%PDF-1.4 % 1 0 obj << /OPM 1 /SM 0.001 /Type/ExtGState >> endobj 2 0 obj << /OP true /Type/ExtGState >> endobj 3 0 obj << /OP false /Type/ExtGState >> endobj 4 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[255] /FunctionType 0 /Range[0 1 0 1 0 1 0 1] /Length 699 >> stream X  {^l۶m6l۶m'k۶m{4S6_B"=H$!@6b䐜F#I0J#̆QH g(ˉQ\J,΃YF,TȏYQ*\T-YMƬQ*U[ê[/@jT 4)Tj^,JZnS^:TXtEVV Sz]ӯ6NPg 3Zg o3!Hwi; 8wLl;9dwdĝ wh;Sfom7O[o,ꈷXt[o,BVv[ 鎿V_l셿I6l닿]v@G$7`LpP !8<FpL'81जIpZΌ"<;Cxa,E4\Oxu5>ܜDxk2mr;ΩDweݝEt4{D z@I<3?//,"~Q^ZLWեįˈXN򦼵myg%ɻHޓW| !h-:O$o BH|ͤw[H'y;/v."SM=do/9X endstream endobj 5 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[2] /FunctionType 0 /Range[0 1 0 0.6 0 0 0 0.06] /Length 20 >> stream X @ O  endstream endobj 6 0 obj << /SA true /Type/ExtGState >> endobj 7 0 obj << /FL 8 /Type/ExtGState >> endobj 8 0 obj << /Width 637 /ColorSpace/DeviceGray /Height 679 /Subtype/Image /Type/XObject /Length 432523 /BitsPerComponent 8 >> stream _}|nVYly|{}|}zsxy|z=l}w[MZQSMQ[VRVpaMP\VQSVMMISDVNNTOMPKOKOGPGMGMNNHHHIIOOQNNIFOPJJGGGHMNEJJJJJJKFFOKOGMGGQlsmrrnsoootowuxq2WpqlhdedddecdgujeedddeefbbbbdddeefgedddefddeededdededbdVbbbdbdebbdeefffeeeYeddfeUeeYYdWddYeZZWg[gWW[\jYW[YYSWWVPVPVMKMNOWNSGQIMNTFKFFNSMSSJJEJNNNKKOKKKEEKKGMMHNHHIFI?IEllkkggglggebggee3Vklljgdbdecabdkgeddceffddbbdbddeeegeddbddbedfbddaddddbebddbbbdabbbbeeddddedebddefdeebdabbadddeeegeaddeeeddfdddbabada``babbdeedfdeedddddbddddbbededddbebadbebbddeeefeedeeebbbbbebadbabedabddbeeeedddYeYUYeYeeffYYWWdUYYUYUUUYZUUUVVVVZPQWQQSPQQKUUUUSSSVNNvnnvroorosqlmqmk[wqnljfdbeddbabebbbbdddddebababdddddfd`bbbbbaddbbdbdabdbbddbbbbbbddeeddddddbbbbbdedfdddpbbababdededabbbdddeedbddb`aaab`bdabeedddeedbefedbababbaaebbddedbbaaaaabbddddebbdbaa`aabaa``aaabaaadbbabdbbdbdfdbeeddbdbbbaaaa`b`abba`bb`ad`aa`bbdb`bddedfddeegffgffeeffdebdfegggfghffgggfgggfhgfggeffgegfgfghfffeffedeVgggffgZgggfffgg[[[Y[WWgggZg[|y|u}tnqtmrqemmheddecdbbbba`dcbeebeddbabaabbbedbdbababaddddbdbbdbbdaabbbb`bedbdddedebbbbebddbedededdbbdbdeebdbdeddbbedbddbddbbbbbbabdbbdddddddddbbbaabaaaaadebbebaa``a``a`a`aba`a``b`a``b``a`a`aba`abdaeddb`aabdeebbbdbdba```abbbabaaa``bd`ab`ababa````bbbbdeeffeeeeefeddbbbbedfgefgfffeefffeefgefeedfeefegfgfeffgeffeefhgfebeeeefeeedggegfffefffedegfefeeeeffggggfffgfgghggfgfggfggggffeebb``aaabdeddbfffhgfgfhggggfffgffgfhffhggfhfhzyz}~pfbdccddbdbbaabbbdbddddbbababddddbddabaaaabebddbb`bdbaddbaaabdddbbdddddbbdbbbbdeddefbebeddeeddddddedbbbdbbeddbdbbbababaabefdabbb`bdbbbaaab````bbdaaa`aa`b`_aaaa`ba`_````aaabaa`aaa`_`baadbbbbbbbbddbbbdab`ba```dbba`a`ab`a`ba``aa`aa`````aadddedefffeedbddbba``deebedfeedeefeefdfrggedeeedfdeeedfdreeeddeeegegedgffeddddegeghffgefgebdfeeddeeddeffggdeeffgggfgffgffgeeeegeeda`_`a`abdbbedefffhggggffefedffffdeefegfefdfeeegfheggfehgeggfgfgefgfgggfefgfhhgghhghghfghghgfgghgggfjjgghhjjhfggfghhfjhhhhjgghyzĿewxjefdecccdddabdobcedbbddbdbbabbbddabaabbbabbaddeaddbdaddda``abbddbddededbddbaabdbbdbbbdbbbbdbbdadeeebdebeeababb`bbdaabbadbdedaddbabbb``aa`a``baa`bba``aaa`````a`ab``a```a```a`ab`a```mbaabaaabda`dbbb`aa```baaabaa`aaa`aaa`````a```a```b```abbbebedddedbdbdda````bddddedededdddeededfdeedbddddeedfeeeeedefeegfffdedbbabbddeeefdeffgeddbdeeeegeeededefdfdgfeddegefeefdefffefeba`___`aaabbdddefgfeeffgfeeeedfedfeefedfefdegeefdffegeffffefefefeefdefedeefefgggegggfefegggfeggegffgfhgfggghjfffgggfggefghghhjjkh`snhjgjhkhhghjhjlkkhjhjkkhjkjhjjhjhjihjjjjkjhfghlkjjkljkjkkjj`8H]lkfeddbdcdeedabdbbdbbbddddddabdpbdddddbbaabdeebbbdedddddfebbb`adbedbbdddbddbeddbbdddbbeddbebbdbdeddeefadbeabdbbdbabedaddbdbbdbaabbbbbb`a`a``a`a`aaba`aaaaaa`a```a`````aa````````a```````baabaababdbdababd``ab````a```aa````b````m```````````a`bdbbdebddaabd`b```adaebdedddededddedbdbedddbbbbbddddddeebddbeedeffedbabddabbdddeeefdfdddebddbdeefeeededfefdeefffedffeeffeeeededb`]\]````aaabbbdeeffeedeedddfgddfegddfeddefdfeeeeeeefgffgeedegfefeffffdbddeeeeggffdfrffeeeffffehfffgfghfgfgggfffhdffgggfgggfhhjgj[dlhhjhjgjgfjjjkkjghhhjhjjjjkjhfghihhhhhhhjhggghfijjjhjhjjhlkC=Vebbddcdddbdddeeadacdddfddfedabdbbddbaddbbdbdbddbdbdbbddbddbaa`ababbdbdbebddfdabbpddbbbbbddebbdddbebehgeebbbbddbdbdbbdb`abddbaaba``aa`a````a``_``aaa```b`aab``````aa```````````````]``a```aa`bbabadaba``ba`aaaaa```a`aad``````````baa`````__ba`bbbdddbbaadaaaaa`abdededdadedddddebdedeedbddbdbbbabddbdeddeedbdbfeeddbbdb`bdabddebeffffedeeddeeedddedeeeeeedfeefeeeeedebeeefeebb`][Z]]```ab`deeedfeffebedeeeddeddedeffeeddedefeeddegfefffgeefefefgefeebebeeeggfeffdeeffffefffffgdfffefgfefgggffeffhgeefhgdgfhgfeg`sjhjjgghhhhjglwkjjhhvhhhhhhhjhggghfjkghjhhhghghhgghhghjjhgkj?DZcbdbddddcceebbfddcbecddebeddddbdadddddbbbbbddbdabddbbdbdd```babaab`ddddbdeeddbddddbdedaabbdddbdddbbegseedbdbdbbbbbbbbdbbbbbaba``a`aa`aa``````a`aaa```a`a````````````a```_```````````````ababba`bnb``a``aaba`a````aa``aba``````_````aab``_```a`adbeddaaabbaabaabdddbebbdaddbbdbddededdbdbddbbebdddaeddefddeebddeefedbaabbbbadbdbbdfgefedeeedadbbbdddddedfdeafeefeefefeefedeedb`_[[Z\_`````bbdfdfgeeeeffddeeeeeedbeddeedebfbbebeeeeegeeeefffeefeffefedddbdeffeefdfefdeeefefdffgfgefefeffgeghfefffgfgfffggfehgghfg[mghhhhgghgjjkjkhjkhghhjkghjhhhghghhghhhhhhthhhggiihjggfgjhgjORjdaddbbbbdcdedeedcdceedbedeebbeddddfbadbbbabddbbdbddbddbedbabbab`aabdddedeeddddbabddabddeddeddbedddbdegfedbdaddbdeebdbbbbdbba`aa````a`a`a````b`a````````ba````````_```````_``_`````````````aaaba`b`````b``abbaa``adaa_aa`aaaa``_````ba``````````abdebadbbbbaaadbeebbfddddbdadeddbdbdbdfdedddddbdbdbbbddbdeedebbdddeead`bbbaabadbddegbeefdeeeddbbbdbbdbdeebeedfeeffeedededdeedba_[ZZ[__`l``adddfeedeffeeeeedededefdeddededdeefedbdefeeddegggffgeeeffdbadedffeeeeefefffrgeeffefggfdeededegffggfddffehhehhgggggghgghmgghhhfhggghkjkjfhkhjgjghhhhhhthhhggijgjhgfhhghgggghjghhfhjhj?Swgdaabdbecccdddedbbddbddddeedeeddddbdbaabbbddbdbdbdbbabdbbbbaaa`abbadbdddbddeaddddbbdabbdededeebddeddedeedbebbddbbdddbddd`bb`aabaa`ab`a```baaa```aaaaaa`aaaa`a``a`a``````_``a_`````a``````aa```a````aa`a```baa``aaa`a`__```aa``ab`_`a```a``````aaabbdaddaaaadddddbdbdedfdbbbbbddbbbdbdeebbadbdb`abda`adedbdbdeddeeabdbbbababadbadbbefeedddddebdbbbbdeeeddbdbdedddeededdeefdedb`][[ZZ\__```b`dedbdedbdedddbeeeeddddddeddeqdfdeeeedfeffeddffeeeeeedfeddbbdeefgffegegfeffegfggeegeeffgddedffffegeffgeefegefffghgghghvfggggggghgjjjjhhgjfhghjjgjhgfhhghggghhghghhhhhifhfhhhhhfjhkhH=gbbebdbdedcddcegcbddebeddddeedbebddedaabad`ddb`bbbbbdddddadaabbaaaabbdbddbddededbb`debdbdfedbddeeeeeedbddbddbdbabbbdbaaaa```aa`bdaabad`````````a````baaa`ba``b`a`a``_`_``a````a`````_`````ma_````__`_```a``ba``a````````_``ababda_]``aaa`a````aaa__``a`baaddbddbbbdebdedebbbbdbdbaeddddbbabdbdbbbddbbabbabbbbbbddddbdabaaba`aaddddddddbdeedddddbddebdddbddbddededbeedebeefddda`]ZZZ[\]_```abdddeeeeebbddeddfddeeffedffededdefedbbddeedeefedfddfdeddebbbedefegeefddfeeeeefeedefgfdeeffefdeefegggggfefeffdegfhfggfghgegggfgghgjkkjghhghjggghhghghhhhhifhgfhhffhgggiggeeggjjghhjhG<[bbdbbbddfdac[eec[cdebdedeefddedefdddddbadbddbanbaabdddbbdbdadaadb`bbbbbbddbbbeddddddbdeddefdeebdddfbbbdbddeddbbdbbbbbaadaa```abaa`aaaa`a````_`a```mabbaab`aaa`_```````_`___````_`a``````_ba````_``_``__``a`bb`aaaa`_``````abb`ba`_`aaba```aa``````aabbbba`abdbbbbdaeebbbbabbadbbbdbdbddab`badaddbbabb`abbbbbbdddddbaa``abb`abbbadddbdbbedddaadedbbeddbbbadededbbdddbddbedeed``]ZZYZ\]]`_```dddefdeeebbdbbdbddfeffeddbdeefgefgdeedffffdeefeedeedeeeeeddedfeddeeefedfddffeeefedffggeedefdeegfegfffefeeffeghffhfghehfgfggfheghhljhhgfgghjfhgfhhffhgggighhghhgfjggifhgggggggghhkkFDdbbabbbeeffgm]^^TXNRdeeddbbeedbbedddddeeadddddadbddddbbdededdaabbbabbdddbbbdddddddbddeeedeedddededdeaeeedddeddbdbebbbbbbba``aaaa`aa`````ab`a```aaaab```ba`````````````_```_``````````````````a__``_```_````_aa```aa`aa`__`_aa````````bddbab```_`_`aabbababababbbbbbdbddbabbba`daaabeabddbbbaababdaabbbbad`abbdbbddabbab``aaaaabbbdbeddbbbdddddfdeebdbbbandbeedddddedbbdbdfdbba`]WYZ\\]]_```deeffbdefdddeebdbeeedddbefedddeedeedbededfdffeeeefefefedddebebddfedfefdeeeedefeefffeffeffeegeefffeffgeeeffegegeggfgffhhhffgggghfhjkjfhefghghghhghhgfjggifhgghggjfhhfhgggghhfgfhgfjjKDeddcddddddcqg`ZNSdddddddfeeeedeabddbddbedddbdbaadeddfbddbdadbddadbbedddedebdffeededdedffddddfebededdbbadbedbddbddbaabbaa`bb`a`a`a`a`a`aa``a`b`a```aa`a````a`a``_`_``_`__```````_````___```_`````_``aa```````_````a````__```__]_`abdbbd`aab`_``aa`bbbabbab`abbbbbeddddbbbabbabbadbabaaaaabaabbbbaaaa`ababddbdda`aab````aaabbabbdbbba`addddddddbdevdd`abddbbbddddddebeeedbba][YW[[[\]``a`dbddedbeefdbbbddbebdebddddedbdddddeddeddeddfdddeefdeeeeeededdebdeedeefdefeedfdeefffffeefdgebfefegegedeeegffggghffegefhfheffghgfghkkgfhgggfefhgghggjfhhfhghghggfhhhgfgggffgggggeghhhK?edcaaccdba`bQ]ӏEWeddbdbdbdddeeefebbedbdebeeedddbdddddddabeddeedddbbdaddeeeaffedddeeddddfddedfbeeebdeddbebedbddbddabab`baa```abaa`aaaaaaaaba`ma`a`baa```b`a``aaa````_```_`````_`````````````````_````aaa```a````___`_`_`_`a````abdadbbbaaa`_a`aa`aabdabanbbabadbabbbbdaa``ba`aaabddb`bbaabbbbabaabb`babdbbbbbdaaaa`m`aaaadbbabbdabbbbddbddbbddbUddbaaaeaaedbdbeddddddddbb`][Z[[[\]``abbddddbedeeeeddabddadddeddddedeeddddddeeeddeebdeeefedeededededddbdeeeedddedeeeeeffffffeedeffdedfefeeeeefdffgfhhhsfegefgfggfeeegffhjkjhgfgffghghghggfhhhgfgfffjghggeghefhdeeegffseghjgKDeebdbebdbaaUI|Mdddddadedbddbbebddddbbbbbdbddbdeddeddbdbdeeerfffdddddfedfffeeedebdedbddddbfeedbdebdddbddbebbedeebdbddaabbb`bddbab`aaaaaaaaa`bnaa`aa`aa`aaba`b`a`````````_``_`````a``_`_`````````a_``a`_`a````````_```]```a```abbeebbbbb```a``abbbababdaaadaabddbdbbabaaabbadbbbaaaaba`aa`aaabbabaa``a`aabbdaabaaaa`ba`bbaabddbabadbbbbdddabebdedbebbdaddddbbdbdddddbdba`][\[[[\`````eeddedfdbbddedddbdbbdbebbdbeeddbedddddddeeedeedddbeedddddebdd`ddbdddddddddegdeeeeeeedeedfeeefeffeffddeedeedeggfeefderefeffhfggfegjkhggefggggfffjghggeghefgefggjgffgeegggggffeffhfjfjGEddddfdbddddY[MYeeddedbddbddebeddedddeeddabeebdebdeebdbbdddeeededbeddddededdffeddefedddedddfdbddedddebdedbbbedbdebedbddbaabbdababaa`abaaabbaba`a`aa`aadaaaa`a``a```a``````````````a_`__``````aa```aa`aa``ba``l_`__`_____```bbbbbdbddebaa`aaab`abddbbbbaba`abaaabbbbba``bdadbb`aaababaa```a`aaa`aa``aadaaabaaaab`b`aaadd`bdbad`babdbbbdddbdabbbdddbdbbbeedebddeebddbdaa`_]][ZZ[]_``baddddbeddeeebbedddeddeddbdeedddbddedbeddededdedfeedeeeeddbebedbdddbbdddfeedfdeeebedfddfdeddeddedeedgefgdddfeggefffdfefddeefgfgfejkwhhgfhghghhefggjgffgeeffffgghhgehggfhhgeghgfegfhfj>AddebddbbdddSZUSfeeabdbddedeeeddbdadbfeeabddeddebedbbbaddabdbdddeeedddedeeeddefdddfddeddefdddddeeeedbaeddddedebdbdbdadedbababdeedbabbbdbaabbdbba`aaadbbdbbdbaa``a`aaaaa`a`dda```a``_`]_``````bb````ba```aa``a`]__``__````aaababbbbabdabba`aaadab`ddbbbaaadbbbaaabdbbdbaababdaadaaa``aaab```abbbaa```aba``a`babd`a``babebaaaada``aaaaaddbbaabddbdddbadbbdddbaadddbdbebaa`]]Z[Y[\\]``bbeeedddddbdedebebedbdebddebeddeedbddaddbbddbeedqebededbdefdddbbaddadddedfddefedeebdedfeddeeddeedddffeefqeeeefeefgfedfdeeeehffefjkjefffeffhhgffgghhgehggfffeegodcpbggeeffgfgfffhgfhh>EfbbdabbbddbUbkUfefedbbdbdbedbbbdbddbdebdddddbbeddbddbbeeddbddeededddeeefbfedeeeddddedddbdeeddbffebbbddddddeddeddeebdbbbbdbaabddbdbbdddbabaabb`addb`aabb`baba`ab`baa`aba`advd`a``a``````a```````````a`a`ba``__````__`a`aaa`adaaaaa`aaaaaba`abb`ddabbdbbab`bbab`daabbdbbdaaabbaaa``baaaab`a``ababaaaa`a```````aaaba`aabda`a``aabbabbdbbed`aaaabbbbdbadba`bddaddbdbbddab``]\ZZZ[Z__``abbddbddbbddbddddedbbdbbbeddededddddbedddeddbdeddddbeeeddeeeeddbabdbdbbadeeddddddefdeeeeeedfdddeeeedffddededfdfeeeffeebbdfegdeghkkhdeffghggggggggfhefeeedfgecUD\|Yghgffegefeffgfghj>Eedbbaddbdbe[k`Qeddbddbbebdebbbdaddbddddfeedbbedbdbdfdbdddddedddfdeefddfedggebeeeeeefddebbddddddefddddbbbdadddbbdbbbabdbdddaaabbabbdbbbbabdbbdabddbbaaab``baababdbabaaaabbbdba``adb`a`b`aaa`a``a```aaa`a`d``_``````a```a`aaa`babaabbaaabdbaabbbbdaadabdbbbabbbaadbbbbbabbbbaaa`bba``abbaa`aaa`aaa`a``````a```aabbd``abdaa```a`aabadbdaaaaaab`b`bdbdbaaa`bddabbdbbabddba]][[ZY[\`_``b`dbddeddddbbeddededddbeebedddddddedbddeeedeeeedddfdddddeedfdddbbbdddddddedbeebbddbddefedeeefdbbdefedeedeeefefdefbdefdffeffffeehkhffeffgffegjghgggggggeggeffM6jSbJ7]hffgggfgfffgggjjD;edbddddbbeb\[U\feedeaebbedbbdedddbdddebdbeedbbbddbbedebbeebbdddededdddbeeeeefeedeededdddedddedddedbdbabbebddddeddpabdddbeeeddabddddbadbababbaaaddaaab`aba`baabbdbbabbaaa`aabdaabba``aab`aabba`a`aad`a``dnb````````b``a`ab`ababbbaab`aaaababbbbbaabbabddaabbb`bbdbb`bbdddebaabaa`ababbbaaaa`aba``aba``_``a`a`babaaa```a```````a``bb`aaa``a`a`a`a`aba`daa`a`bbbbaaabbbb`\]ZZZZ[]_]`aababdbbddfebebddddabbddddddeedebaddedddebeededdddededdeedebdddbbdbdeabeeddbddeddbddddeeeeddebbdddeeffefeeebfeeeeddedffeddeeefeehjfdedgefeffeghgehggeggffefgKG6[ffgfgfdfefbggghGAdddbbbddbebeZ}ۂTgeeeeebddddbddbbedadbebdbdbddedeaaddadedbddbaedddeeeefebddefddebfddddddedefdbbdeeddeedbddddedeebddbddbbddbbeedbbdbbebebdbddbbdbbadbaa`bdbabab`babaddbbabdabbbaa`b`ba`aaaa`aaab`aaaa`abababd``_````aabaaaba`da```b`abbbabbbdbaadebdddbbdedbbadabb`bdbdddeddbbbbdbbbbbbbbabaaa`abbaaaaa```````aa`aaa````````````a``````aa`a`a``aab`aba`bab``bnbdbbbbadbda__\[Z[\]_]__a`bbabdbddbbbebadbddddbedabeedfddbbedddbddddeedffeebeeddeedfebedbebabbbdeddeebdeddbeedddededbdeedddeeddfddbdbedbdddeeefdfddgeffgkjgdeffeefggegffghgfeggfgefZD?gfgfgffffgfhjgM;ddddbbebddddbdPOYYSTYfeedbddedbedaddbdddedbbdbbadddeebddbbbddaddbbdddddddeebeeefddeddeeeedebddbbddeddddbdbeeebdbbeddbdeebbebbffedddddbbbebdbbbbab`a`bdebaaabbbdbbabb`baa`dbaaa`aababbbaaa`b`aabbbaddbbb``bbaaaaabdaabb`abdeddbbbdbeddbdedfbeeeefdeebefgffggggfhgffffdeeefefghhhfgeggheffeeffeeeebbbddddbedda`b``````aba`a``````````]_````____```_]`_```_``_bb`aa`aaa`abaababa`]][Z[[\]_```abbaddbdbeddbeddfefedbddddefeeddedbbdbdbdddebddbeddeddddededddbabbbababbdbdbdebeeddbebedbeddbbddeedbedbdddeedeebfefffedeedeeeehjfefgedfffeffffegeffffsgggZG+hgggggfegeeffh9AebddbdbdddddeeeeYfeefeefededddbdddbedbbdddebedbddbddedbdedbdddadbdddbdbebdedededdefeeddfdddbbbddedaddbbddddebddbdbbbdbdedbddddeedbadbbeabdbddbabbabbbbdbbbbaadbbddababaaaabaaaaaabebdbdaaaaabaabbbbba`bbddabbbbbebbabaabbfeadbdeedeedebdeeeffggsffefhghjljhhhgjkggghgghghjhhkhhjhhjjhggggffghggfedbedgeeeebbbbaa``bbab`a``````````__``````_```````````````a`a`aa`aaabaab``aaa`]\Z[[\___````abbbbabdddabbadddddbdeddddebdbdbddddeeddeefebdfdddbdddddedddebd```aaaabaddddddeddbdedbdddeddbdddeddbeddddddffeeeffffedebffbbeggfefgffffefgeffgfffffeffggVW'hgefggfgdgegfgCEWebbddbdfbdbededeeeeeeddddddbebdddddddebddbbedadddddbdbdbbbbbeeaddbbbdedbbeqeeeddddeededddfbdbbbdbbbdbdbbddbbddbddddeebddeeddddedebddb`ddbbbdbadabbabbbbbbbbadbebbbdad`a`abbababbdddbbdbdaababbbbbbbddbeedeWWeVZQ[[gWQWWWYYY[\\\Yh\g[hjhgghkjkggghgjkjjmmlllmmlmllmlhklkklljkjklmmljhhhljjhjkghheedfeffffedeea`adadabbbab`````a```]__```_\]`]__`__]```_```````a``````````````]\[ZZZ][\`````aabbabbbbdbddbddddbbdbdbededddbeadddeddeddedbddfeddebeddedededbb``\``adbddefddddbebeeebbdddbddddedddededbddeedeeeddfdfbefddfesfedffgeefeggfefeggggdfgggf_U.ffgghgfgfedeghFAbdadbddddedefdededebeeddbeeddebaddebddbdddbbeeebbdedbddbdddedddbbdbdbedddddeddefddddeddqdddeddddedebdddbbdedeeadebdbdbddddedddbdddeddbbddbbbbbaaaddbaabbbabdddbdbabbbdbabebbdxqbdbabbadbdddbbdeZWOKJG?62,$'&#&#'!