚╝Дb#evШ│Т8S ░╣О╛╜kfй_┤!fП eR╔к╤Ї╩в─YФї ┌ыAа╥ржf Cу>#├ч$+l\A╒=wFКц#╧ж╜kн▀╜н┐y·з\IN╧єюЭ}0]xjо,]Ф╨E┘4╔┬fvЖP%л╢╞`_QК╧ШJї╙■юЛv4ЇZ╨В╨╩%+БgдsэeшФ┌D├┘<"У╧єГ╗~p╫ $ю·.Уi ўB├▌%РН¤V╥Ц@Ў═Х╝о╪\МъЙ▓"░a└ [╞hAшёw:Ы─иrц└ Ism▐|If╟Wq╣|N бхS(6н┴ !ЯO;:]▐у▐╪╛╖╣;Hg\3▒}Ї%Гс0оє╞┐█ХСА▒wа;╒<Сї╩┐}J>╟b╘уи╚Z.з=чЄmF@Б▄▒p?╛ю+╖.ЛяЪ╜║Xc│h ├HP╩¤8L│ЗtЫыЖm╝жРxд ╚╜[М$░f╙╦■[` ( BФ╗й{t^&┌щр<└ щУ?┴Q]┼╘CZ)╔М1╕░}█√°ЭЮз|>│ nф>8╪єЇ>╩mo╖LТЄЩ6у*ilg<█ш "│z&{-ДбЖ┴╧Бс╕Х █шв┼Мb Дъ╠!ьQyd[▀Ы ыцхаP&ТJ ╜а▌▄;Мё]rs▀ЖНS|?╪Цдо┤/ўt▌Rуй└?и ┐╦╣c5XYXnKT9ўС Й▄nс-I┤OnВ╛]nHAеn╡Ю#▓╬ёЄь!╖P▌фыЖ░<║w*╞y!нЙ╢d~╡Ц╩┴R`FE▒СДЬ 0МD`╤iЗTА№`Ф7М9·╠╪∙Сu╜щПэ▌ЭИaЄ|√╓· уап╡Сф°╒ЩЯYr╦R╨√gзЭЭfEЩ╪iX═Л°ч%*6j(E▐`Q█7_ч▐:ЄЎунw,┌?╪Wшр╬ю┴-{9Жo├Шжу4Ь╕{ЁЄ&MqЄl¤└┤░a°~ ╓Шў╩╢H╠╪жЭИП∙mGкk▐%И┐B[▀ц╛№╚,%ї└─0хжш"О╙.UR├▓ь╦:┘гЕК?FBё╗[┤Ў`╢6╣╡8ЧМl"uЮ╪<З╧РNЎЎ ■,эЯР╨oMa├в`Jz=ю╢oфоl┐б\HcЬь┴cр┘yD ь╓ЄїDtЇR╣─*Пwц6ИЙ j$TB(┼ЕцтPAS9h┴Э▓Z.Эм'Ep9I√╗ЛУ╝▐vaр▄╢о╤X7e√╙9╓!Б{╬ти╔xe5bш ТЛц│mC┌╬Dа ин╝Эг╕░О│╒╪╖HЧ(юL╫$OЭ0SШc═╢ЕHОЪqТ|Йыт╢╓╘юbиP├lб▒rj─╛┤evZеЦХиФ╙мbхъMO░▀$Т├LзКЧ┌oеIpБб╖T к В■▒&е┤Уz[4Oч2цY▓╦6ОЎDKг*?PЙ%╤@Д_#<ТО┌<,~ ╦╡нДлf░hZCj╔н└Ж▄╦чдХz▌│_+hiн=3Жец$╞Ы ab╠Ь╝ иЪ,д√ФП└Ъ▓АM эчЕ ┌&Ho╣SХxa┬^ ┘▒п)4▒оZ¤r╔ м┤/▒1▐О╚F_╧*ь F&╧╗nёЪ6ъ┘2┤кyB5оБмk▓·▌¤}л(ЗМ╨/DНT┬ънQЕ╧С╧8▒X╛КQЬцnV[G>╚яB7ц*▄ИзЧФеу ╘ZIЫR ┌L╞W)XE ▀} "]!├f\VKcw═╧╣╚П╝Qф@ФШ№Иa╠ЮA?у|РеЪ╥K$Пd╞С├Хё|├╕К╪beЛf)6▓C!eЄ╢@°\·8С 5k3█,RU╗╚хЭz(╓s #7 dўЄ╣п╠ЦЖЪ┴Iе:х№╒ ╢╘$├┴╓ШщНV╙ЙхSОи}ФЮщU~бюсO▄1rї`▐╧;.KЬo=cХe3 Д√sбд▌╕}Ш╠DУ█puO▌╨m╘Мя,Б1/╙%4fН░█·CГИеУї┤БdЎ-∙Q ¤@ЦвwB`ёг╢|KM3╚.u┌>F▒ Q╤| Є;╢ Х■hтКД∙ E6кЩ°ЬЪМа╘╚|bд╙ шяv├Э$ [┘GмL=рГ хЛнЫJ╢ЇчтqЦO╒─*X╝4ї╛r║ЯлРfЙ╪№жфc╪Фz═Qажg∙PwП╟Ы■1·Щ▄fС╪bKчЙє┴+@ф°vТЙ'(сС"▄▓ща┤0U)bU!(╡л─[1Ч(l█╟мu м0ИU IМ qvF #HюcтРцгD╚xМиуZ$vEщЖP║Mq ╣bdШ╨t░ШЖMT┘ё9Nl┴╔Мл╔є╡ ┤Иb!╪▐7uЦ▀┬t┴Cыa[$╫буIаёМi>rзПZ|)▀P╕НpjtmOPVд└ЎF█ГЧк;LНi3K╢uыФ░╪▄┘(YNЮU╞мэ█KК╧^║ж╛cbдДDU┌щ\)▒ЧМ(R&6╟n┴Сжg╪и╪▓║жЖ_Ё&оНюф[ўР─╚k╘уt^KfїЫ№kМёD┌єГw╚XLЭ╙ЎНётэ+Б═F[39W╧}╪*г╛ЭзSn┤ЇK╒▌ўYН╔{ ёо┼bмя4═╞?ya╚Мд}ш-ТЫkСС дЕFОO█дSQdFЛ гСx╓ўE|їе°БФh▐#·з╟bЯ9ї.э┬;RL@x═/NT_Эe╖VО9bV_/lyЫп╨Dд╢бЪ┴йп█Sq╚.│╘╡K∙b┬╢ОXєN ЦR6HР╢(kz╬╤Би╖Ї∙┬╚+нэЕSЎФ@№Ъ╨|u·ЩЖYcл╤yе╔▀У┤╙&┴Феon%╖·▐╙v4QС╕∙ИaKИDJюJQ$tCЁT╙М<О9EL░Вh┤▓Sр( PЭ╢╜╬HSхa;,ЙНS╔л╓4I┤┼аLМ┬2iО%┬H▒░Hю┼║Т╟MШ╔▄0╝v∙~Ь,┌Й.д┤@╚ ╢-RoT_"3Нt█╟╪5W╤▓┘H╚ ┘ф┼щ┌╙}AВь+╥ч╛Иo!gKR%5GЫДHбc б┼8ЫД*Лєаm0Ўсc^Я╡┘ Є┌д╚╜╡oQ╖фўy1cБgы+Mk[AїэЙ,№╓║▒я+cМУТ$┤Q [NHУ─│ўv╛\ЧД╞йvьД┌IцКР╩▒┐HБ▓╔√╬╤p93│Й▌и╠hЁ▄gф ▓n▓╕K═%7G╡ЫЪЫ-гs_Фa$Идр0 Йщ╣8▌нvєkq.m┴┘|┼(TmЁЗ!╕5~╟Q╕2k№_:КД@2kўMХLa^ЮР%S(E>%X╗р└╝И─~hЛYЙ╩kОЮї№иЯaждl┤╦│}░шюйeнwчг╩·╙╝Н@R_Є[`▄╢+З╣б~,YД√4vL·┌єи9ЖЄN╛╬╛QЄеДГ╡hRp╕Ор2а╓nBЇ;1H═╤ЭГ#╬е▄ЇВIъSLГ`ЇRЭ #▒╣█З▀XЫ°К2F┴█1┤я¤ьsбf6м│;H с{в╙PgЩтwЧlGГ4z╗uш$╒?╪m┘mbNр8*ю 3Й┼ЭЖВ╜╒┘ъC$чHВm{Ц▓QПщщ▐╣6╗[─Ыб┴f~kШЇФ┼w╖У▌pЦцI$╖IнтGЁGй╣ MЮ╣¤hЦ\U■= Кь╞ Sхs┐ИЪЦl░СёА▄Ї╝р┴М╞ М@№ўє[kя╕Ьє}YоЖnўМpKо╠Х'"vь╪╫╡Г╡блФ0ъ╔*FїЗ╨~Ф&█U─╙їvq>jR TЮYБqOїЦд(w, Ю qчP3j!TЮ)ў,кС-├fu ╬Иaш╫э┤*)\╘ iС╩л╪И=║#UCn¤К|nФщp║ЖЫ▒У╪|RБ ╣░В_QMы°√▌~nNGеи╥4'Ю├штE НQ`D$u?$|s\B4 4S7┌╨╤╜╩(Iб`<├y$( ЩрН№▄ФJЪPЕвИ╕Z&.!Гн&└@!T;k╞W&дH}ЄL╤╣f3╘KГ xЙСыхЬ╔DFEм┴С4Ъ  BM_b6CDW║m"й0вцЕ╕ш';К+IиИт5В2Е╢и JmгkЁR(▀ВQ╢ъ^:*"Иz|╒O╓YYлSв]H┬5МR;┌Gm,A═93#^QGxФ<╪8иCуzMР ╬Wе┤K·B=fAв+fL╥aюяO% В╧ б >л├vх(д 9SxУ╪Ы╘.$ W'$ї8╖dg$+Щ┬)═╗ аа║"оgТ▌*╪KьпО╨╧Ж9─НХ+Т;з╡ПИ■fp┤СJ#з▀ 7╓╓ya ТЖIr3ьaЛp■▓WФ`J]╓ !"Ш√)H(Бв2^║~5Nв,CR!Гя╣оb╦FZ1%j^ИfК▐ЫAF т{c╡k╚9mILаЖ▌╩┬┤p√ Й(цCэ AиC4A┼иCЙQ╧yH,Z4.9V8=╝ъ╨К─sб5yr¤J╗ьl!hЎА═:<[t╗їюu╛ЩшшКйТсМ|Эw$╟Н1x╝v7д╘И2ПX╖╢╩R▒дЗИ▐бl3╪!"-а┌Ї╪ЁД╜═ржO┐│aG6│╖*иБ:,Дq╓wЪGgo,?¤[С$╔б╔┼ЛйА Цn╥{аlрМj╧ Щ5XЯ2pe√FH╫Шъ!a╝─жДШщqZ╨4ъ+qKb;т5AЛО▐Г ╜?3╖,й ХцЙq╪5Х┼LTЛФ/┌&\┴*Ъ|T^тНL┴fТLVEе4ъ╢И·b╛▄·╚M2(╦OнШX╝ДЛuе<п.╦╬*╟Д-Ъ┐▀@ХМчЄ*dW├уХЛx 5K╤]DDД6═AММBд33Е╞╬;h┘╒ю╗гЛ│╣S╜кк╖dPzIу∙5ВЯ┬ў┘L╥╗.}├9¤╚EDБ(═ЦBoж┼a3{иё┤C'IС▒РеP╫oс )┬qИУBи╪╥∙юкeч0жЁДбЁAТ}╟Ъ╓Ї╕14MД+q*zGОд╘~ш)╛b<х╙ФFEm╔,;T]шQ╟jє\єдi(№K\▒,ImQ╩╬╓"+В┘B╖Ъ░ц█AжЗ#PDЗЪФьг3░|╬CЪЗчЫU =╤ ╧"PлUr9нИн 5┘w9н╔mМh└И4БAz╝Rhи$ИЮ╠┘BгBиDy\*С)Ш╓ў7є╛D╟┬╠hЙUЄ}!─gYи0ш╧шu╢mX¤╒*в├ИvВЕю∙S.Г╝ЦH▓p╠їтОv╝б*!