# *#1++(,++/8798?9>U忥ۼwkY\]aa[bZ_`ed__geed_ZPTQQPONPOVYV`_nmylejrs˓lSC>QPnrOGVgt}{|xtrpmkkjkgfefdefebadbbb```_\\]`_\\_]\]_][__][\[[[\[ZZYYZ[\]__```_````a`ab``a`````a```aabbbb`bbdbdbadbbbeddddbdbdddbbddedbebbddbbbabbbaaddddbdadbbbddededdbddfbbbdebddbdbdeddbfedddeeeddegeeddffgffgefefdeeefffeefdhfgffeefffdfgggffffgedfedeegffJDedbadadbdaaedbbbbdaddbdbbedbdbadadbbbabbdaebbddaadbbaddbdadpbddeebddbbbabddbbbbddeddaddabdddbbb`aaaabbaabdbbbdbbddddddbdbaaabddbdaabbebdabebbbdZIHDfѸڹ~b`Yb`jraWZOT`_ds~ypejgk~ݤtZKNWarsѵjGOgpx_~{vtpmmkjhgggfgfdqbbba````_]\\\]\[_]_]\][[\[ZZZZ[YVWYZ[]]]]`_````````aa```````a```aaa`bbbadddbdbdbbdeebddbdedddbbbbdbdabadabdadbabbaababbbbbabbdddddbddeabfbdabbdbdaeddbbdbeeeebqefedffeeeeeeeffeeedffdedeeeefegfeefgffegeffgfffffdffededfdffhFDdbbabdbbbdbbeeeedbdddbbddbbbbadbdbaabbbbdbababaaaabbbefebbbdddfdddbbbdbbaababddedbdeefbbdddbbdbbba`aadbbebebbbdbdbddbdabbbbabdbbabadbbabdbdVPE9?YĸĞxqggw{ΰ}kW\Z[`l{xftjWO]anp٥`?J_r}ketrqmkjkhhfeffddad````_]]]`]]___]]]]]\[[[[[ZZWVWZZ\\][`_`]_```a__````a``_`__`a```aabaadbbabbbedddbbdebeedbdddbddbabbdadddddbddbddaadbad`dbdbdbdbddbbddd`b`abbbbdddededbedebeddeeeffefffddbefeedefdegedeedddeeeeeefgfeefhhgffegefdeqdeeffh==dbadbbbdbbbdeddbddd`addddddddbabbbababnbbaaaba`aaddbbbbdbbbbdddddbbdbbdbbdbbdddbbbbddddbbddbba`ab`a`addbddbbbebdaaabdbdadabddbbdbabbbbbdbVM?Ehӹtp{Ķ|sxv{lqspyxxѲ\7-2=HgxvxԠp_[`m_kka=K`s~{xwsmlmhgggfefddbaaa_]`__]__\]\\]\\\\\Z\[\ZWYYY\\\\\\]]`___```_`__`_`_____`a_`aabdbababdbddddbdbbeddbdddddadbbbbadabdddbbbbbaadba`abaabbabdbdbaebaddaaabadbbddeefdbdddbbdbddeefeeddeedeeddefefefeefeefeeeeeedeefggefggfdgfdggfdeeddeefg=EedbbbbbbabddeeedbedbbdbbddddbaabbbbbbaaadbbbabbddbbbdbddbbdabdfdbbdbbbbdbadbddbdbabdbbdedddbdbdbaabbaddbabdbddbdabdddbdabbbbqedabbdabdVKG?aٹsy{sklblvyxxfahg`brpxA +Mnt]xqpgnjFIky~}ydqmjjjgfeeebbbb`````__`___]\\[[\\\\\ZY[WYZZZ[]]\[[__]_]___`_`_```]]]]]__`aaab`abbbbdbebadbbbdbadddbeeadbbbbbbddddadbbbbbdbbbab`a`dabbebeddbbbbaababbbbeebedfddabddeebdbefdddebdbdeedfddfddeeefeeeeddeeeeeffedffefffedefeefeeeffdegDHfbbdbbabbadbbbbdaeddbbdedddabbbabbabbaddbbbdbdbbebdbddddddeabdbddadabbbdbbbdbbdddbbbdddbaddabaaa`aadbbbbbbbabbddbddebddbbdddffbbabbdYHI\ɭ|ټ߻rh`V[hxӖU# !=_pkvyphv`I`v{vrpmhkjgfefbebdb```aa```_]h]]\[\]\\[[WYeZ[[[\\\]\][\]__]]____`_][[]]]``_``bdaabaadadbdbdbbedbdbbbdbbdb`bbbdbbdbdddbddbaddaaab`bbaabbbdddddddbaaabdadbbbdbddeddddbdddbbdbddedbbdeddeefeefefdeeddfdeeeddfffdfeffefeffgffeedeefeeggD>Yddadbbbdddbdbbddebddbdbddbddb`bbdbdbbdddaadbbddddbddbddeeddbddbdbbabbbadbdbdddbbebbbbeddeddbabbabdaaaddddededbbbabbbbbaadddbdddbdPJNtʲ׻żﺑvWHPWmΊF 6]xtxp|列|M]l}ytppmljgeeeebdaaaadbb__]]N_\\Y[[\\[Z[ZW[\\\\[\_]]]\__]]_``]_\[ZZ]___``aaa`a``baaabbbbdbbabdaaabbaddba`bb`abddbaabdbebbbd`bbababa`ddbebbdddbbbbbdaeedfdddeddedbdeedfdbdddebbdddedebbeefeefefdeedeedqdefefefffeggeeffgfedeeffefhFHfedadaaaadbddebddddedbdbdbdddbababbbdbbddebddbbdbddabeddddbbbfeebadbbbaaaeebbbdbdbbdbbddebddbbbaadebdbbbbaedefdbebbeefdbddabddbWFFPʩֿϿƑV82?VqH Fepv|yӔ[G`|{wsqmjjggeddbdd`bbb`_`]\_][\[\[]]Z[[Z[Z[[[Z[]\\\\[]\\_]_]\[[ZZ\]]]_``a`ababaaaadabababbdabbdddaa````abaaaaabdbbbbbdbdababa``aabbdedbabadbbbbddddddddddeeedeeddedebpadbddddddddbdebeeggeebeedeefeefeeegfeeedffefegfeeeddeeegg3?fedbbbbaabddbdbefddddbdbdbaddabbddbbebeaddbabbddbbbdadedbdbaddddbdebbbabbedadbbdabddbaeddedaaaaab`dedabdbdeedebbabbdeedddaddYKA;eּʴ}txfea`YOWNQFGJMJOZT]jlphs=4ayH 8QxƂmn}tpAVkyywep_jheddrfddaba`````]]]\\[[[\[g\\\[\[[\][\][]\\Z[\]]\[ZZ[ZZ]_]```aaa`aaabbaa`dabbddbaabb`a```aaaabbbaaddbbbbdbab`aabba`dbbbbabbddbdbaaddefbebbTSPddebedddedddedbbbdeedeedbdddeeefeeeedfedeeefgeffedfffgegefeeefeefdefgfDFeebabdbddddbddbdddeddbebbddb`aabbddbdddddbeddddbdbepdbdbbdddbabdbdbbbbbadbbbbdbadbddbbbbbbbadbaababdbbabadbdeedbbbbbbeddddSG;Qʶȵ{jjld]\Y[begr|l`Z=6 &/IWvx. /Z= #9Umx`pw}ONgy~~{snljhfffffbbatb`_`__]\Z[[\_]ZZ\Z[\[[\\[[\\]_]\[]\]\[\\Z[[]\_``````a`ba``aab`bbbaba_`aaab``_`a``baaad`adbdddbbbbbabbbaddaaddaadbdbdbddeddddedpndddddddddddddddddabdddddbdbdaeeeedefeeedeeeeefdffffdffgfgeeefeffdeeeeffDFYdddbdbddbbbedbbddaddddbbdbbabdddadddabdbdbdadbbbbbddddbbbddddbbddabbabbdbdbdabbaddbbbabbbbfebaadbbbddaabdbderebbdddedfQJC³xxx|y~}|ʊM 8Un, P~7 #-J`h$;pp␁xDVr~~}q}xrnkkjggffbb`a`__\_`_`]]]\\[[[[[]\Z[]][[[\\[[[ZZ[[[\_]`_````_`a`baa`baaa`bbdaadb````a`````a`aaaba`ddedbdddabaababbbdddbbbbedddededbdddddbedeefddddedddbbdddbbbbdbbbebeddefeeedebebbbeegegfeefffgeeeddbddfdeefeg>EdbeddaddebebbddbbdddbbddddbddddbdbbbbdbbbdbbdddddbbddbbedbddaddbbdddddbbbbadbbdababbabaaaabbbbbabbbddadaababehedVNDT yx|˹~kjd`WlZWa]f]bgeeeh`jaf`VUTNF;DG>CMP[`jy}s7 .I`¿q ,bD (4FSI9tv]xqȯp\IZ[ep|~Ӹ|]?1 3Ib}r, 4Km/ D}4 +3Ka( FhaAFp~}~}{tnkjffgebada``_```]___[[[\ZZ\[\ZZ[Z[Z[[[ZZYY\[[\]]______````````abb```_``aa`````a`a`b`b`babbbbbdbdddbbdbababadbdbbbbdbdedddbpdbdbbddbddbbebbdddddbddddbababbaebdadbqefedededdeeeddfeefeefggfeddeeddeedeegg;?edbbbdbdbbbbabbdddd`baebdabbdbdbadddeddedebbdbdddbbdabbbbbaabbdbdfdbabbddadaabebdabbbbb`abaa```aababbabbbdabeIDe{Ӵg_dgxڦk? 7UxK $1SrK /f~/ $4 6hW1<=Sðd*Md}\KMt~~~~ytrmlhhfddb`baa````_\]\Z[\[\[[Y[]g[ZYYWWY[Y[[]_\__]]_____``_````b`aaaaaa`````````aaa``aa`abdededbdbdbdbaddbbdbdbdbbdbbbdeadbddddeeedadbddedddbddbbaddbdbbebbdaedddbedeefeeddfffededeeedffdeddeeebfeffgh>Eededddaabebbbbabba`bbbdbbbbeddb`dbdbbbdda`bbdabbdbbbbddbbbbbaaadebbbabadabbbbebbaadaaadabaa`ba`aadda`adabSCWήŠdds̻~|{xxxrwqwqrrhmdpbjknvn|yxyS Cff '6N_- H,$7fedbbbbdbbdbbbbdaa`baabbdbTebbbbbddbdabba`dbbdbdbabbaabababd`adbbbaaababbdaababbaadbbdbabababadbbbaabbbSIOղ̫wyɯ{wmnrptrw}~ȿr\I97* ##/;QYtW He7 .3Qv} !TQ/7?Yų+2EpOr;Wr~~~~}~~~{vqlllgeedbba``__]\[\]\\\[[YZ[[[ZVVWYY[\_]__]]]]__]____````a```aba```l_```a```aa``baaddbdedbdeaabdpbddadbdddddddebbdbbdedddabdbaedfddddbddbdbbbdbadbbbbbbbbbedefedfdqedeeddeeffegefeegefefeeeeffefgFEedddbdbbaadedbeb`baaaaa`abdabbebabadedabnbaddbaebadbdbadbbbbaabbbdbaba`d```aaabbbbddadbaadbbaaa`aabadPEEx׮ն~~Ħn`es~pN& /Ik7 /][ '.2Dg` (Sî++9>edebbbdbaddabaaaaaa`ab`badabbaaabddadadbddaabbdbaabbbbbeabbabdbbbbaaddaadbdedbaddbaabbada`bbaaa`aVDCvٵѰŤqwxȸ~sjsdddlllrtsrwptmtpxw}qxx1 3Hl6 $Mmd .44;Ma !;FV!=H &36=`| (Ab` CH?M;3IbeQeedbb`badbbbbadaaba`a``abdbbbbadbddbbbbaaaddbbbbabbabbb`ababaab`b`a`aebbaababbbaaaa`aa```abaUPD9yʭ켨̵ȘtI.,.E`}ۂ/ Wp (Q8 *3-A|= (4Mxijx9GCH=#8P`U]wDWs}}}}}}~~~~~~~~}|}|}~}}|vnlhhfebba````_\\[\[]\ZYWWWVY[Z[[[\\]\]][[]]]_]_````````````````````_````_``bbdbdddbaabbbdbdbaaabbabbabbddbaabbbddbebebbddddbeddddddddeeedbdbbebdbbdddddeedfdeefefddbddefefefddfbedeeedggGHYdbbaaabbddbbabbaa`aa```bbedbbdbbbdbdabddbbaedaabdbbaaaaaab`a`babaaaabaabba`aabbaa`ab``aaadVG?qˬƢ»ùùјQ AbH 9ſ/ !4Yw 3/,If (6=e6GC=hw˫̺ȼ֐F *SxO PŮ1 #,9Kv[ 1949[!&33O1 >UF>Z~= G\eij?KHh~|}}}}}}~~}|}~}~|~}|~}}}~}wsnjfgfbdba``_]_]\\\[ZWWVYYWZ[[[\\\\]]]_]]_]]_`_````````a````]]]____`_``aabaaabdbdbabddbdbbadbbaaabdddbdbbbbbeedadbeddabffdeeddbdadbddddbdedbbddddddddddfeedefegfedeeefeeeedfefddeeffhA>edbbbbddbbea`abbbbbab``babdbaadddbbaabbdbbbbbbddaadbbaaabbaaaa`bdaaaaaaaaaa`aabababaadddQ=bɲ˳ô~}ylhbgaa_b`bddey{|{mՂ3 +St$ bĹv +24a² *>97I!397P+(FVGDf­$&AFwôfV;\q}}|}|~|~~}~}}}|~}||}}~}{vpmkgefbbb`_`]`]\]\ZYYYYZWYZZ[[[[_][]`]]]]__]``_`___```_`_`_]]___]]_````aaaa`a`d`badbaaaadbdbabdbbadbbdbeebdbbb`bbddedeffdffbddddbdddbeeebdddaededdddeeefedefdeddeeeedddfdeefdeefgggA>edaabadabebbabaaaaaaa`bbaaddadabbdddaadddbddbaabaaabaaababbab`abaaaaabaaa`aaabbabbaaddI>P̿мȸ|k`\VTH=HDCCA?>GA?F?????AHH??DEKQ?JMTZesxfjD FaĿG (`G #+-Wģ/ #6>1?q!3=9Uv!DSOApĠ[4JUĘGd\Ed}{{||}}}}}~~|}}|{|||}|}~|wspkghfebdda``__]\\ZY[YWZY[[[]\\\]]\]]]]]_`_``_`__]]````]]_]\\]]`]_`_a`ba`aaabbdbaaa`b`babbb`abadadaddadbddbda`bbbabbddfegfbedbddbbedfeddeddddedddedededeefeddddfdbfefdddeegdfefggh>>eedbbbbbbbbbaa`ab`baaabbbbabdbbbbdbdbaabdbbbdba`a`abbbbbababbbbaaabaa```aabbbbaaa``bWFFJWdx; 4H`Z Qɶ# #-4\ѴT 3>2J!3II|ȴAxUJk~|}|{{}}}}}{}~}|}}y||}|}}xrmjjhfeeb```_\\[YZ[[[]][[[[]][]]]]_]____\]]]_`__`]_____]___\]]_```````aadaaa```aba`abb`adbdd`dbdbddadbdebdbbdddgsfefebbddbdbddbdddebeeedddbdbdbdeddefgfeddbdebeefffefgggggghh?=fdddddabbabbaaaaa``bbbdddbbbbbbabbdbabbbebdbb`bbdaababbabbbaba``aaabaaaa``a`aadQ=\пɵ˴~g][JPPWU`a``adk~mjhea][[[[[ZZZYYVYWYYYZZWWWZZ[[YZZYYYYVVWWVVWVUVWUUVVTVUTTTUTTTVU?JA>97NZۮj /<8/7J˼Y &jK 1816s¤8 ,H?97Ƴ?=4A/#DTM?PJ!?I]«mQAZp{|{|{||{~||}{}}}y|{}|}}}~~{spmjgefde`_`]\]Z[[[[]\\[[\[\\]\\]]]]]]]]]]__]_`_]]_]]_]_]_]_`__`````_`aaba`a``abbaababdbabadbeabbdbdddddddbbeeggdfedbddddbbddededbedeeeeddddeeeddfedfedeeefeeffdgeeffeffgfghD=dededddadbd`aabbbaa`bddadadbdaadbbdabbdddddbbbbdbddabaaabb`baa`baaaaaabaababbUD?ȵpeQSOTQ`b_````adfm{ljfa`_[[\[YZVYZYWdWWWY[YYYYZY[ZYZZZZWWWWVWYVVVVTUUUUUUUTUUUUUTSQUTUTTUGIH98=Sn߼` 8=;/8Q~ɹ$ GƼ] -<78fЩ+ (HE3AƵ` 8H-Tr!FTF8Zòf/MTD?`3?[xbNC_py{{x{y{{}|||}}}~|}}|||{{||xvrljggbbb``__\]][\[[[[[[[\[[\\_]]]]]__]j__``_`]]]\___]]]]]]]_]`_``a```aa````a`aa``badbbbbdeddbdaeeddbdbdddesfdfbdddbebbdddbdeeedeeeeeddddddebdfeeedefddfeeeffeebffeegegghC>Ydddbaddbdebbdbbbaadadbbdbbda`bbbaab`bbdbbbbabadabbba`b`baddddbaabbbabaabbV9.*(*+#$ -G+'.213A>?DFNYYZWVUWVUVVVUUVUSUTTQQQQSSQTTSQUTTTTSUTUC=/-ƳE #ED2<èD 1?C/WųV7JP7IACCrbeYJf||{|{{{|{{{y{|}}|{||}}{{|~~wqpklgedaa``l_]]\[\[[\\[\Z[\[]]\\\_]_]`]`_````_``_]j\`_]]`]]`_`````b`aa`a``aabaaabaabadbdbdbdbadedbddabdeesffedbedddbbbabddbdedeebddddeeeddedeedededfffffVefddeereffffghC=febbbabbdbbbedadaabaabbaaabbbbaeaaabbbbbdbba``aa`aaad`abaaababaaa`aaababWIH¢vmZNQJT``_```]_```````ThnqmkebQKIC4.$ +2?HTV\fgmflfSK;8, /4>EGVWVUUTSSTSTTQSSTUQQTSSSQTTSQQSTQTHD6+?by. >GVD2+6mư 'e4 '=D13fIJA +DG87&9M62dų4E`V6Q° 2GSs`=\{|yyy{xyyyxyy{x{|{||{|{{|}~|xvpnkgfebbaa`_]]ZZZ[Y[Z[[[\\\\]\]\\]]]]__]_`]]]`_____]`_]___`___`aab`daa````aaa`aaa`aadbdddbdbbeddbbbdedegbbebbebddabbdeddebddbeddbddbdedeedbeedfefeeegdfffeefgfefeeggh<=Wdbbbdbbaa`babbb`bdbbababdbbbbdddab`abaaadbaaabbaabbabbbbbda`a`a`aaabbbVI`Ȼ˫|gZPKS``````````__]````bgn~rWN7&6G`ѦaA& (/DCUTTQTQSQSTSQSSQSPPPPQQQQPQSQQST>91?Z㰄_ ,DVWE=*Dr. Oº8 FF4-eĔ2 /J>1Cę#FP;;{'PSK;q>GErgpHG}{yxxxxyxxyxyxy{{{|{}}|{{}~xvrpkgefebb``]]][[Z[[ZZZ[][\\]\\][]\[\]\]``__]]`]_```__]`___``_```a`da`aa`aa`ababbbab`abfdbabdbdbdbbdedefddddbedddbdbddbaeedddddeddebdddefffefeeeeddefefffedeeeeeggfghFDdaababadbaabaabbbbbabba`abbabadddbbdbbdbb`abaaadbaabdaabbaa``a`bddadddKF{ŸpfJTP_`````___]`_``]```QMWfdH'!7?_O# $AGTTSQSQSSSQQPQOPOQOQQPQQSSUSTF//>rԝ{ ,9WUJA/1WιũF Dȳ3 /EA42g=JE,OɺT *FM3IƿG=_PAKIJ|#;A\xeyAa{{yxxxxxxxxyx{xyy{{{|{||~}|xtqlhggeeba``]\[[[Z[ZZ\[Y\\\_[[_]_]\]]]]\]`]_]]]__]_]_____````````abaadba````aadbaaadddebbdeaabdddbdfeedebbbddbbbbbddbdbdebededebeddebdeedbfeegdeeeefeeeefdedefgegh]=3ebaaad`ba`babaaddbbbababdbabdbbdb``baabaaabbbabaaaaabbaadbdba`ab`baaVMYп~{jdymO`]]__```````_````KM7+*9Oa¹ښ[$ $+JDTSQQQPPPOPOPSPOQOPQQQSTQS>3$Jx꾍= .KVIK6(>r` 3ɲ! (FJ,2m˩{ 2M2''>jϺźޑM &7HSQSSQPQPOOPQPOPQQPQSQQST?.'Nˢ 2JWWWF.3Pú .rȵ* 2EJ/(dٴq DJ4.