рQ`┬Я╩8МiмХпУпЎbt+7╝#1╞иЗ=k▒м)ёDЛ>х7ч>-P╟ЕyФaхiщ^BЦ-¤┤QП3▀│╤Тt(Tг \H█ёФ}i {4h`╪CШ3йўw єбQ:KгФ╓гм│Еp╬ЛF\ї│Є)%┘─╒Би З┬─GdK) U6ЖЕLГПИВЫo$┐╓слж9nY├V1╖1▀Ц"<+й╚Jї┼ПєkC°nt╧2╩ЙЗ[ьKbжyC▒┤^rQsъHДDУЛ2UИш=╚БЛ█T╢V %/╢мв╘л4ЬЇХё╖░К├ш(#1=╚(ы╗=jPL|EТ▒X▌Ё┼т#▓▀]4$<│║]emQ┬У;К╝\▄p[M· ъВ▒Ф|C╙]WШОIKсvZdЭlL╥2U@╚O#${┬р 09Й╙^┼fИcраZЙex╡vW;т╠#[┴] S╘╪Г/╞▓єФЬz-Сч▒О┬$^Р└рПv ,¤С:Я╠дO9 ▐F─е╜Д:aЖЄх·ДрЬ)ж┌2kX3п├Ф╥pЩ└ШлЖ╓П5i$УV·ЖД&)Q╡м)╓a2┴оATщT%?ж╝А ]╞2┘IК^.М#+м╟#хLЄСк┬E;бч d█¤НfяDV╦$(Ї_Ъ╤¤Жa╢а─x╠┤~ї┌╛░fJVЭ O=┬В┼NVж/вАТ╙;й&$▀5Й┤P┤Г~u╙B║▌И ╚▀W═┐╡ПБ<Н╟ЛoЩ╔Кi&hуЙ╩P6╟y~─Z╣j┬@8й3/Cьy OШ'√dуzИ$г+-╚╩U╠М¤h/КyК(H╦Е┤┤)√Т_╤LЖь0▀I ЛУё╓ёъНъє╡Оlн╧Е╣╙ж╧┬г=zQ╪B=▀`бsj"e`╗f╣■КрРд╡/-J╔# yЬгм┐щт█h┤к╟Є┤"0╪IкиЁ┬^╡!ЮT0Ms▄Yз·z(cЪA║КpС"┤5 ▒ЎN╦йО─eж_Ю Sье■╨пк!╡╧╙М^╚▓yTеv2│▒($e3 ..1Iгы0ч(у╘Э)▒ШРzABY6Ъ9LМST─Csv kО5Y·`ЙE╞bИ║!┤еф"лLСj╡¤╥╘ НB╥'D│╪╪Uвy2в$╜Д┤fТ\;@JЙIСQЁ8ккЇ═8dJвЁS5тQМrfЪС╛╥q╝°уїD╟х■1ЮбшЙtV.Ma?зЎT^8 U,9а"юхK3ZЮcМu°╬ш*Їмe▄bт╔╝TCVyX╖я╠z\4UьЗ╓_╥╕ C·╜0МHU Кd6)МсбsТЗ╧эu╖ЛЗVЧm╙вT╤ЬXwєМB╚LЛЗв ьл]0з\nд┤Ф>┘╨ Э┤╞▀N╫№сМЮ К/wШ%6EщkнжR3ЦВС@┬ш╚ ▒ЯIO▌Ня&ў┌N*╓2;)k╣║!j╪8VРИaЛ╦(-ЭтuН╝ЖЙї║nDq ╚L∙┌∙фjЫ;X ╕: ▀=О▓WШ0y S╤▓╘╡Мч"гUL|n╘JuйЖ╤fAnШЩ╦╦╥GМ┤B>*Ъ╫<ч9FнVХ7Л<ЧtC┤ WМprYIHЛ BЗевB}▓d▒rаtQ°Ц:╗їХ№кDї╧ P t7▒Й~Еj╚CS ЖS%"#И!\░║╢шb╝г▄Y╪ь┘Ф_{R│IЮjМfЙI^╚G└х╟─╓(ЮЎR,{─ Фbk▄░PMR+╛┤ФSщў% bnг5<╢г% ;Jx·¤rY▓идУGХэс╝у╚CуяNБO╣D├h╣EDq·IвОз9▐╨. FУЄ93б ╢G╖qЁВыiHнМY4%7cэFсjМ▓^%Л0кr▀▌╝f┼K┌;]К┘-░yа┌ l?ФS┤Я╩▀Рeuжц┬√К┬─╚J╔╚т а√ТО▌х1Ые┴Pю┌Гє|ЖblЗVt5ъ═ гв°P=╦╥]F▀ACзб{1К╛м%║ї1МcIbБЩ┐╥ZJшЕеd№┬░вj╕Ыj{эзО#d!░╞╒ ╠├4ФчUBi■є7/ Ї╚н(`╔╓WЎХ!3╧Х▀с?√·Dh#xAQJЪFJdДtT9└Ю┤q▒'PYў+я7╝ъ┐ёїЧ/4%╝ V=╦√y[6vаЮ╟Wh$ь'UBM╒┬gЪ[∙ЩGE╜Узяlж(qЁЩн╒ИF╔D 7TтY$бL\1:═йf╒Иslой┤h{-Г╝ ╠|ц жZ=╘░S╔}V╖█S╚@`╝╬т%b╪г▓3Р3\∙╚└C╚Бї %┘Д)ОТ3¤R╚!&▒sЁ▐XЭжVфjэ╪Ыx╗▓n╓((╞^кЭеЦYмvHоЩгUеG│5h┌C-H5NИ _ўЕ╘Oa╙}З@d═y"дц,WБBЙФImёd" ЁТgИ/KЪ▒F╒Nй└Aн&Х╡Вy╝m▓,ГFNе~B┤Ь9H╣f%У╡@+j─J╡%ф+КD┘Й!D╥0x╒їтС7uv·j йzQ█пп╓ЫйЁMи╧b/5О"[ї╒▒╟Эb╩╜Ёa│BЫ┌ у9C╝ы╛`lєиN╠═╤0ыЦтЕЁкцZзц%ДШ▒ЛЙвБоIcZChЕb╒Z$8 1н╠┬ %ж■g2ьс╟T╘╩u #И¤╛ЎOC! ╖─┐·Jу▐F╢ТLg║╡ JEt|D┼║_u^╨V&═eЫKd}v┌x:╔)░ы╩3╤ОхhДMр/ЇЩцшЎШYУЭщщ% bЖxRi@╨м&<.n╩zF)!4Н╫ ╝к▄П+0МА{ЗеЛ▓╒╕ЯЖТ■╞'jк ▒╔^┐╒╩Aз╞eZ╕(╔ 94╜Q╘!┐CY╤uшъ╗1s╣КJЪ/╔0░E6х%ч╔oh;їJъ; ж╨╗╟@пB"╨▒Я╫╢НZ ╙ъQ ░J$=.╓╛AяL▒a╩6igUи╚S╖)▀oерЗ∙│∙ї√▓╝■ї+я!жю▀^3╚пї_G┐эпКM╚puWQП▓╢В)ДТ┌хп8 Ду6д╗mБ4ВQXhaДлF╔э╢ш╢"0щ· оDН█╞6щn[а*P▌з ¤p5╧lї╘ ┼n¤█j█┐t▄ ╦▒Bcе[оnzTМKLёеb"░2щ(CП▓чg13w;т TOP╚╤LX╡N~╚Vк1`2F4C $K№mЄкхзC║╚█░zи9:╡зРzзЛ"╛╟я┤Ў6fSБh╢буЖХ@╬Sє│л╓SЩё7кфB┌,ыHсДшN&Х╞№╡З╚вры╩Ц√ !∙w2I┼TIЕ) ╢√▒┌є╞▌яRJY╘╜LЬ╧░щ и{ ╗Uх\1UNб{(¤·кa*сk.ЎАо.ЎаЮЛЄЄb6E K╡OГЄи]@г%Хщ╧а╢РТ╔r<Зъ-яТ∙NдX╩ё╢XСЖкOC╖_Г─№╒~БrIЄ>╟ ┤ы╓>b═SENhtєл `)чхЭ╘n█▀ыУ(▄Ч%_Вt&THЬnTKT╟Ї╢r╗ ╞°9 ╟ШРУ0L╔N@е=И╒тыГоМЫК1@▌*В╒║"j╫sUБа╜ckНЬь'tB>]$╕▌ЛЦ╦л8BГ;!rXш]эZ▐╖╗YZt╙Й╟л▐]е│╞┴ЇHR┬╣Гє╘Эp#ДрqЗYF ╠Ab{╥IQ└&V?ДтйЕ@uf ╙s┐╖+Аx hS°02Б0ч║!"rY@шт,{3|6Вp)хо┬W╞з■4╓ЙСФб∙"▄_c╬bxё┼A]э╡BЭ!╓ХМYМxЄЎэKшЫ▄ЇЁоdV╦nL4P║─.иЎЭЖзhLА╞C з·┌╗┤ K┴L_eeПZH╒╜∙╤╘їjP▀╙╢GdС■¤Ў_)°Go7;УtЫ╬є] */$╞ЫЧ╘^LЕгEk.─ ▓=▌╪Юr╩i┴c'№ЁxёQ╣bР▌VшyУyt a>╡░Iu╙│cЗGьащV╘*╤ %е ЙQ75Рк╕н┤Зi╥╖°Х┌[▓ЭД*ИКТU^▀─╒╙5╒В╓DЎ>▓Нж%Л├шkп┌ж3╓М░ЗnВE6ЬЇNz|ЗnMЙоBjЧгеЇ╨,9РйО╗2[;50id ╩qI▒╞ДХНIДЬъ█;kw└шС╣c▌3Pрї9~hю ║3┴ДA┴╞╞Г╞зхж╛╙йDТ@T$m°AU:)Мв6═RБac/╕ы╪}П2s-ъ84 2Т"ЭbЪPБ╞'╬хкze0┼cЩга.ї─WЮe\РС╪RЦlX,Окy%щ^БHЗ╗░єыDHЧ╠№П*F╔ўКєs2muh№'d╔ лпФкДбь╝╜Y!Гb║РCЩO╬B|JНШрSлс"QcТаМ[CЙ ^╡╓~Г-L╒╩;ДLб8Р,Ш╞9-НRэlшHdО~╖-╩н╫°]╞Ъ─ЪЫrш╧yГ4BЁJ╩At╩╣uи▀yIGєA┌9╠b X|┴п.qф╡цv▐m>%[E№)NЯ╬<]DАў-R┤x5√Х~ Tщ2*и№@Л╧ч>зcЮШoy.гЗ*└┼eК`СP╙ЗшeGЛ'PЛКr╤ач2й/╡є╣8╒4∙EXЖf/ющДк╡╨вZA║&ю╠ яВQ┴tШР9^╖Д5П╫КуXФI╟.СqM╙ЫXsFX+@Нj Иаж=2:DT╙1кK√и&YJдЛиЖ╝]T╙Д[tx╒о╩Иажr─"wQMуИ1Ў╩иFВ╡ўQMё s▐Ы<┐┘ОkP╙Р╩╔9г┐п∙{Нj`з╩й╒(*4[щвZЗ╘и╓a╒╪ИyG╒4┘╚┤Tг2&├ТAНЛЮY№dPS╣ЦП\Г_m*─[PsCЦH5╢F▐KPвhъВ"1ЎюВZФа╓A5иuX5╬эГЪИy╤╕]P┌№К╘PЪюXГ┐яО├]PлXsOьSЖyГ4ЖkAM│╓║╡┤/#ЎдE5QW~│╒D╛gЬ╦и&$+╧╒Y▒-кйё[Чи]╒G5╤╘PuQMфUFмjxМ)╦╘Dc8╩╢а╓ВEЙii┌└└\╦<"-|╔;Э+{h н ╡ЖЄKD╗√fД┤г╘╡L░╗Вйe*г╩kЩz_0BI-S╡▌ъ╕]еUЛ┬╓t╖шБ/?ir╥╓мI5b*f╪a4дЧв╦█1ю tУ,|Ж Э"╒╢2╪═S6iUжLСпX ]цP╗'Ўкс}1ЇrеFм╬`ъ? IС■>ю/ъoРFJ<{М°▓фX;A$■5у6и[iЖуvB┼Ъ2n▓Е└Ї:Q5БyЎы┼h┬иЖФ╕мeж" м█жY yI9'F.чоТФ) dыt|b▀IХъ;$ИЮ`ё+┤*┼ЩvU┤81Pw╚6^и{б╟╒Dйё@xs\d/ч├/║т`Ё║Зb9╬QЕс▒,╘O╢ZўДКИ▓▌'9КвgЪe[o┬\aЛD FW·╪╣аZobШыз*.