}Ơ #HK99—Vv[6W\V`_]]`___``_TK?- 6T˲¼wvj`]\QPONHHHHENOPU\]_lty|3 7ETQQQQOPQQPPQQPQSPPQQQSF8$1_о- ,GZYZ[837w -aε$>IJ/*e׶V .EE,6ēT 1JO2=ή3!M`I7]Ϟ8(FCĵكfwCbny{xy{xxxxxyyxxxy{{{{{{{|{|~}xvqmjffea`a`]\[]\[[[[Z[]\[]\\\[]]\]]_]`_]]_]`]_]`____`]`````````aa`aa```a`aa`badbbbababdbdddbbdbdebbdbdbbdabadbbbbbdaedbbebbbdbeedddeeddddfdfefefefdefeffffefggj4=ddbababaabdabddba`badababaabadaaaaaa`abaabbaab`b````a`bbba`aaabbO6]bYgŏPa_`_\]__`_MN31>fڼů}t]TD9312&313<;8G<>>DDD=DKC<=9;;667.-.'*&*66GSj׾G *GSPSPQSQNQQPQPQOQQQSTTUH6*Eѫ6 2N\Y\\H=2`˪& -h©HMK71tӶ-6YC/Nʰ&9KG-`ĦnDQ_G>ū`#EAa{kJU|{|{yyxyyy{yxyxy||{{y{|~|{||xvplkgeda``]\][\[[Z[\[[]\]\\]]\\\\\]]]]\]]_]____`_````_```````````a```a``ababbdbbbbb`bdddbbdbabbdddbbbbdbeadbbddbddddbeddbabddededbdddeeeefddfddeeedfddffeedfgjEDebadba`b``abbbdbbaabbbaabbbbabaaaba`ababbbaaaaba``ababaa`baaadN6=¾l{fݵYQUa`__]_OK7'(Hxɦʲn]QIE;;7AEFJIZZZWZW[YYWVVWWUWVWUVVVUVUUUQTUTTUUVA>?92'+,49Yrп׾w 3ITSQTQSQQQTQQPQSTUUVUW=18r- /O[\ZZM89dп $8t̵P 2P[G/?ѫ| AH6/qʗQ9IM>;μ S_MAgȥ$=ES̪yvmHj|y|{yyyxyyy{yxx{{{{|{}|{x||}yvrpmjgebb_]\\[\[[[Z[[Z\]]\\]]_\\[[]]]`__]]`]__```]``````````````b`````aaaab``bbdbbabddaebbeaddaaddbdabebdbbddddedbbbbbddebddddedebfddeeeffdedeefffeeeffdffgg]<=dbda``a``aaabbbaadaababab``baa`bbbaa`baabbabaabbaaa`aba``aabV;C}ˮx6F}_DN`````K>'*Ar徸ѹlTNCWåY $>TSQSSSSQSSQTUTTTWVYYM81h忣6 .K]\]\Q<3TЙ ;̹3 ;M[G4HéI -DI-?ֹ>Y=2ZаE=_S?Jѭ4&GEЩ}ts<\yy{yx|yy|yyxx{{yy|{{{{y{{||~~{wtplhgfba``]\][[[\Z[\Z\\[\_]]\\\\\\`_]\]]____`___``__`````b```````````bbbaaabadaaabbbdbbadabbbbbadbdbababbdbddebbdbbddbbepbdbdbedddeeefddefeeeefefgeedffgfg]==ddba`a``a`aba`abaabbdbb`aabaaabbaa``a`b`babababqe`abaa``aaO<9xɫU7Y߫vGV```TT9,.OƯ˪yeKG<9>AQ_O[ZZYZZYWVVVWYVWWWWYWWVWVUVVUWUSTTTTUQQSSQSQSSQQQSSSQSQSQSQQTSQSG<-!$*Qr$ (AUUTTUUTTUSUUVUWWWZ[GA.I滦D +M]_\`SK*Iϻ 6y˫'E]]97Zն+ 6(,QwоE *JIVWUVWUVWWWUZZZ[\\]H83qɫQ8V``a`aO<>rԵ#.Fɨ .T]Q<1fι!EH2'~ɾ+DYE2?ΰF!J_P?Kɭ4=DHӝ{tKj{{{{xxy{xyy{yxyx{|{|{yy{y{|~||xwtnljfebd`_]]\Y\[[[[[]\]\]][[]]\\]\[][]`]]\]_`````___```_a`aa``````b`abb`b`ababbbbbbbdaaddbbdbeepebbdddabdbdeddddaadbabddbdbddbdeefdedeefdeeeefgdfeffeghZ6Eedba`````baaabbd`b``baaa`a`baaaabaaababdbadbbabgrdb`aabJ8_оδ~lv~b NdVbTA43gݻеgON\`qmheba`]][[[]ZYYWYYYYWWYWVYYYaUUVVVVTUUUTUSVQSSSUSPSSSQPQTQSSQSQSPQQPQQQPPONPPOQPPPQPQQQ?7++Nţ3 ?JZYZZYYYZ\\[\\[\]]_S>;kŭ<AdbdadbV9Fѳb&4HþO E`_S;8©=_]J;Ƶ4.FEӾw>h{{{{xyyy{yxyxyyyy{yyyy{y{{{~}ytrpjeeeba`_]]Z\[[[[]\[][]][]]\\\[]]]]_]]]_```_`````__``````a``````aaaaa`abbbbbdbdbdabbbeddaaabbababbadbbbddddeabdddbbabaddddbbdddedeeddeddeeefefedfefhZ<=eab``_```b`abaaa`baaaaa`aaa`ab`aaab`abdabbaaba`bbbabbI8A‘mxf YUC4-Iė`NCHZrqnkgd``__\\]][[YWWWZYWWVVUYZ[ZVSUUUVUUUTSSTTTTSSSTTTQQSQSQQQSQPTQPOSQQOPPPOOOOQQNPPOPPQQPOPQSS>/*!3V˨} &AP\[[\\\]\\\__]]`bbW?Ov׭#!TfdfefgZIM782jѵ(2N``H9Z !AW;/ĺ#JY<3Pڲ'J`QDfўO,G>mˏ~xD]{{{yyyxyyxxy{{xyyyyy{y{{{{|~}{xvpnhggeed`_][\[[[\[[\]]_[\\]__\\]]]]__]___```a``a`````a``````a````a```aaaaba`bdbdbbabdbadbddabebadbbddbbdedddddbbdbbbbddabedbbebbbdbddddeeefeededffegj?=ddaa_```aaa`abbbaaba``aa``a`b`aaa`aaadabaaa````aaadQ<=jetڝ *-HٸkI=DFMWmpkheb`]]\\[\_\ZYYWWWZWVVUUUZ[ZVVUVUUUUTVUUTQTTTTTQQQPSSSSSQPQQQQQQPPOPOPOOONQNPOPNPNOOOOOOQPPQQPSQTA4& 8YY44ξHC_S>Fʮ+??`חySM}{{{xy{xxx{xyxyxyyy{{yxy{y{~{xvqnjkgdd`_]\]][[\[[\\[\\[]\]]_]]\_]]___`_```````````````_`aaaaa``aabaaabbabbabbdbdabbadaaabdbbabadbbddbbbaedbdadabbaadbdbddeddebddededdfdeefeebeedfg]A=eda``````ab`aaaab`aa```````a`aa`aa`aa`a`abbaa``a`UK>ÝkewF폾{ˢt]ENOP]\`aj{njfda`]]\[\[[\gZYWWWVYWYYYWVVUVVUWUUVUUUTTSSSQSTSTQSSTSTTQTTQQSQQSQQQPNPQPOPPOQPPPNPNNONOPPNNQPQQSTTSUUUVVVWF/,Wʮ$8S`_]__``___````a`UIAjd$D]jjkjlkaTbϯP6KGQʴ{!FbaaO<[øU>ZN74Գ>MWK=2˰,/J_T>Zթ<4I>p~~Db{yy{{xxyyyyyy{yxxx{y|x{{{{|}}|xxsmlgfeda`_[]]]]\\\\[]\]\]_\]]]]]\_]_]]___```_```_`````_`l````````a`bbbbaaababbddabbaabdqaddadddbbbebbbabdbdebbbbddbbddedbbdeedddddddeedddedddeefgZ=9dba```_```aabaaa`b`a```aa`a`aadabaaaa``a`````aY>Hίdexf+ğũyVCCJS]]\]]]ak{lkgfa`_]]\[ZYZZ[ZWWWWYZWYZYWUUUVVVWVTSUTTVUTTSSTTSSSTSSTTTSTQTSQQQPQOPPOPPPQPQPQNOPNNPONPONPOOPOSSQTTUTUVVYYZZY\PA./\w6 !I\]\]]][\[[\][]__QOEж<#JefgghjkZPp/CTKv72OdbVJE{,OZF'Ś` 7JYD3r̗ED`_=FѳJ-QFhŊs?a{yyxyxx{xyyy{yxy{{{y{{{y{{|}}xxsnmjfdbb`]\]\]\\\[][[]\\\Z\\\[]__]_]__``__`__`_`````````````````aa``dd`bbbbbbbbabbbbabdedddbdbabdbebabbdbebddaebdbedddbbdbddbddbdeedfddfedeeqedgZHFbbaa`]``aa``bbaa`aa`a```a_`a```b``aa```b```aVD6pwfg=,qԯaSMOS_]\\[\\_bkyylheda`]\_[[ZYWZYWZZWWYYWYWZZYWVVTUVVVVVUUVIIIJGH>8C????>CCAIEHTFSSQOQQQPQPQPPQOQPPPPPOPNONPOPPPPQSSSTUUWWWYZZZZ[[\\\_<*3ڲY 8[ZWVWWVVYWVVWWWVZ9HȵHabddghjPWϵT1OS]ʶh*>ffbV>eɻ-H\E,QЩ ZWM.KѨs 9]]E=ӲU*JD`ӓ`ONp{{xy{xxxx{yyyyyxxy{y{{{yxy|~~{{xrnnkfdda___\]\ZZ\\]][[\[_[[_\_\]___]_`_]_``_`__```_````_```aa`aaaa`aa```baabbedbbbbbbdeddbdbbadbbabddbdabbbbdbdbeddebdbbabdddddedeedeeffdeddeffZ99bba```_```badaaba`a`aa`aa`aa`ab`a`aaaaaabb`N9WƝpkwrmٓq GEPOOCSONNONOOCE7$EŒh O]```abfWJ=3Я,Q]C8ɜ=FIٟN~qAn{{{{xyyyyy{yxyxyyy{y{{yxx{|}|xvqkjgeb``][\[]\\\[[\Z\_][[]]]]]\___]`__]_`_`````_`_``a`````a`a_`````baaaaabbbbbbbbbddadbbabbbbebeedabbdbdbdbddbbdbdadddddbadbdbdddddeeddebdeffZD=bb``_````bbbdbaab`aa````a`b```aba`aaaaaaaNECQPPQSPPQSSSTUTUUVUWYWWYZZYZWZZYVYVWTWVVH?