╜дФ:▄─Э∙|@ж]I¤2MQщщpBШx+╩(6Л╚VвЖ╢з l5к│e▓{РeН;╧<∙1uцwVВJя8Д4(ТM:E█cФZ"CMБalбS╩░ЁЯY┴╒╞▒)°БP|─:n╓ЪX╨БMp("FуеЧ∙P╗bЮ╠ л'хsРm░Г2МБлGjd`=),ЁЦИ1icйi▌ВEfЩЧ]URИ|YаNeэMжё c)х]сD°┐ы туzI"┼ёлЮАкUДgd╠л─c├ayv╙▓6И3y1B*╤═/╪>╪BsUХу│l% ╙fЫє╣LMиЮ6DTИъ═Б┬a{L-Glго_╬Щ└t°VDЭш=╓3Ам╗R Wч7╒яЮ>хяжl╦/AYKEОeДї │И╘╜бУDЗЙЗbєм`;╪v╟Жt]{пHeНQbx8┤]Б▀╖p▄Ъ?╪3Ро[8"ФH╣д'╢ьkл_┬г{А'WUИ√√:─╨Ёжк[╚ъ╛RЪЧL#;ЇТo╡8ОтвbфЕ,Pы+вУT&jF:КЫC#ш░2фOo╗kВц╨Ссhi═ J╥ДK?┬─ъFп!к│к.*6нQ?4М║ЧBЦ6▓кq╡Z}ЪюgЩЕ░╠)4Їs║ўWК-э0д╩n`гу№+О)лМююВЩМbеZ@ >м╣╣ДLW╖╧'ЇеSИ┼╖Ф1╛94вЙшCjH@¤└Й)ц2║[]О╨Д5─ёыfG╤и*№ВЙХ╢&dмр(aЙ4NrбЇУг NфE9╞╞┬А╥<┐Уbd■╜8Кq┴w╒Бз┤╫ V▒.:╔бкоШjк;¤ж 4zТЕlйїшХК─├├k№ў╦Чy wШ╨Фс<г▒g+"╕н?№╦ЯНп °█Ч∙Є├Ятп_■тхЇj╕ящ╠аФ^РЛ∙ы▄|dє┐√0._№╧/ ╟╦▀¤рO?╫┐$2╩╞Я┐№_А?4X■°w?xў9╠Й~№сO╡Б╥ХpШ\Ё╒o>ўЧЖ5ў]sщФ ~їГ√ьйИhC%╖6·0Д\?MmХчл)█я▒¤Зс╟■БO Ч№ў{∙oиEq`%sЧНЄ>эЬС"╕ЮSЇЁ▀Є▀сs.▀1Wдpёw:№╦ єЄnГбa┴;■№·х_░рOrс√л■╕∙8═c9жи╣╝X╣Ял(╠ёЭщ╙┤]_ї_¤}ЮyКЪ╠╧О№уxp╦oiэ0╒№8└Ўq∙¤{╖┼х▀?KqПs Ц▀T▌+╬НvUтд╬ЮTАi╧┬К№ьvDхжвbШU;zяvыщ■їRHщыц@▀л▀V`{zo╙Ц┤НЎ╟= ¤■═>Лm}v;u{╝YъэЭ"╤>ЬЭЭХMЯ┐ИЮSфPJT>о;ЧUK╛█└│╒пЫэ╟┐┼д╫лв'╥tў┌▀┐▌║ьr╡│╬oп╟Р&ЕюЫ■щ[я╖уMїы√√╜ |Ъ&+n─жv║▐ж╕bG╟єЭ ю{;Sп▀`╡пх Зй╗v√C╣}YР╩.╩е╚еT8ц3cВЩ~№ ╔ш/6╜ТЧhъ#Г┴▒RFSyRO\Р_╜№ьЪ┼Jr╔,╢ д_g1UCъ▀╔bПйеш╖h 4В Rж╒аЎ┘э*eq∙╜№¤║ISч╥9цCЮ╝?R[┤о∙ █йбЪл▀НTР{гlЙ╦eЬ·0ЮФб"[-[fpкG AХЯЪЇТвG╩─iм|ї╧∙хЯ╧;ЗСКцd╞з╬*очhщ{7m-i=Ф ФqЧПЇr"nя░▌╝√#1+╝Y┤ўЇж∙iЛzю√qхЪЙ▐@∙th╖лyЮoX╘g5e0~&$я▀ЛФ╚ГHoU~─╥ўgКЇ╒/ ║Ї7е■сГ ╤(R_M▀Ж Х О╓ел>М%Ш_ў╕еЯЄ╩√▒Ёъ┤Ъпи#,G№┤Й?╩│^k└шка▓╫Я=▓{╖]╙т╦╗Єщя╢kш3ЁG^оhй+3Л°^▓,y╕^ нjвLкча─'с(шЮkЎ├ЁУвЙ¤Л╤kХ╡сQяДъQХTуЮИС╤°vх┌}╓bC┘(n° ъj5╗ц╣U╛зп ┘│m╩ zУH#┐}∙L╗╧Ч?╜kй~чЮo╝yY╣R9■Єe GsёЛцвYA╡ШЁ┌uн)GЕ▌┼}}ьк∙paїь├─кЎ╜╣ъ╚[K.oFZ∙Сїъ└▄fЗy┐ТUecEРow√ую┬ЯfDфЬ&╤x∙у┘L%БC╜P&¤лVкв╛N■═╢K┬/ мД┴?)С№Э╚┌ї0'Р}[їпBБ╒uxЎTеi-╕▄чй═¤с3╡<5Гт╠¤Ч═ф/╞Х7-U╓эMя╬▓}ж╞J═╒N╞@∙є\ЪН^Ю╫7═Є G,║l╟щy>¤Юъм╞Sы┐ШфЇ,╓'№■3▌_│~Zjтс╞Nд_ТЕ╣{!Ц║Y▐цбё_7H▌╛ЬЯЕШg }уi^Я&Щb'╘9`=▓<┬3│|■Ц╖>ь╢фY .3>m}]у╢ПЮ┼ая╞╠[Ї╣sР╒UтлЦЛ╔*PяєC│R├^Ч!Ю*ыiFюс╢}_j╪'ш╩<_■Ї47|rh√Эбў┴ SНсЗu;╧№Ik"rД┬Ц┐|YъQwN Г*R╔|zи72KicФ╛Н`К%┴╒I0d^_'m :╛NO4Ъi]┘З1ьJQxbцsЫЖФЖ┘f▌*I Aа╙[╢ЪЦ? ?¤"∙в6Pб!жIў.ЪЫЙ.zи╤sъQ√єоVН?╤7Pлў&√├Xж(∙║·wj-Aэ╫┼,ПUёёE╩╔`w╢│юvы кW╩║╦SV╫··■▌82╙{>Ъ:;LmN?М^\■'uї░бО}ЪX?·в ╪╦╝0ЦыzВF╩=FЧ▒(б╜,є╚qk  QЫKХ┘O'S\°▓w█igZ\╟oЩH8╬╨╘9^їp╡╩|*5╫╡eп4A▒,ло¤ї╟хпk3Ъv▄П╛Hхня█┤дHFs╖Щ"Q╨Ж╔Ф╥╤Ўnk╙a╫Х=║└M8t╤╪Д√╔Ч/<ы4aг▄√╫/Lv)ДD▐"№║└░няwф"Ж■.▒┴У╒N═┐╚■√ч$Ї0 x┬√мЄqЖЄHz▓О┘7>╙^гPлы Gє│'Шn^UьН▐╗~┘7)Vз В▐√э ┤NЭ@0аМскюЎў#i┴▒ие╜■9 ХQxЫqн%дm_dм_4▌█╞XЁГ:л  z▐С^∙·╝Й|Эчu│╘Ё╟V╢MКГяЫ/? Pитэнq╙G,аЧя╗┤А▌VН<Hл╘─c<Ч▀╔Ko╣жEє.*╘G#yО√Є═┘╡┴0Uўl─k╔с_s╗лMО'├ЮЛMфы╪фYїi6I╞ьш╠┘Щфн┘.U╒БИw├hq╢Vр√[SХП╪i/єwiз4№@a¤ PфSW╠╟V;P▒▓╓ яw╪х╝mЁ№ ╪хy ы■pw5ДїФч█и╬8>4 =7Nt3^Н3СпaЬу▒╜_>┼8∙l┌гЧ┬кпИ{╡\У$ЭB ¤═ЬKCиzЄ[2у╦э╛S3^▀╝╥sБвў█▀Ч╙∙▀■Tж'їW}m^xЬjД°ж-║Фт▀иEoн╒┼в∙:╜3v№4Л^Чю¤╦│ж∙╥c┐cn═ю,В xИ0 гэ/Ё╟^▐сSj]Ї╡ ▌?1ЄюG╦{┐O;%~й└)рўoF;╡╞▀i┤+^Н6Спc┤ы▐uнК∙√oп╣∙ьU┐13ы╞iFzБ>н)В}є═╚8Я╖fд _чQЧйлн?Єи▀Q3rХя;┤А╥М<шў▀М№Зэъ█mFжх▐М$ЄulrВу·4Ы№ж╣╩№┌iiF·=5#  ╗№╓ЫСq╕7#Й|уй8>┼8  lF.╖√.═╕4#╧·¤6#▀РE═e╔╡Hрk╪єytuєG═∙ ═Nф" ww▌И№Ny╛Н>фўaв ▒>ды├оы√a╣╗aY├└6}пk┴№р]ЭogЧэпёЄ╤e:¤╟╧Ж╔ўй°rЮ╚qП╙ ▓ї░bП9]юж╩Йh }╓s?М?╜И.ыZч▒мЩkуУ.║√▐;:y%юЭ |¤4Л▒vЫ^╟ї=ФЪкL ╥Н╦лHs:▀╢Я╦фэ╧▀ЎНл?Ф ·╘OЯ╚P@╒ ╫чРПЪ№?╗▄N/▀L┤иЎ█╝ WМвhймgК[┐)╓|╠e╘\-тк\Е╣╩хбЫ┴ХуcЪВюЎmhJr▌ hcg'zё╒rї╥DХ8Z■ |╥┌ПZt∙█\№#,ёъwc*▀Ц┐Ku*_╘ aX╛xLIщ└пїBдx?єЄ╙КfN2╘<ТЪа Е√╙JAфЧoЦЩтж·жь°╦Чuy]O▓▄AЫ╗Сй╟ёuЩ▀o├∙·╧ ЁЄЛЧ·°√·Ы°dЫЙ┌ U┐О;R═5ЮД√y█ЮAu═п╝╧PцПvnzев~N;{n╦√i┐ИЯOб&┼щ░ь▀A√√сЇЎДq└╨╛пТuy┐LЫ!Ж▄ч2^ "┘xш+№}<╝т/7шD┼му└iЧВ╔Яу╝?╕▐9НFXs>BwМу∙:─Щ¤╨ёP▒z╝}╞м+Сt= █∙к"y!РЪеэїч^╖п№Ж┴о├H┼▓lР?█8┐?v╫yчN╕▓.√тuЕ*o"lZШВЖ`╬шДЫьїH∙¤ч║[ ▄v▌╨FWя2ь"!ШLzБс|П%Ю╛▓!9[Q)RьЄЦПN}№ж╕Єя|U0='k┤= Ъэ▌1З:jЙБFV╜ш3миYn═'IM #iўБз▌&т╞JRТ┤╙√aIу&d╙%ў}Л▌ЧQХ,╧=/┌НОих└╣ЭRРЬяDщZ╞?/╕ї┐┐T(5j{Z(С:┴жgiк▄v"@j╤▓OЎ>LdР▌?ГФ3KOЕ─┬ЯB<╓r]ўИдГZДл╧╩Сї Шй▐¤8),]D_W║=Х╝jРт:ьDw╢+╝p┤[├ж~fщ╙xО!ю*c3р{z╘Й0Чаf╓И ).№+_ёb▌КUk0╬Г▄1uЬхq─єy╡yЁЁДR∙╔╠ыщz╞d)иТ╥AAаьДщV 3F.eЗ▌╫░щдВ%г)POЪЎа№╓G0Ц8н$х6?■░с@·hЩF▌уX╕ПРЮ═╚0Є1ТВm~7tt*\pьH8ЁxrwЙ4ЬDS!├╢NyA&|єЬОулs╤гХпt┴К!ч╢O╛аJa╠°)Жў╙%╚а╞Y═1N/^ н┬Aeг╜zвZт┌<╟┤(LcP█L┴%∙сЖ"╝П▌ТГз▌'О╢√▒┤)х r█╤*\ЁJ<^t9д №ЬJ╒w:w6╨^УJaИ╟▒FДпцtZCx?╧W░ГРт░ЗъН]BNBе1л╥xЗтЮwp├@tg?╝■Ь*тїпБцA■эїе$ы┐zyGЛs+Q╢ў╟└c ·х▌Ж5О┤k╩·█сp°n%c╧КЖ\z▓Л╜7$U∙вR`=∙╔;щ▄эPГjdU,я╣ДD=Жb┘u╦9#е╚╝AhTPT╨╩┴┴j─░H╫OA┘■beТym?▄ · ДH╟&Г─xWВф┐Jxu@vzц; R╕ЦRэ├vБ0/№[юAФ▓╬╣Ф`Рп╖уE>║BОБГЄб┴сдЪsp>B:▐vZ%>"c°ў╕ZА▓J╕╧Ш7╠╠╓0МгОЭРjФ9p╪JИў═Vд┬бdЧИи3АQШїXЭб&sZu ~╛.;ЯдwэЗBў╪ПЯWЫ▐p ╗╛#┬Д9Д╠L19cdфxвЭ╚б╗√▌pU╓юз╩Б3 t∙`U─╒=ФEМ]uj^═GРGЫV╝▌gLфMЗ▓з`j╒─╫y\ГУ|мЗФDPV▐8A,g╞╝*╥+)Щb▀З█a╖Qt9ўuШlzv╡Hm7Уўх>3┼Щ5}Ь,Q|_d~ЧЧSх0Ра√ЧSЭ╕─├Й╬Fщї█ UU╕╫─g┌НЖaYЗХBVL▌╨Dо2D6SVщ@%zмЎBщrU=U?╢т g&ЙG ▒╢є╛°)╪╗pЙO┴+~!═blз╥OWи╝ <ЧиТР┤H╜Рзq╠SpаЮ Рш┐°ёЯВ\№╚╫╫rU oАшr┬Г bёГEzк╥ПЦ┴WдМl╘Г╫{Kж5╔VпpJяh[N╙ ├k■ш¤з┼&AЇУ╡ЫR∙╟Ч?:╛ИYjыу▐Q$ю+╞J┼аF^▌с;╘иBаBИВЎUMфАх╧─У└╨Х╛гї┘╣║кю@░TДY(/@╓ўу0:> Л╪└┘╗dV╒F№╧└Фy╘∙A╨_╜№og6╪Yщч#Y|О┌°Qg╥ZиX╖№Ы<м╟v╜д═╡┬HРЇ#wl▐▌"╠#C┬{▌1Кепnэ]>4╡:ї\wКдоXУР6}JSF!ъюR'В┌в'в (√#ФбdРcБ╓BХKBбъМЭ6 -ЯК"╓rwвзW}6м▌МHv╜├░~J╤·╗ВТtjЗ╔x¤м$^▒N├w]Z├╨!ЫлюFЁt─гцК7Ыи└жыqT╒ОИъKХЎB╘ЯJ%▄zТJM╟F YrЩЛ│йT{Ю|╦H*║╣ол─ 2┼-yЙ#Пє╣~ТУr(╓Q]Ю $№СT А0 P═~┴(ьH+B(lНРРБоЩЬR╬sЦVи&7ю.Д4=╒К┘g%ПВ─:XЙ╦WвTЎx'Е")ШчнчZзн6YRн*╔@╓a╔зCЩ'Т Цmxk*!?╩'ЮюЄцуBА╔e;p╘▌ХёC╥z:sЕ r╤PПF╢eНЄ^ikк у▄00r|╪Ри_уъsНУ┐ЗЄ&J┐ы7dд▄ZL╫╗╗wН!БфkZGР'°г▓╨:QtIR'm─Yx╢\W1:= ;НCjo╖7(БШоУY#\м█1╒pЩБp"ф,' Эў╕я░┘`╔qтFЄ~j╧Дё╞щ3лUЮеЪНj│с╨╒еЕ2Йwё\ ╣с│SежtyQj╡ьЇцвY╚К6°bеЮQИVёфK|йф4гХ~Еa/ag╙ьwPУЗY┘Їх)ЙУo_┴Р┼ю;i=-е{°ёf╦ЧэЙЛ▌НХ░╩[MDЗ╕Н:YР╪>!З▓░▀*B╛╥╕щ╗┴j1_`s╦b^├FЭY"щ╚T@╫п0N]F-S╟5'ry\м;w│п"°╞дYэ№┬┼dD╕Тъ>┬h╙°Ц%РSI.j?╬Иu(#<Чs'яS─F╖фХЛ▄#.иў@а∙{l─)щВ∙╔╕ L0D╛n\Dе█rг W#rPэYqчыЁЩ╚ъ╬{Д╤═uШД╕єШд&╕ВИgУ%ш╣│м м3Ъ√╙Gkфт%№N∙∙ ─~OИ°J─ёёЦwrеe$иЦCаЖ▌6Л,B─6sт╨╚tшШq+Зы! ╞DC?,∙ЩRbЛЙBжиКZшФtзЇ▀)▄я∙Цд#DЫ░╪╨^Vтжa╙И╪ ]╡╝╒а№∙фЎ?WрлzрвBЛТ:YЭ╖─кРnR%ЛяJyв9МСY√╪9ен╪ьtсМПDГT 6▀┴▒КCТЇк╝Zц╖N▄╓wВpЪj▀q┘(N┘э0aбJ■)┴A╝Тzs▓ЬR╒fИбC${╞Гв&д<Ютv╪╣╙МцfёВP_)):Ю╥зJ n<*╫Ж№}rИзў5[@░╤0╕}wкaЙ╜░O+7J[ОМк╒П┘╔иPтщL╢шсUBФ╒_одuЛ[┬фЛ #pg;Кб/╚7р├HО6╠Ac3щ{Н8Ўы╪Cх+r9м№░ХєVоЬмrHГКJ`вn▀A%╟УОкўН╫щA3йe&▀BРQ*аl█┤U░└Mlия╞Ч* R╚iK *∙АFК C°Ї╥ HйsФеї;*Н=wS2{8хй╤├{ОжrE є?лHЪ2tЪП╒Їn"Z в·╠Sg┌(БHщЁ"Т╤JЖ█ЬФ┴$Пє4├вМT╨Чlш[Ив╕Воiв #Ь╕,.╒hDxвrФ Ви }_ W╩ъ┴>eЖ6ПW"Вцuщъ▓ю&b$t°+5ШSZфDdц^<Ш[В√Г╠М2в,№5┴M_Z[с╔╚'[є{РкZ╘j Z╘░е╠$═├рt╥│ЕЮW╘+ИpУ╖ЕYК▌PeFЮ2НБ№B┴@%1╥S Д▐I╥╔┌6Lф·RДlLNmwуЫ╫HЭI▐е&ъ└╞YPЇiЬкW{Д╝їi.<╣ф~ ║ 0═вхpфЩ Aї(╪┤┴║№)╚к╬r╣ЗO▒V<▐3░┴i╖K `ЇA▒▓}F╚KиBAXЪЧ`Pn─┤Ф├ЩИ&7Vо№СЬухи░╦J°ў╚*T:■МЎkЛтDФP@KоД3Hq▌╞d)"Т└Э|@М3х R~М*▒√╟хfчН'ы@хЧ!тSU▓yо"hўkл9rt╖ж\ЛиbНю3fПSцwЧOBУT▄M╣3┤о┌*Лц╚вzПу▌▌кЎ#Я ┼Вц-Ы╙TBiфтlХыw╘GYкяqк▓Vжw┬d.╠>M╒Ю╦ ыТ▒Уn%VhUСЪKь╡ywФЇиx&б┴╗╪*h╥╘g3Э}в╗╠╥РTk.Ъ6cЗf?vчи╟F╪Ц ч є54√ТРЧj2╡▌┐#╤╞гF1Ж╬Ш'pjv#▄ р╤┐Дєб ЁmyГИи тжеЦыAЖ╞║Ц7│bNту}(у┐░УEX╩KSУ-жь/о▄tнэuU║▌k ХD4i▀Iqi'e7г┴a░?╒яР¤IJ╫=!ДЭЎ■к╤h╪3%ї<Ю╝]>Ў║8РjЇjk$зfт"Z╧- pэв 5rЪ▌╚Р╒╣дcГrd╓8((нbZ╚ J╜,█щ╕}╖ЙP6ф╣ЛЫ|ких\╩|ю щ4лНЗd╢Хe C@╘├q╫ ZаXП&╚)de2Л┴T╬▓▀С мЗz*(ЖrЄь[жВ└IdFPu∙z╦░н ■ФЇI■║}Tщnне э╔b╦√√яx.Uй>bС!hv7.J%лm╜░Ч8ПКNЗc№#Ещ▓ї[!ZВ38Р шXР:dG|UБ>АtЪН╩Т┼мЖ╪єР╓╛ E╕Т?N╥T^AzuУ┘чR3йq0aKЪИїЩRZ╩пZFEЫ v¤nу∙3=╗┌╙█мfз8U═ey╓бфOШП4═е-0u╚%Юp- цпёд+24√ОА $▄iдpU▐yЄ║√aТA-;O╢Ъc°Р~▓╨▄ЪfКAO┘Йо┴t$ъ▌Г═ы╥█Ж╫ [1┘ХL╘╫иvX№ъR╦╩▒▐╦w╝уЪз╥╦eАвщКSЩ╓ег ╩kd╤iКFИ^╛ }╝К"xВпШУ.м5_{%k8тvї)╪е╟З==;╣ь 7\R╗╥║э·╠х╫г*ш[Й▄ЗmЧ*X/╛uwяO┴оО▄╒╖tu,)"M;ъ╪I╠X▓еРЫ4Вя Y цy=ч)ИЗ┐СА╨yЧJ(xХR╚N4kщQK! 8╥°ўЕ,uBV▌Q╚═Зуp+d┴шFТTПBh ^е▓ВJ&оЕ, №Y,═BVРШИоРmPW╚6░7#.A ·╪▓ мЕмам2│О╡в┼╗:V`4еОХВ#╪╫:И9aхГ├╙ї6Ie ▓сY}y ┤d▄K+ГXЕ·я(K│RО2V╓е№R╚┌ │з╚BV╓╩Фи/d{и▓ ь╡yєУЇ╡)е╫(дяD·И╥ж#}к╢шH_ Ж┘Aщ DЭХ¤oТ╛`Yе'х 0F9Qы8фрЗ╘qйў╖▌uB ▌Rм18_№%NмЬ/ е|62┴∙ъж" :╬ўсЄQющж:╥wRAЪ│╨╩·ОЗ ▌J√┴НчА;h_эwРo.┤п┼оз}Б<'щш\йеч▌Ш$Eї╘>гТ╪z╓wвs▌╦t*Y_░Нс`╧·б╧ЮЇнHу|;()_яФ/ШЬп дR╛Цл░┤х∙bT█вЬ^╛Л{┼bЖ tх3lMS█Оё:ШC](_╜%]G∙ъсИт=х█аОЄ╝A╟ю╩BbNg╗Gе|u╤╔ЎV)_┘еО╗P╛6_J╛ОЄХСЛ┐▄ХыW7O╪Q╛╥╔X*╙№NхkЩIх√`╗С·gьb╢Ў:7Я╣SЖОъх┬╞╟дЧЙ└эЬДТкЇuсф3Tei ╥═Б╢0ёъ╛@ ░;╧╧егt╓╟qХ╬═AО┴N╘╣9 Cь#эц║i╞Я!╝№сюсх╛=жuёr@И╟лЧBO%y^Dг╡ї^о¤шсп^.Mqxях▄v▀╓nТchБ┤╕║╣TЕC√N╫2ЖЗЫa )H║9=W╪gqsJє} √,~^б╬╤;,=▌Ых#жз√╠Дкл[╢-╦√║/`U'╓Ec█9╗┬hяЄ&7╣Fи╬фBгwv=╠Ъ├█pv╜▀СЇы╬▐а╬┘ Fиn-;╣╗║0zїt▌s╩1Kz:╚с_ёt▌^tuчщ▓є▌v^=╪/ЯьRїt╣\юх;ьHєС╬╙ь7=ЗБ├┐╓├ ьj▀Y│є[╦U1U?ЇwЙaE┘tJXCРьё╪ХH@ЛыKvPCхЛPш*ЖD9М╛ m1#РxF[hЯvUзa%%M┘╓ЧЬ░X\Хt9aGi9%'Р▒О>╘УMГ№яS┼DP▒э;MлЄ╡"#ИЧ╬oZF╨l╧─D╦ЪdФ2%▄/Я)A╫/Q▓ж8┴ ж-#РЛWєф-#P╙╩·М└vКШ█%#аз┘═D╦ЪЎСЮzВ2ЄЦ╨└еь╙eг i∙~}uБ╤х═b3╫Kj1├╟ZGЛ)АпrпH1╬aUbК√5п╗└ЕТ"'C╢ .тO╓ЕC╝aQwwк%/P7╜DvГIН╛Ум5▓ЫхРК,3HМO~L╤Ў║еХoу dHЎxфWК}ф Ц`x╧эї]Вj╬╪KЎ╝·e2ё=ё9 )цЖ\Ь(а√╦═GЕ:|ЧЁxw@zЫхжK╙Иo╣`@╛7T█▌ZrAшc ь` #╫jС№ dО¤E&┬yАЮ>Ёл╩EЕhRJЎ├я√МТuБО>wЯ╜тЄ╢иЗ╠∙К¤Мк8p(9ж■Шlk╖BНъsцП╫s╘Тtdьмc╕│╞ўT ),Ъ■Ё GГ╣gмёзoьЙИДUЪ_рrЬ$+njU╩_p╣r╜W@l─S╡W*╛п╫S&iЬ\Т─?└ Х.їё┐▄РА╨шў!є'C█╗ y╫╨[K|f┤бy│э] Д■ЧчїЎ└сз2┤°~N╝╝ъ"┤┐Ь{s№!"@РЪ╓cщ┬RAn╡╣@│╛╔▐kйpОєM >зЁаШu╣о 9У]eыg▒╘>хqUЯЗ{└їзwMlя|)з[▀хFФцMъ}.┤┐qIjWE&z[ ▄ЮС[z ш ┬╙8╙к">п■FVчu╛Ю rС╠4OЯ-ьЭР┌═ЎV?3 +┼╨ю╖ТШУЙnHЧЯч3o▄╔## 9╦DиЦН╘'mL ╘╥ш8<ШЖЙ(┐бчQьлХ∙Ю}∙╫=К╬-∙бq{┘█C│Ч.ў1#чЫьlC$╚e╘NЯўъл0ЖЦШ>╟╣ЩЖЁcl0єы0 Ўц╤╗}√2SЇжnlюЇ.sXїюRхЩю;Иъъ░н╞ гэ*WЖ╓J╛╤╫ ╤ыKеyyrzЖLЭ╧▌╒ }°UC7=∙ш╗N ╒цгї╗З=MvАО╕T└@O╧Bщ└чWm5v╛r$т?╟╠s└ ─ ╗1 &ц░nм!zl>@?ьЕЖи3└Kё>lй ЪNp█аX▀m╝эg7■ЇOB>L?J▓е╗╪Ў═OGUФz┐╚ц╖яn╝Лl№ фХ╖N▀ч91съЮ╟Юь" {ч^ўгЇ╙A¤╘■╜M*╤]+Ж>hюK▐!ю▀W▀R╡i┤6ЁА0V╗∙v| ▄тТ,▄╔┬Ч G╕$ДпрvHшюяЎkЮы°фўо╞═░А╡№<ўИPyJ_┌)"%╪g╝ х╣M┐∙xv°o ╥г[@Wм@╡├▒{еoщo▓б;гP9P_3Ўнp╗Jр╜·╛хdц°нКkt5┌ЪЪrIУ╘*B(Вс╘з2N╕RГlj·:ЫЬС хЬС┬х|Аqрм═л4╜▄s(o?zь╒JTшНтЦuл h╧z2в▌ЄэйУЄы╣НVf─╛ю6 ш╥д╬dїB═sH'18┘║К▓┴їЬХ{ЮCХ∙╟~Л|j ╬╞3xвl▐!╚к¤╗x]ы╖0х+sКЄ#БЖ▐ЁП@ЪВ╦"М^ ╓Xк_└N!╚─Е"М─Ў│>▓еo·ю╬!;■@fNk^!ЖIЭ dЗ>v¤╪зХ_)!H╬_Кfe╡G┌'щi^о╘Тmdm4SЎQ█НDcХШы╛#:6╒YC:Cx7 фW╧8ЇЩ '3╒ Ц2р3НЬa┤g ЎВЖ╢dХ■┼ч"915A╖▓[ НTuЪhU їхT╞G┌е чЇbуЄ№╟оФ яW 4п\ъ▌╝VЩ6o)O=tїХ╙ўЁs2ь╛╤N╗╨Cщтiэ╙¤╞▒Щq╖оfЎСЇЮo╩╨я╚∙╞сх9 Р┼3╫┴>╝┤e~Е`ЩА ЙK├е▄uyZ п \l4▌;x═Рц▓ ╞│┴▌ .иачl▐> ЕыP1"3ёжвїо`Н}2Е2u╠РЭТЩв╕╜Ўt╘Г;Шч▐7╙Д3 ┬x╖Ч`с+╜ypГRВ├┤FU.dVNЪЇ╒'╫░╣щЮиk╠зщ7Ъ╡i╣Ючzя█■╖з-Б╙'╞P╕┘▓╨BЁs.╙╖пю╕г╨╨є▄qГ Фt}!к1Wy:Aж╒¤╝*мЫ╡9х┐[9ўNЙ╡╕XR▌tзh╠vЕ=7S5╤ёCд√3с?ж2▀MXФ"u╞Ь`нрж&Е№цo"╞Н┌%*-п№<┴Eэ°■^є┐░ЦЕbЩЙ╣шx╙Сюц6╩КdП╞/NU∙ъR@║Ly!gЪчЁН╛▄ е╤-▄с1 о╟`∙╟^9eШЗ╠NЇ╬·*─│y'"чMЁ{╗╗ ;Cхч│Я0Щэk!0ЎщШ ╓EЩзас-vє▄┐|Т╞:o╛$╝]@─sФя*цзЇMа)ъСє*╙╧ЇHd╧M▀J╙Ъu ┬═шЭl▒- dD'зОkqв|иJ╛│Єg№]М┌╖що:пm╗¤Рь ▀#фMGШQ )а╖w kЛ│$я▄╨Ў2▀│tъA┴°╢╩g№Q_Y°¤ж#№∙*Гэ:ПtОyГн "8╧=2л╤¤ДЬ▐╧Wфк:|B6ф╔w▓6СбИlъu_▌^3ёФwЦ╜~:@ьw√Рц:к#Ф8NЄЁ√9жШё¤5Т8З>Lщ╢Me├┌1Ф)Я╬K╕╕uЭ┌╥$ э╔aЙzа╛▐┴7·PcпБj├|f├¤UiЄ'E┌e└[di┴ДдЩ├\8%Р+┘╒┴щSбP▌+Al╡Ы╠a>Р~в╧$╡mх└J/Э═{х╩ ╬л#еы╣√з4Ыqp-BБЕIг╡FРUy╠S)C;5║╟k╒╣BпOп ├с╖тИ╙кИР%ўзГ╦8Ш█е╛Э┼╒Ив┤╝;с╕╓╘▌┘(Ч░*iТЛп╡═Х4pjў╝ИSuFРaA▐▄9Д▐pпо√{ь▐о0▐В█еd#{╜─]?Uо?╟╜JсZ╖(У :│KЖЙУфN▐S°*TЬ┐▓юСWw=ж╦цЫеЩ-╜2W2▐ВdLU╛ЄЕU.<╧=╤4e ■Вю.Sr▀9цIn^╚x░Ш┌╪ля2л╚cp─FцлI╩гупdf┼Ъ°%гхимОэЛэ}wBN╬з┤>╢#╒J╕з`|d╕кЭш═у&├о│b╜└ь╕VИьк@╣/Ь█╤i:`ТF─MбаЛТц┬xA┤(I╜yq@\jЯ┌ЕY *C╔░ьрTўE╨╟СзжT║Г╜DV}s?v▓┼AUI▒┌" Wr─y|< Z!а.F\Є╟BёЧTн)Q▀╒-╥·╨─taeкy'╢0(0№Я  К╙╫ Т─ЙJ╓#у┬:T╩N ГаRЬ-y Ж╥i6AЇє╜ЎЛ/┴├╩ч'Ы?c_╧Йc╫l╙с┐X═╒6Z@·v╗з:mї№naF яX ╥/╣╜`4ц▄.gГч1╕`ЛR0╬cgИ#x4O╗;MмS3ю*Й+DA√Ф@]р@┬┐d╩7иz╚5∙5╒│a*╚-_7└╢З╬)▓чJ Н■wЛ▀ЛHцx▒▓5═╖ AF}╖9(2 ╗Z╘╠ ┴нg╟_¤[а╔╨╧sПc№┬=_╒Ёпт О╫WХДе╖▄"ЗИ,,∙41Z!b▐ЯрzЬ?╫$\єР<ї▐ф▀хюЬРюЖ%╨Sм╬}╩·WR,gOmdдWNF]╧sLQ╩╚╥HП╖[Щ╓L╤─╤`╫sчР╗├ ╩{i╒Ї}@фс┬!▌ЎЕ╘╧св9╓ГhЄz╛5FР╝йхw4 MRЯЯ#0и}▒╦Rs╟Y╝NjщД┌фhМ│aъ0▄Xо╟81НvєcЦь:YЙ┤6С╨2┼═ў7Ч╚L▀~ ы╟^▀оU|тЁ┤шжтьKo√UQх╙`^░ л╢^ИОd║ш┌ЮДdLЁч═■╘0▄╬o"О╩МЮ&Kм ╬▀fa╖[АФVГs▌(·jFнц@√╓ЮBt╗wz└og@·Kвп╧qт)6ъ3v ФЦ)]ЇБЭ┬╤W▀my╖4QЕ∙i5их┌ШR6Xў++з┬╢8dЪ~лўїpн5?9зZє_ ¤°ПbХ endstream endobj 9 0 obj << /Nums[0<>] >> endobj 10 0 obj << /BaseEncoding/MacRomanEncoding /Differences[1/space/parenleft/parenright/comma/hyphen/period/slash/zero/one/two/three/four/five/six/seven/eight/nine/colon/A/B/C/D/F/H/I/J/L/M/P/R/S/T/U/W/Z/a/b/c/d/e/f/g/h/i/k/l/m/n/o/p/q/r/s/t/u/v/w/x/y/emdash/quotedblright/quoteright] /Type/Encoding >> endobj 11 0 obj << /Filter/FlateDecode /Subtype/Type1C /Length 4700 /Length1 5399 >> stream XЕMW X╫▓nДщnAFP█└╠╨═*"nИ,▓Г ╚*╚&2ьМИА╞}ЛQ█иёj▄ИAE1Кв┴авВ√╛]5J▄BоЙQoВIкgjЖў╬рє▐ў}єMwЯS▌зN╒_¤╟Д2ыCЩШШXЗДLNЙIqПRЧ╒илКзOгL╚8)))Ie"┘їСьL%▐ _ў Q1кX/oNЩн ┼П╫~МEQ?Ў7■ `E■M2м┐$╬zefb┬жцФzОЇ9&╧k┐╜Зпяш╛╛Ў!ej√░х╒UъJ√h═ЇСЎ╞┘qЎ▒┼ЪUЯVиэC&Ї_Ё░O6О$═(ло*ЮбЩ╒√┬>/!ehЪДо"▐╤ЙЁFФ╞Ad┬qЦИ0-Zp2 й4|QЕjШпgХ─ЁV}p ▓┤a┌їr%ШеoX/╜╟,FоТЩ┬Ч*bДe┤4ИX╩@M├п*│vxе┬@уУ4Ш╠╦PCу~жрsХYгМXУЄ┤▀°d▄j>r:=№E├?┴ їTцК┤%╔┬▄СЪа№ДМРШЇ└Щ╣ ТЦGЙм■МJ6╨шЦЇ3ы!LaV╖p4АМV@v:° О'4EП{Шн╘┐вх┌\эmЗ=╥T·хїеsZДJОNtW /И-рл2'.ЄQ▐4°q·iл$╨Oo.йi^чЯ │W─╬K)╔ц├╙╝КPо4Ш¤▀·ZR└с<0]┬┼G√Я┐VАмфзшk|┴с─╞рЖ╢=═ {Ь╜╕чб°Л°╕цNюх╨nФ╖a░╚,hcтпы:8М5Ф╤г╖ЕюOц]┌▀OБ╩╖Oўu▄эk°vў▒U8╞uе▀M;.ЄнМч╤,█; нХ^ёН╫JЕ╣ЗЦ╢┤+┤0Шvєe╠SФ\╥▌╧с4\МoЁ(─\╪┘~j¤W▀ Э;nn?{¤Єeш│ё1ЛЇ┬╠кiеЕIq┴e#D╠GБ╙r(g╡{hаV<^|К_to╓╒┬s┴ CП╟8\dбYпсHl!vXГ-°*БyЪыuJ╪ЫY╖a<+ўГХ,Г├3шВорbHg╨юфp8╙▓~є1ЩХs─╣╩ТкuХ[╓7)┤ёоgpbяЮltm\O─ш┌0ЖС\═И 1РKюН┤!