&Fwm, ;CNO?NMKNNMMKNO?*F> $GYZW[\_SE]̳4KWYô6GjhgZ?Nɸ3(P]F.P̙| .WVF(\ŚAJ\S4Zϙ&;KAѭQ|~USSTUTTWUVVVWVWVYVZWVYYWVVVUUTTPPONNMA;+gϓpA a_]]\\]\\]Tlljeeba][[YZZZWWWJD=>1(&=Ij̾}_& !4CKWVWWYWdWWVYVVWTUVUQSPONNKJMKKKJMNMO;CmC ASTSQQQQQPESSSS?+/øQ +FPONOPQA-UªtPHl|Ta>Y||{yyxyxxyxwwxwwyxyxy{{xxy{}}xvqplheda``]\\][Y]\[[[[[]\__]_]]___\_```_```]_]___`__`_```````aaa```aabb`aababaaaabadbadbbbbbabbdbbbdddddaaedddbbdbbdeddbdddbbaedddeddeddffg]ADdb```````a``daa`a````````a`_a`aaaabaaI;]Ԩny~W|ٹeOK/`__]\]\]]`j}qjfdbb]\[[[ZYZ=41(#9M¿ʾתp2  9GMYYYWUVVUTSSNONNKJKJJJKMKNNPNPQQTU11sI 1$#'!! ' # =PONOAPC1!p̻9EHhˢ8Yrnn`JJϴ!4S`K6_̞P >YY=-r.M_N7ഏ=1JD]ɍhYDV|{{yyxxyxxxxxwwxxyxy{{{{y{|}xwspkgfeaa]_\Z[[[[\\\\\\]\]]]]]_]___`_]_]_```__`__`_`_``````````````abbabaaaabdbabdbbabbdbddadbdbbeddbbdabbbefbdbdpadddabdddbddbbbeedbdefefQ<>W`__]`_```a``bb``a`aaaa````````aaabY=Drq~nѾ`OIU`>qک a`_]]]]_akxqmmjda``_][MA3#!/Uп¸~}klkaYW_]akbrsxβx}g, '>KUTQQNOMJKJNJKNNNOPONQPQQQTTEC=& +ȯ~Mnr|xpea/ ,pb !>QSPPQO;!;Ѯx3=E״MAjsqpYFtKNaTFFϠ 6YWI*_ȩ+I\K9C+KEPГ9TFn{{{{{{yxxxxwwvwxyxxy{{{xxx|}ywtplhfeb``_]\\[Z[Z[[[Z]Z]\]\]]``__]]___`_]`__`_``___``````````a`ab``aabaabbaaabadda`bbedbbddebdddbbddbbbbbbdddbdbdddpddededaddbabdbbfddefTK>ea``_``a`a``aa```````_```a`abaababI7mɤwmy}ݿڿ`EDT```T8p >``]][Pblpljjga`]OD2*&=bɮslZTJ;7/31*-,+36492;7782'>,,,*$,(& .1?KPf׿~ݓJ *-?NM=KMNONOQOQQeQQTEA<7&!!/EUkxϾt+ &-28GSSS6&Vѹ1IS]_]__]_`>y Q`__dlypjggTC-?WɾfTE849?=JHIHTUUTTTTSTSQTUUUQSSQQPPPPPQSPOOPONONOQNOOSNPSQTTGI4,+'(Jlкd' ,WTWI;7+*3Psn}Ш~T2 OϹ 1<ɘ>da``````a`````````l`````ababWDNƦtt|k߾Ī{VHK]]]]\\\]]]_\_4}]afnrTG9P忻߿rQF9=8DJYWWVVTUVSTUQSSUTSQQQQSQQTSQSQPPPOPOPOPOMNNNNNONNNPOOPQQPTQTTTUVUVVUWUUUQTE7$ 2\ЪwSޔx~ޗ=?x $1߳ 7nxnbʴGfeQ7Ϭ .YVY7Iի,M\CA띝 EY>Ѡ{_~*j{x{yxyxxxxwxwxxwxwvxx{{yxxy{~}{xsqmhfdaa]__[[[]]]][\[[\[\[[[[\]\]_]_]]_`__`__`_`_````````aa`a`aabddaa`babbbbbbbbaaadbbbbdeedabbabbaeddbadbdbbbdbbedddbdbdddbedaeeedZD>dda`a````a``a```````````aabN6hƑpr迺ϺdKO_\]]\\\\[][_]]_>e \eSI\ϾռhOD<;EEKWVVVVWVUUTVTUUSTSTPSQSQPQSQQSQQPPOPPOOPPNKNNMNNMMMKNNMMPOPQQSUTTUUUUTVTSSSPNOM>KN?>(!#Fxѹ|鶸ޔʳxڗ|ѩ忝(h˔'Qkq|ly1CgeZ=Tɍ$WWW<+ڴ=H]D3㦒E\>[a3n{{y{yxyxxxwxwxwxxwwxyxxyy{|{}}{xtqpjfgd`__\\[__[[[][\[[[\]]]_`_]]]__\]\]__]_``__```````aaaaaaa`adbaaa``bbd`aabbbd`abbabaaefddbbedbbbdbdbbebdbbddbdddddeddbdeddeddeT9;baa````````a``````````aabbH?Ӵyv}̺nNFTa`\\\\[[\\[]]_]_JAQ HaϾӢhNC;>=IYVWYVYUVUUUWVUUSSUSSSQSQPQSTSQQQQPQQPPOPOOPNNNNMOMNNKNMNNNOQPQQTTUTTUTTTUUTSPPNJKKKMNPPQSUUG1 #e|׌ϲxq}ŒA 1!E֚U ?OhpwpyѤ22ڰ $-l3Ьt?}|yyyxxyxxyxxwxxwxxxyyxxx|{x|}|xrqpjgda`__[[\\[[\\ZZZ[[\[\]\\]__]]]]_]`]]`___``````````b`b`a``bqqbbdbaadaaabbbbb`abbbdbbdfbdbdadabadbdbadbbbabdedbbedddbededdqeefZ==baaa````aa````````````abWM9sΈ}ߒwq}~ sJN}|{x{xyxxxwxwwwwwwwxxxyxyxy{~}{xtqnjgeb`_\]]\[[[[Z[\[[\[\\\]]]]]\]]_\]]_]__aa`__````````b``adbaa`bba`bbbaabdbdaabbbbaabbaa`ddbbbabbbbeadaaedddb`ddbedbdeddeddffU>>b`aa`````a`a`````aa`a`N8~ʮ|ny̺ƴvtP`]__]]]\\[\[]\]]]]QD2Mԯ`F<=GK[ZZVTUWWVWWWYUVVTTVTUTVUUSTTTSSSQQQSTQSQQQQ]POQS]PPMNPOOMNKMMPNPQPQPQSTTTTUVUUSS]PMJMKKNONQSQTST?..>sɣ{ɾx쎐}ɓމf /Д3b``NKOÜ4YkjU?vϭq ;HTK.Sϣ 6;IwC.Qx x>V~}y|y|yyxxwxxwtwxxxxxx{xxxyyx}~{wtsqkgfaa```]\]\\Z[Z[\[][\[\\\]_]\]`___]_]_````````a````aaabbabab`d``aa`b`baa`ababbbabdebbaddddeadbebdbdbdabdbbdaddddbedbedeeefUE;eaa``_`aa`````````a``AA궶xv˖rx[`_]_]_\_\]\\[\]\\PE1EʫePVb```````_```aa```S3ZӼ}vx̎v|Va_`]____]]_\\[]\P87f I```]\[[ZWVVWYWYVWUWVVUUVUUUUUVUTUTVSTUTTTTTUVU>A?8+#!   $ .4>AGGEN?MNPQQSTUUTD-3\ޢȻ|Êf 6[`wdA;ݳCTrnlSM֙8 4pJG=yy NeAhԟm (j~|{yyyyxxxxxvxwxxwvxxxxxxxxxy}}yxvrrlgde```\][[ZYZZ[Z\]\\[]\_[_\_\``]j\`_`]__```a`abaa````a`ab`b```b`bababadbaaabbbadabddbbaeddbbbadbbbbdeeda`dabaabbdbdddeeUFEb`b`````````a````O7jv}vվrv̬WU``]___]\]]\][\O<*hdjɮI4`]][[ZWWWUVVWVYVWUWTVUVVUUUUTUVVTTTVUIC;1& *9Ndq˲|aU>/ #/?AUVJ4!(a갏ƈΖvԓwɒęy 'V[qnW<ߴFTsqpSDϫMIJE- ?PE4݄~ HeFsڠv 3l}{yyxy{{xx[xwxxwvwvxxyxxxxwxy}yxwsqjggb``_\][\ZZZ[ZK[[\\\]][]]\]_]_]]_``_````````xa````a```bb``adbaa`bbbebbaabaaabbbddbdedbbbddbdbbadbdbbdaabaabbdddedbdefU?>b`a``````_```a`aHCάsnã`ȩZSQ`]`_]\]_]\[]P=6`Ěk[SI~Đ `]\YYYWVVWVWWYWVVVUTWVVVVVVUUUVWD+- (DW߲e< QΞ酰ɘ⃨ήߔՓ EV]afIUSwrp[;KM' M[Q2ׇhPUDےp|6q}{yx{{{yxvxxxxwtvxwwxwxxxxwx{}{wvsqkjfda__]_][Z[[[[][\[\\[[][\_\\_]_]`_``____`_ab``a`a````abaaaabbbnabbdbab`bbaabdadbbbbbbbdbaaadaabbddddbdbaaabebdddfeeeMP>Saaaa`````a````G?⿼ntڿw]ѫ\O```]_]]]]_]_]I1NΜkkjnlWFQ G_\WWVVVVVWWWWVYVWVWUVVVUICC4'6gӖI}󸗥vɭv󞄫ʹ񘤓 =FV\dNvqTfZ>7=rIZqC1[[F8ӃbYUDד{Es~|xyy{yxxxxxxwxwwwwxwxxxxxwx{|xxwtqmgeaa`_]]]Z\[Z[]]\\Zm[[]\\[]_]]]`_`_`_``_```````````a`bbaaa`dabdbb`aa`bbb``bbbaabbddbadddaabbbbababbedbbbaddedeedddegSJ>baa``a````a```HMڻ~xԦfdջ_Pa`]]]]_]]]]]P9Aըr_mvnjhZ1׊b][YWVVVYVYYWWWVWWVWWJ;2&$ِ1x[S~}}|y{{{{xxxwxxxvxwxwwwxxxxxx{yxvwvrkfda`_]\\[][[[]\Z\\[\\]\\]]\]_]]__``_``````````````aaa`a`a`babeba`bdabba````aaaaddadbabda`baddbnabdbbbbbaadddddfdeefSJ>baaa`_`a```aaDU£mˉhxԵWDOba`_]___]]_=1xUIttplhgd;{ ][WVVVWZWWVWWWYVWJ3' 1Oxȹ²pnh}|nldrqsվ–̘ήwĖpȓ!<޺ӴnJ?Gjtnhgd``a6}6(ZWVYZWVZF42!,G}ʹs[MA2-24+1.4=;D?OOPPQPQSUTUUTUUUUTSONNCD;G=99- Jʰ񰐟םyԂɜݩے/ $b`kEEn}Ϧ~ 8YWW.