ьщА(щЎЫ/]║╦7╡┤4Ь┌╢wубu▀Й╧─ %НQ;жoJ'▓И╤Ж1@═к╣└ Хъ|З+Q└>S╨zИ├1и7\m*┘є╨M░<@ШЖ}kИСП б ┤ц╤э Ж`%$Б▌┐ цЩp6А7д)`Z)МНsFМC┼CМSоRщH│╛╖@9U(ыЪ}aИB▓∙▓бц]┴Е°Г> -PЙё╝qїЖ|ЮA<$┬Vш~Lh▌qdo├╖нэuw┼ЯD╤lёДИq"rQбhЫ\у!┌│Iпэ▄v╡╛х√'OЫбЯJ╠¤Et▌╒QA╣5IЛгDНX╜ж`ЛЮ╠Ъ··5uJ(ЕБСШО^hНf8х>Gd ╟ч▐\Ў Л 4юg,ВW╝▄O*0bK_╨[у├щ▐GяЕq=╝уp"Н3a(·┬AP├PРAїK■,(ў└hS└иjЬ╙═CB: Кj%^AoЬЗ[░В1@¤O└└'В>f p─`eV▐жЭB°С№█+▐▒$нNїsЬtRЁГ ╞Б╣ т"tЁE'┴╚Wе╞zJзсJOЗ тi($c├Э▐√k║F╤8├Ё ┤OdШMг┌Ёє┤╧eиaасPj╨аЪСыО¤Z╫тЮmи┤UжяхkK6жЖ* ёMж ╠єЧр╨▌ЩГN╝a>─k│Ш╫ ╠шр▀з╣ЭAg%╔,ХВМ┐0л╡тРж.эxфо▒b░8avB^╤,╡:7Х%╚Ль┼Єn8┬▌▐w║¤p╟й-╫7В╔VЫЫ x╕гeЛ. Ъж╕fЁЪД╕∙▒J'╧kя)Jв8l.─мJT!%тT[МU0|┴ї╟▀ює_цn*┘V╡/чDї▒Mм¤вc; ╢╠чU│W═Sf,оo$є{■Гё'∙У.u8@ЙхШ4kЧ @oh▀z№Ы}G█n╓ *ВП°sЪИ¤┼Є╧лЦ═[аЩёi▐ V▐vГдg`°я`╤╗jW╛ЛЗDf]■в5╦ХшДЦh6CА84Ш╣Ў╕1G╟ zl╓ъeШKKЎ=/чLMF█хЛmKk*+гФ55_╘╞ 8ОY▄№ї╩6%ф╫}'╡@╛╨l; ╗▒/a╒y]Ы┼йF№IЭ`╔б╒╪v0═*/,║єT╤╜∙Y¤Mм┐~мХ`ї<═[Е·IЫC╞*Ё ZгЁ·]aKwт~ s4уpqуьЎвЫЯvК▌т╧НПоВ№▀Ч┴_Д"╝┼H┴╧E_1|Ўдщ╣∙Е,8bШqG╥q▌KcVш√с%И┬╣д╛А╥НЫЪ г╤│─{║)1═ №аЇяэ]Нў0;їc0J╕щЖ6╗гб╣ =▀уgJуж╬╦a╣;┴XЄЪЇЩ ░zЩ1┤MhМ▌ючк└ЩбXЖ╦° :В█╦дЖчв╗`Ц┬I°Л╘╞zx Z,Зxl╚ўо ╓ХBаa7]{ў°╡ЫЪЮ∙Ў·a░{hЦ7Я^hmэьl~+#B9║@vКШ."9ЕЬАк!л╨ЪЕzm╫╓█їз[y╤ ¤E ▒б Йс1╔╔EEё╣▐щШМж6╕ ▌в1l!К,YYы+нуЇ9┤Фг╡УьШ╡·uDA7Въ╝q8mpюqФa╕Ц┼nF▐(Н╤эхF00j╟EpOda j└ДY[■y┘Rї╝ШТВЇе,v &6#v]√6┼lfм,YкЮ√┴╞╟▀T▓╬─hБK╞ ╣hUНюй╨WC5╞┴.╕Aиd1lБєШ#qyx╠┬КD>╢<-;o╥°7il╔Р%■$▐( .~wim╬WЙ,сZGШЖў∙Е*▌П&аq#жГъ3ятXt┼Р8' r?D57ЬП}ч┴И╖┘w┤T\╛T1cЕfI9?'▒┤4kYп╧ч┤ў9T!√Ф╨я■{Б░gЎЎ╪Д z _╥9╠F╨хF&·╜З`ИАnЗ░┐· ╕Q;ИCЯЙуp ОWр1ШБгао│LX wщЛ╪Ы|ёб╠╞Д╜gў7и?pв}ў}▒KДB▐уqЯИM"zcДИ┼т╪=gSўiОVЮо1:_J&╞╙X┐ ЄРГJ╔╤Vв-╡=╥ШЙ╛C╨ЛУ26э╠╞ЭzwQwя2Stл9°╣g5$лd╨СЮВ3ГfрЦJyRqoUfWzЕN┴0iЩJ╫ ┘*Щ\ZFJиWиdэдобЧ╗ПА╦Sp√∙▓&с ┐│`SbАВ(Б8mєч№зхy0Iv8ЗгФ^as╘УЕтj╡:7ЕХNЇК'sX]Ж╨X╝·т8╕зДSр^РЇош^─ўBNГ╫фаEГM┌Ц№н╡Y√кЪ─Vё∙▌єа я═:ЦY_▓н`m БЇЪ█5╫│/Е┐╞╛нш-в(в┌ЙШ#zНzФё▌М[Х кзBЫGs┌цюЩl╓╬"1K$ЇiСИ╢"ЪЙ ┘*ч┐тQV─╗¤ДIAз▀б╖╘/Г94|% Б·!2ШKы-еябG┌!├ ┐╨[тj╔RЖ H|╠б┬╚└jZМ]2ЩЦЖъ:dдkтB╩G )╝Fи╠юrАnшn=г!R7ЪФм#F20¤^0┘╢Y\┘─├8fmYїЪ*%Ўє+Ы4Mи*ZШ▓2Ш5ц`╡┤УГo└  |└Ъ@▒wСК■X: ┬рSъдkЮB_№пу RЁб@╖Г═3▌`мJ╓О!·#L▐щ┬Cе;УE╓·ЎRК┤AўА├5ШЕEИz+╚┴с0№_ЭУ{┬ш║╚╣21wШGЄвЧ│3пyцЮ╣MKO▓Cc┼qЕyJRлў┴хБ╨№xч▀аRшЄ╨ХL╤ЙвoЛw╟ ▌х#▓ЁH▀╩y╬╘Dє╪7uЇdфФшы|╓╜∙i¤U,Z_\ДБJrА_Й╠?┬╧ьШ#SлVuф▀Ю▌)BЛH vЭпD╨тD┬╒;ED2Ыр╠J√I7СКT║Уrc.В9ieWv■о Хы f0▐лёKwПi╝1СГ>╩¤iю└├K}SoЎ#┤cдСТЛ ╔}Ю~кL√+Ж+┬>╛2U;ZлЖ0ГZJ╘^ЖиЮu╞з─ЎЮх▓ 7hМоCс╘0#║ ` мQ┬▀]┬й7u @┤B{│{ьЗy>%▒<2УРЮМуХшрzЎяa·▌┘?¤н╨┘ХНоC%[╠ї╠┴hэAz2юh7=q╓╣b}6юaa*}\ы ┌qcw ╚.╬э !V┐ъb┴гWнС╛цр0╤}6DPЎЮъpКoИ█8R1dбя╠Й$=Щ^ hнD ▀0═f^]°шьРМwс$\Й┐щMа#H7ї|∙╖KВ╛вU▓╟ДnLYkщбТ║I'B╛CЁх│u╟╣ ИA├│  Cmю бЙФ╟F░З °vbщ[ГндўуH+ФGу^o/})┘╙П.-йiЮф7З"еР√їе?Ьн{╧╘╜Я>*iМЇ║ =█╨║{dўHp╩ДnИ░8~сУ╠w#oз <0t7ц╡┌а╨8fo■о°Гхg┼{dЎ50░H▒[}9Ёр┤]ёЫXИзс о╝М?a"&`-╩[G¤2Й?WЇкk`j╢ PХП5m%зЛыE╤>!-Є&╒LX,в┐Иьйш7Egц▄ZёФ%~ъеwЬ>ЧЖ%Z;Шe░Ус-p·╙╜g2ь)┼╩дhp╙╟╩@CыўўЮкi╥┌╗U▓rhM ЦцЛо∙nq8▓ ├Eв6R╫%oШ╝ ═Ў86 mGч ╧│`I╗A\48Ц╝Kп И }JДд:▀ C№v Ж¤ 9─й;┌'┌&тФ┤ZЪK▀:╖dЎ1сб·H╕г╙РН%╟+Гл╓Ы√Р6s)Эщ╝┤Ї╙#┬═ТC1ы▌7у*Ыї╚№гrK% +╥e[jЎ/j]╛w┼ёU╦!▌f9%]Dж>╣їЁo┬E ЄWCО┌NИЩ5╨Є╞╗·▒X╙`)?Вы╤wWa╘гm║юХ0.№зАrїjЬЭ,Z╥o1ю:z╜ЎРB~UРЙNe├'р0Ь╬П┐Б┤Рsэ░Б №G ї*ЗQ∙■бЛx╣dо3С&r║эШ▐S╚а╒Я┘┘|hIdбГ▌#;┴K°у╝ЬЙОLю*X▀тЫn¤X)/┤В/З╛*│╧ мЗgt╝d╘є├┤Щ█ГLоТ╒└gF]сквэ└Uе¤йўФф■┼ЙZ`nпАIт=■#∙й╨Mщ┤фг2{(вчч8BМ╖5L6В¤гўQс╜Я╩ь▒ ПРжtcРЦч■йЛ╟В endstream endobj 12 0 obj << /FontFile3 11 0 R /StemV 0 /Type/FontDescriptor /StemH 0 /CapHeight 2100 /FontName/AAQUKU+Helvetica /Descent -914 /Flags 4 /FontBBox[-167 -446 994 1025] /XHeight 0 /ItalicAngle 0 /Ascent 2100 >> endobj 13 0 obj << /BaseFont/AAQUKU+Helvetica /Widths[278 333 333 278 333 278 278 556 556 556 556 556 556 556 556 556 556 278 667 667 722 722 611 722 278 500 556 833 667 722 667 611 722 944 611 556 556 500 556 556 278 556 556 222 500 222 833 556 556 556 556 333 500 278 556 500 722 500 500 1000 333 222] /Type/Font /LastChar 62 /FontDescriptor 12 0 R /Subtype/Type1 /Encoding 10 0 R /FirstChar 1 /Name/F0 >> endobj 14 0 obj << /BaseEncoding/MacRomanEncoding /Differences[1/space/comma/hyphen/period/zero/two/three/four/colon/A/B/C/D/E/F/G/H/I/L/M/N/O/P/R/S/T/U/W/Y/Z/a/b/c/d/e/f/g/h/i/l/m/n/o/p/r/s/t/u/w/x/y/z/emdash] /Type/Encoding >> endobj 15 0 obj << /Filter/FlateDecode /Subtype/Type1C /Length 3955 /Length1 4452 >> stream XЕMW \i█ЯъЩГSнП)Юy╠Д░ЙФ╘FФдRб╢lBФ╥Q*Pму.iЬ╓iЕD*█AJ"IRIиz{▒╗╓┌Zk╫т¤э^3╧ї<э;Oя~яў¤f~s╧}Ъ√║■╫ ▌ў*c┬╚╚╚▄▌╟gЮgА═╝иДuQiqС+'╧IJXE)ЭДЧ─Т╞He,ё&Та┬ў}╓╞X├xС№@BХх&К [жGё╗Щс∙ц#хi┤tшWJ1t┼ дСУ╝▐┴╓▐vj─┤bK√щ╙э&OЯnщЮЬЬeщС┤&9=-*┼╥'1╥╓╥╨ыlo9?.1)-#9╩╥▌╗┐╔0┴▐rСб%()!=-.)1╡┬э╢Ь╖2a]tT┌■о+жM#SbaOМ'мИЙ─b2сH╠P\t&мЙqД1Еp ЬИ▒─bсIx╢─bсK,#№ЙЕ─з─"bсC!DсM╠%>#>&В 3b)сA #Xb81ФB╕╗ Оp2`7FYм═hР╤гrгzг?НMН'f╝╪╕╪°о╔xУУ6UакИt =╚?(кСfшYt(╜С╬г{Щ4ц╟Й \80gрУACЕ кд╝qp█рчCД!{ЖшMэL█╠,╠fЫн2█`vX~╢ц╒Y ┘и┴хн+е▌єY¤mmП|╗пЗ2-нХГY╠Ч:!_╫IЫ╩сТЩ┤М┼Z o├f\( Ч├jЕ3`Ў╬сXєI9Ъс┴╓╓∙~з╫Ь -L╗(6И@┐я▒S╝╜хZ╩гшЛєLeаОВЎн╕fс=N╟рb ┴У8ю·ш╖▐BK─╤09ьbGЇмяH╗╝ЎrЄщhqйшшШ░bc└О9"ЛЧ┤&Чmи▀▐┴(жi╡█XЬьфНуxмТ╝аКВq/№q▓╖Ў▓Ёсcмуїцн+┤HE╨N┴3Ё▐ ╩tНъ;Нъ: 9}э╩э{╚╒7Kfr8╓ЗC╗|Zё■aп╟тЎVЇЗ!8КG oИхр dB AЯч╕G─"N^ИГqЄ(xс2П0ж3$_s%P╪╥o┐┴йI║╔Bа╘ єu▌дn uJk═ъЄХ~║иў╨DJU╘/╪D┬KJwJЩKт;╩T· ьФw╓рe╛тeвFu[iе]г║╫▀Б┴Ш#∙k╨ю*РH З2рЫaш─лzslС═I№ЛТЎM"uї╨*╒╙╥6э$▀Sж3L5д ╚¤cЯQТS┐5)ЁТ?▄А╩X ^·$╘RТC┐Eэ.╤┐^БыV└ЇР_Р°O gш ╟╠ХJ╦bеEqUс)▄Т╟KПїубе]Лю▒╘В╖ м5`▒LгjdбВВ▓NЬБ h┤╤6aжАc╟yр8+┤┴╝В├м▐LЩ!ЫQР ╬╜рўзЁ4aДиa╩Шgx┐ЮOюXЭ_Шчv╘ncкїРы Щ┼,┤xб\Ж2K╣l1┐╟hЛ■Ш%╚┴╥ Є▌! нБуБFtl╞c╨1ХкА╓╚═╞0╠Wcnоk═+a7╟@Ис ЫAй ` гЯ└ ╚U\╖∙;ZPе-ее╖}е$┤ иъ╦бt▀ksH№G?л·╨R╫╖gЦ - ┼■S╒╬ Л&ёcяЁтЁ╜dII3 ─>wSъВN |B1`Я░Gэ ▀~(bф■ї╫Оgа╖ВJ╠▌pnGх╬│YW┼ц- С!/P╙╚├'Mm` Цj`"Їыт]{lоbф~╞`m?╖·xэ╧вi▌4зї└8─┴!p╙zД║Чg┴ь╒Z█ХБу╖╕зЖЄ╬╤3"p(ЗCз_·.ZHн▌Єф] А~Ю '╢▌Tg╦ОMWЕЖЇв^j№hъJdyьГR║vХdB▌╦╛╛г|у▌─╥┼влh┐╨wuLцТэ╛"Г}╥(┼q╣Э╒ЗВoGБ XЬyЇЛP]R~ё▄╒+╬<_К0╦L╤ж▒оаЄ\AIMc■#ё'ёeZ╫К╗│▀уЁш│╧ ┬Щць+ V*в∙\NСК╪╤4эB34у\\·╡ёL╒ХBбЁ°хc╖П▐√z─╜пЛ┐╛Р╧а;Мd'nAу╧Э╙уGZ∙/ЮИj5FВА%▌s╦[∙·тл.^▐┐Ї@ь╔0юVS╤'3Nюъ╩о╦о╦)ЛЛх?┘╓Є╡╢г╧т ¤╨|Щ═l!taЄ╠/'1pО:X}м,пр\┘╡У" я&КS┼шї╔Щi█вw┴(2ЧJ╡яXм┬╕^I╗ А%╕AЙ═Ф_ЫА}.а k╚м╓Эд?°Нi┼▄Э╛1,:╬ X■]0\пe╞^:╧█рH59тtф,д█ZЖЕ!=3╤ц░аєз`Їй╬W0ВГ-*╝е╚`ХnИnьE(х{ №,▄ю8▀v░Н┴+╘ж╒)ы3вуC3─Eт▓ЬUE╛Wт║wБ#oжЎ╝╬zЇ┼ї═/Т╗┬█&┴┤nCQ╤ц%НjMк9е┴ <нQэ"uЛ■гХ кy7 Ыx┼!┤!се╒1h7GЎe@Х2SчO+ЖЪ├[ >ЕgА╧HJ╟H7A+Э#▒ЧB/|А╛Ё└Р▐@╥Хщ]∙wmPД9Zд>ЩS6 zхїЁu_1н┼UгjfсVу ижХ┬ЬэыВjmV+KьФ▀▓R.еk╥DbК╓6ы╨╥uщ/╢ї1╕╔РРхt%RЎющaB|J\dtxоя1TH/щО├Mз.є▀^h┐Ї+ў┤!)шЬp<сPXаZo5r ЕшFШ╬ЫjTЗ4д╖Ў-ыс╗iMА░hMhh┤▀║Ж╒W"╬ЗTxч:Лв╟║Eс йqС▒БЖКХкe+║хP═ёb╛с\cсsюaэ┌р│┬▒─Гб╛j¤(иТG╤uЗ./ч█КoЦ=хю╫жД╟Т╞Eиї╛PCяХ=─╬мЖ/*Fnm\_ЫPщЎє─2%b╥oZFкf1▄ Gв├в╨у┼С№╝·╕W0L¤ьH{▐ ■╖ЛЭu8Ш¤'сLЭдvvЪ[ъ╥∙BlЄъиДP▒Pг хR]╝╝$╢$╡9№Q·K DВQ.J.З и╨Ъ(; rЇяеO╠;Ю╦чЬ,<\Щ]С]┤√─n6╤√C╥ў╞(H|.╚■,╘Ppo5.° 9|В┴Шиx№жa№ <`ф·Jhъ.∙ЎрKF╔HoY6GrУ¤jzтД u█я=S╕уT= Ky√╡7\╟їЇ░RсL|N╠Б╞┤Ї┤╓ИЕIz╩√─Т╥x╛.д7╕╩=тшь ы│39dv}%HП┴┬╨Ъ▒ЫUЕ╤ └╒Fm6 MT─уИ╫)ЫI╬ё@+┤╨н|0wиqk.s╘Ё╚┴PШц Л9Ї{┴uЕP▀▄мkyXВєG@╕\к╙b6╝жЁ│х╠jБСЬТюБ\┴╢▌i┌Ъ^/ЇD6{цПяГг!┬5·q=1╣─ПGж М>GT]gЯ╜╛)╚┐№╒W ┌B▒V╔Щ║Яh╧эA┬∙Щ1єVMф▄B╬5о6Х|Q{G-ПSЄ- Зzыб ъ▒Й6▀гX▄@яj═ы98PtU▓+Aиm&▒Й┬t} nЧkH|HIV▄w`cМu|┌╚╪╘рЭA√bЎО0:Z╔Ъ3}2уCДЁф╚иШF:mP╞l(ЕQtepyT┘║╞ШG?ЙP%*;┌^zExЖn░лDfNЯ%Л│ж├(Ёzд-я║Ё·bgэю¤├e6ХB^╚?W5~цДц8┴░y▐3╫ж├~¤ъ┬эєч`ь;аЮПxs ┴Эъ╞{▀Х╛ бLAt▐1XD╬├ ╟E║еO╪Йf S√Ю╜Э[Q╥╓R·RДaтC;═─┘k<цпКpЪЗУ╤ ЫqW:жO╩╦( jЫаНЕTt╓Є°Ш╓ўйH▄+ubФB8╙:HeХc>№%SдЮъ╟ЇеЇ)Лe╘дє'W╧}Жj;VКЁГ│!QД▌" ИщЭ╙▒┤&·╠Z▒№XYAiE}K┴#ёЕ_*LЪВ┼"Г╓╓╤▐│Е%╦взж√nё╬Є`рc│юЇ╟┴А√nhт┤:p~ТЭщ╖▌6Ы┴p·Ч█3о▌л/·MRг╒─Щи▓Ы_■0Ц▀P╣¤┌-uвЧЧ▒Ё╛ ж├,ШUБ╙ё=■Н╛8 gEВ/№└CФ╝Н╒СhБ∙║T]*XрiЙФHх`sZJХR╤B∙╦%ЕJqЛ╞Ї`к║;Е╢GyЎис(╢b=╕╙;Р[тЙЇjЙo└1ПiTсШ>ЗЦ┐╓.#Aь╙bОЬIыўЎ- ХЯбuЁеь╩bвЖЙ∙G┌┤6iK Пл·mк ╟█Ўс2╧■║1s endstream endobj 16 0 obj << /FontFile3 15 0 R /StemV 0 /Type/FontDescriptor /StemH 0 /CapHeight 2118 /FontName/AIIHEP+Helvetica-Bold /Descent -917 /Flags 262148 /FontBBox[-170 -448 1001 1034] /XHeight 0 /ItalicAngle 0 /Ascent 2118 >> endobj 17 0 obj << /BaseFont/AIIHEP+Helvetica-Bold /Widths[278 278 333 278 556 556 556 556 333 722 722 722 722 667 611 778 722 278 611 833 722 778 667 722 667 611 722 944 667 611 556 611 556 611 556 333 611 611 278 278 889 611 611 611 389 556 333 611 778 556 556 500 1000] /Type/Font /LastChar 53 /FontDescriptor 16 0 R /Subtype/Type1 /Encoding 14 0 R /FirstChar 1 /Name/F1 >> endobj 18 0 obj << /BaseEncoding/MacRomanEncoding /Differences[1/space/hyphen/A/C/W/a/c/d/h/i/l/n/o/r/s/t/u/w] /Type/Encoding >> endobj 19 0 obj << /Filter/FlateDecode /Subtype/Type1C /Length 1589 /Length1 1731 >> stream XЕ5Ф}PwЖg?~?V1K╨М┘╜3Ю=ТEТШR K╘И~/├бQЦVўАPE/вС8&!тЙ"~╘вЬY%╦ 4╚йЙрGсв!FЛК/▒4ЧЮЩ▐еn╞─?~┐о·UўяўЇ█▌?c╘3:Эn╘ь╣Лf╧O▓═r╣╫╕ Ve№u№Ї\wжc╣{╒;Е.Fз·0Й╟HЬNтЇgРx#ГГуЗ5єC▓╚sCc┘TQ|bЗЕНbжДУО╟╩п╩п┌ф┘qt╫Э-Ё┤Oy2+╫|ЬS╢┬Н4рдмх╨ЗK╤О╦╥ЕвIХ│Ы╥ЪЦ]w┴7L^■cоз╪S╝є▌═л╫╧z=Нb┤╕`^у║Г[ОХЯVy■╦я+Щь@ъє'СуpЪ╙qъ0H√зxБWз)ї√└ёр╪DkOs~jХPЩ%.▌РДгC6 4SрхgЪр/g╙┐│кў*e√0¤хsh╤ЁJpm╨d░7в░*8x t└ВNXН6G(\р╔в)гVУ╫ВvУ30 -8С├ЙйЁ,,;!А├ў М;╫▐\╝ЄSб}сn[.Z╡<Ф"╔╟bюRКhч╨> " ╖UP │Ўn4лBpxЁ:+Е├&╪=╕╪НСp ╬├▒р┼YЎ$┬p▄#Еsf%A╤+{CЮн▓Зр┐i`0@аН┬=┘√Q╚Kр$ХЪХ┴SoЗъ╢╦uZПе ╔∙,╘u":,ф^Й/t& о№ЇМ%╔Я┬лмз╕n░чЙ║{║v╘Я░▐8h║╧}█ЪЫ╝W╪щ▐ц▄░Ё7Е[(╝,чsЬY╛,┐&}╔BЧtэ\Ё еРн╝└Ж·OVАBt╔G░Г@?EпН╒jОУ▀рНЭlь╒Уq/Uю╦8ТU9╘Ь№╓iЙиЇЁgeЭЄ√aAЩ°n╥┤┬┤yВ+o╔Тдщ>Xh┴Z \ ЁQ╨K√Ўў╫\hЁ[э╖ОCW}x█VпpZИ *їЄ$КE; h└╖с?Sq╙At▄┼Q?"╤Й░RДО@><WM°]1╒╡0╙Х0уХХ╚ИШ%тИ╜7/┴MHД$(A/ЎоЎ╧н╔┌УR>├чh╒▌Т╗╬;vШМ▒▀сvчЛ╖╟сS&u▄ФX┘┴j┌}у┼╔ ├:пт╠ Ж╟ xkЁяЁИГw"┴$Ї\√№Fm┐ Ы)Жe═ЙG+7■нЦ;ыЕ╥╢П┐йю█w│ж√ЁщЎ Ї~> vЛ-ЕgUЎ'Ye╦╡■Уy%└b E!46#╖ОпЮл■4 ў▀ДЙ√j·~╝╡ ■;VcМEkў▀Х╞с┴█ыgоI╬M╖╞зL╦|СЫЪV▀^"Ф6|╘║√<ЄXЛ9NК ]ПЛ╪H▒ыqХ╡Я6C╤▒MёOбWK╦╫f[?Kэ╕rр╦-'a╒┌mk╖Л*F┘оЎ !й╜6УЮ'┴ЩЇtЇ╥9иЪhЪОNbЦ║ЮСЯc _5lГ endstream endobj 20 0 obj << /FontFile3 19 0 R /StemV 0 /Type/FontDescriptor /StemH 0 /CapHeight 2407 /FontName/IKTIMP+Helvetica-BoldOblique /Descent -985 /Flags 262180 /FontBBox[-1001 -481 1589 1175] /XHeight 0 /ItalicAngle -12 /Ascent 2407 >> endobj 21 0 obj << /BaseFont/IKTIMP+Helvetica-BoldOblique /Widths[278 333 722 722 944 556 556 611 611 278 278 611 611 389 556 333 611 778] /Type/Font /LastChar 18 /FontDescriptor 20 0 R /Subtype/Type1 /Encoding 18 0 R /FirstChar 1 /Name/F2 >> endobj 22 0 obj << /BaseEncoding/MacRomanEncoding /Differences[168/registered] /Type/Encoding >> endobj 23 0 obj << /Filter/FlateDecode /Subtype/Type1C /Length 385 /Length1 367 >> stream XЕ%М;,qЗ ч╤─+ОЇО  Гth;Ш4.1hOдb(iZICЛ їь¤К╓#йGBC.b7XГдG-G╥╡╞╢оm,▀ўх7№0PV0 л7Y╞FЖLЭ}6з╟цЪЮ▓м░н╥Э№ё№D╩a%а·g5▐ н-r╕оHK¤nAШ╜б╨c─@Iёа+═╡4хм∙ч_+ЮJ┘ым:Н╫|eKsZBNrfС┘╕QOъ╕ЦЕf╓╚щ)Э1■╚╥"ўЎI╩ёд(┬G1ЧйМв<iЗ╠$а─Дvк├р`Ъa йЇ ЎJО4ї¤!╝H┤$ rЪTвяД╙чЭ[ДлєюНк?╙Ўа║╜X[:вг■░wЦTЦ3UD&2]ў°Ml▌HЯ√Ў╣ ╥ЙВ< ^]O>лб└&┐├G╘№КД╔K№xх╘w }'юgшlыx√0|=И!▌yп&го░=4О*jRб╞$■>]Х┤ endstream endobj 24 0 obj << /FontFile3 23 0 R /StemV 0 /Type/FontDescriptor /StemH 0 /CapHeight 1025 /FontName/MZXVSM+Helvetica /Descent -446 /Flags 34 /FontBBox[-167 -446 994 1025] /XHeight 0 /ItalicAngle 0 /Ascent 1025 >> endobj 25 0 obj << /BaseFont/MZXVSM+Helvetica /Widths[737] /Type/Font /LastChar 168 /FontDescriptor 24 0 R /Subtype/Type1 /Encoding 22 0 R /FirstChar 168 /Name/F3 >> endobj 26 0 obj << /Type/Pages /Kids[27 0 R] /Count 1 >> endobj 27 0 obj << /TrimBox[0 0 612 792] /MediaBox[0 0 612 792] /Type/Page /Contents 8 0 R /CropBox[0 0 612 792] /BleedBox[0 0 612 792] /Parent 26 0 R /Resources<>/ProcSet[/PDF/Text/ImageB]/Font<>/ExtGState<>>> >> endobj 28 0 obj << /PageLabels 9 0 R /Pages 26 0 R /Type/Catalog >> endobj 29 0 obj << /XPressPrivate(%%DocumentProcessColors: Cyan Magenta Yellow Black\n%%EndComments) /Creator(QuarkXPress(R) 7.5) /CreationDate(20090312095036) /ModDate(20090312095036) /Producer(QuarkXPress(R) 7.5) /Title >> endobj xref 0 30 0000000000 65535 f 0000000015 00000 n 0000000069 00000 n 0000000115 00000 n 0000000162 00000 n 0000001013 00000 n 0000001187 00000 n 0000001233 00000 n 0000989046 00000 n 0001025165 00000 n 0001025204 00000 n 0001025511 00000 n 0001030314 00000 n 0001030528 00000 n 0001030936 00000 n 0001031165 00000 n 0001035223 00000 n 0001035448 00000 n 0001035825 00000 n 0001035954 00000 n 0001037646 00000 n 0001037881 00000 n 0001038124 00000 n 0001038221 00000 n 0001038707 00000 n 0001038922 00000 n 0001039088 00000 n 0001039145 00000 n 0001039465 00000 n 0001039533 00000 n trailer << /Size 30 /Root 28 0 R /Info 29 0 R /ID[] >> startxref 1039796 %%EOF