|媉 7Z[AYٵ| ?aWDkf+g~~|{{yy{yxxxxxxwxvwwwvxxxwxvx{}xxtpjefaa`]]\\Z\[[\[Z[][\[_]]]]]`\__]`rb``_``a`a```````aabaa`b``ab``b`adabbbbbbdbdbaaaaaadbdab`baadbbbdbbaddbbdbedeeTK>baa`a``_`N?xľgwpɾrxkӉvtt}Q81`ݪvT=KQkrkgea_]_/` \ZYZZE<(+J̾_N>2*.84;AGCQPOONNMNNMONPQQPSSTUTTTSSSQPKMJMOPQSTVWD3>Ȱ橗ޤט}ۏȘeaYreJЖ CZVM+~ޚ >Y[3[ک IaNIp(m2l}~|xy{{xxxxxxxxxwwwxwwxxxxxwx|{yxwrpkfeb`_]]\[[]][\[[]]\\]\]]_`]_]]_`e````````a``aaaa``bbaaaa`aaaabba`bbaabbbbebdbdbbbdbaabbaabeffda`abbbabdbbddfefJQ>S````a``T7xڻjxq޿׾jxlfrnj]sNƐ[HKMOfwtnjfda_]]C>A 9[I4(.]κeP;.7-̰|{ɗ~Жꈺ뗝x`>{ ̹6|mY«aSZY=/̚ +YYO4ׅ 2aaHmy*6es~}|{{y{x{xyxxvwwvvwwwvxxxwxx{~{{xxsnhea``\]_\]\[\\[[\Z\\]__`__]]__``__]_]_`__````````a``aaaabb`aaeaaaaab`bdbb`aaadbbdd``bbababbbabbbbabbadbaddeeeNJ>b``a`O9yqxqڼљbslb`\kxvpleba_]]_E9sÙV9DS_Tf\ppkhd`_]\]]\_.>KdI76d}~{y{|x{yxwxwxxwxxxvwxwxyxxwy}|xvwslfd```_`]]]\[\\[[\\\_\]]]]]_]`b__`___``_]```````aaa``abb`a`bdeaabaabaa`aaaababbaad`b`abedddba`abddadaab`bddfeNNZYYVYVUVVUTTSSQSQSQQSQQONNMMMJMKNNPPQSQTSTUTSSQSPQPKJMZNOPTTD+Gʦqt󢜶vꎬ~ЏȈv֐ Вtb ~TP7԰kn{߿ԟ]UĸȵkP__]_H3OԟdKPghHe{YQ1m P]ZZ[YYZVWUVVTUTTSOQQQQPQOOOPOPO?C2(  '8We{Ѽݬ|՝|x󄢘ּZw$w׌“wklk[y|H_[=9q 3VYF6AbW=`$ejpO{{yyxvxxxxwwwvwxwxwxvvxxx{r~xwxvqgdb`_\]]\x\[[][[][[Z[[][[\s]]\\]\_]_```````a`a``baaba`abbbbab`dbbdda``babaaddbbbddabdbbda`daabaddbbbddgOY|Ϩexv~}Ŀh}ēn~egsqmAS}WH__]KWyݭqN?IH3y'.[[ZYYYWVWVVUVTQQQPPQQPOOQD=3/! JjĮ븚񭚙ׇ߉ blД *kkYwe`\HQŔ EYZH=OZDvޥתK`{yy{yyxxxvwwxxwwxxxwvwwxxxx~mxxvlfea`_][\__\]\\[ZZY[[[[Y[[``[\]\\_]_`_`_``]```a`a`ababaabdbdb`bd`babbadbba`bbbbbabbdbbdaaabaaababbdbdffKUWѲaxt۹̪jӻnѣk{j۫`VI\Z[H`n״yWGJ][Z3fG \\[YYYWWWWVTTQPPQPOQQF6-&!1I{î«̙ⓝ{tԑy~Ơp 2jl]`xV!V]O2lÍ7HY\>a2Q\[]W}㘳̼ϳvsG AfZYZZM8h6]\[YYYUUTTSF<2*>vŹƼtdNpר~˓{̹rjrxhn| 3f}GZDa_P3 8Eq3 S~|yyxyxxwyxxwxxwwwxxxvvwxxvxx{ykxxmgea`]]\\[[\[ZZ\[[ZZ[[[Z[]][[]__]\___`````a`abb`ab`a`babbbebbbddbdbbaaab`aadbabedadbdbdaadabaadbbddeeOZջ\qr̺բ`~}p`9_ٞ_pE]]Ir~ο`|69OWY[Z\&l ]]YZWWUT?.!Nét_JM941- $&+* dʲץŎxgwHbw~yⓂ 8b{l]sUbT2e_ lY<~|{xxxyxxxxxwxxwvxwwvvxwxwwvx{{gyxlfed``]\\\[[[ZY[Z[YZZZ[[\]\\__]\_]_\____``aavd```b`aaabadbbd`bdbbdbbabbbdabaaadbbbbbabbabaabaaedddefGZnlsѠT_xя~{vW8tֈj`QxtMHKm髹UxÒ#&H]Z[[\8T- K][ZY?2 ;{̺mUF=.336<=DAEFPCOCQQD?-Aɭ뤗ȗxݓvډqltϊ\ C_rkPdԙ?9 }f_nj[J |2{yxywxxxxxwxxwwwxwwvvwxxxwxw|nx|wlhda`_[[[\ZY[Y[ZZ[[[\Z[\][\\[]]____N__`_``ada`a``bbaaa`aaabbbdddbdbbbbbbbbabb`bddbdddddabdbabdebfdfMVjdxَY׾x{yr`F8~Ns\Jtw;`wx~Z!-Na[[[N#b(.]P6 $O޳tZE34*8;al 3QO>Cx 3{{xxxy{xxwwxxxxvvxxwxwxxwxwx~~m}sjfba__\\[\Z[[[Z\\[Z\][]\\[[_]]]_____````_```aaadaaaaabbabbbbbddbdbbbabbabbbbaabbdddabbbddbdaebbfeeG`и{dɸђUt˨sxxmhkpJ82ڻxSGW{ZSry{qռʲmĚɔ*GdZ[Z\'ʉ 'CЭjN8+.38AUWUUVVUUVTTSSQNNKONOP7 hмИ񰗸}}–sԑʚƁbxy|yy+CVPx#j|xeW M__D[ QYPv~yxwxxyyxxwwxwwwxvwwwwwxxxy{}yxqjfd`_`_\[\]Zg[[[[YZ\Zg\]_]\\]]]]__]]`a``aaab`bdadabbba``bbdbabdbddaabdddaaa``bbdddbbbadddddbbdddgN\Յ]xщ|prdhj_(NߪjNQP]SqxWNqx˺ɦWΔ<,6Oh[Y\;mD ~ʬ[C6-3-=EQSTSVVVVVTUUTUTQQNKJMNND-+ʟ¯堝󬓻rڒ~ʏ˗֘rpxl EmdfCIM=JE?A6* r rw~|yxxyxxxxwxxvxwwxwvwxxxxy}}n{xphgb____\Z\[[\Y\[\Z[[\\[\]]\]\_]_____`_`````abab`abbbaabbbabdbbbbbbbbdbebbbbbbabdbbddabdaddbbddegN\و[xЊhѾ}yxg\k*fהYGO\\[\\`pfODh˳Ӽsaʗk('Hf\]\>\Ӯ[>.,.TQPPPPPPONONNPOQQUUUVUTTTUTTQPPNNNOO9W񾓓ğĚg~󊣭Ƭ<}ymW\fwg+phgGT9aaDFv (r~}y{{xxxxxxwwxvvwwvvvxwxx|}xm}x\hd```[]\\Z[fZZ[\\[[Z[[Z\[\]]]]]]```__a``a```aabnaa``aa``bbaabbbddbadbadadbdbbbb`abdbbddbbqdegHbѾ_wɲnƤŜ]~{ˤwިHٸrKJ][Z\\g[ZZZ\]ZOpjY

-~֎s¶|\hߩ\MHNY\adW$T#SQOPQNNPNNOQSTUUUUVJE2$8S}⯞¨ۄ堵w~„βmyv} a—8qvnKxt}xߤdp g w{xxyyyxxxxxwwxwxwxxwxvwxwx{qn}phd`a`]\]_[ZZYYYZZ[[\Z\[[]]]___`]__````a```_`a``bbbaaaba`````bm`aaa``aa``aaa`abdbbddddedeeHfӸ`tpӾɾl~yӪv֭k݌ݻ}KE]\\[Z\\[[Z\[[\8Cٸ|MĪyիbJVWYK]ab! ISQPOPONPPQTTVID;(##MmƺѬ󿥵¦v݄ƣxߏ`_x¿ݏ˜|rh|spY}wq18t}nIMd7xqOx{xxxxxxxxxxwwwxxxwvwwxxxxxx|r~xqjb````_[[\ZZYZYY[[[Z[[\[]]\_]]`__````a`````aa`a`ba`bbb``aa`aa``a`aab`aa`babdbebdabbaddeeHĺaƒ\xฤsnٵ׼|TJ_][[][\\\[\Z\G6KƶָnTAk>=UVVWZ]aa;P& =USSQPOPQSH9-!!=pư˼ʦ̜}ꖺʂɫWέԶmÓxpytqy~,GfeSƈw}|{y{xyyxxxyxwxxxxxxvvwvwxx|~fhda`__[]\[Y[Z[ZZZ][\[\\]]]]_`__`_``_```````````````a``a`a`a`ab`m``a``ba`abbdbbdbadedEf˨J~rftvɒw֘vкxOM]\[ZY[[\Z[[[_869CVVUTUTSPOND(\龥}ף}”ĭxζgӢȘb| [Q2Nm]mW= ij wfr~{yyxy{yyxxxxxxxxxwwwwwwwk힞xked``]Zg[[[[ZZZ[Z[\]Zh\_]]_]_`]_]a``_``a_`_a``aa```aaab```a`baaabaaab`b``aaaabbbded?rmaРkӺ̉xxp׮t{Քwڸ~UM][[[\[][[f[[P3ZՑOZmfa_][ZWUPQPPP=9֓]rxY3 .6f|mnm{w_O]`POF|κxO;4?EIUTTUTUTSTQONE+O׬̏}Țvôxϵt|׌хxYyGQȄaN |El \kq{|xyyyyywyxyxxxxxxxxvxx{t}{Tsehd`l_\[[\[YZZZ[Z[\[\\\][\[\`__\`````````````a`aaaa``aab`aaaababbbbbb`bbbaa`babbbffAs˿ΣFyyˤgy`㝅d{ƳӎVJ\[[[\[\[Z\Z[N8[vEHwtd`\\[YVSQQPQ3pvD3/+!9GIIMZwydKZWYM1(qЅ4?MHUVUSSTTTUUSQNOD1I඘ɥvtƜöξ󗻬e³ʵxyl{xxpU|9sՌ`{G  me8l{yyyy{{{x{xxxxxyy{yyyxhm|qrq}`Yb``]]\Z[Z\[YZZ[]\[_][]]_]``\```_`````_````````a`abda``ab`aabba`aa``bbaabdaabbdeeCx¼Oﴎdľbhx`ćՑ]K]][[[[\\Z[[\Q1bHDgtda]]ZWVSQQQE.!߰_E>APNMIKKNOQgmbrK=TH.1d㴹ߩmU2WUVSTUSTUUUTSTPNP.;୓ГկwѲ]f°w΃pxV{ys4v|eпl}K<`|{f{ʄep}yxxxxxxyxy|{{xxxwwwwwwx}|rvjdba_]]Z[[\YY[ZZ[[[\\\]\_]\]]\`````a`a````````_```dba``aaba````aada`aab`abdddeedfHq˾hb΢gƶkt|`ߓs`嘉ߔ`E][[[[[[Z[[\[M9p|KDbxga`_[WVTSQSG<ˍU4FPQOPNKKNMKKCFVZUG7-[γ\8JxMYUUUTSUUUUTPONO=/ΩȦ溗վqϿxϜvțfʦp׃|DlZѳڅ66 n__vrq|{yyyyyxxxy|}|xywxxwvvxxwvxx~}|pfd```_[[ZZ\ZY[Z[Z[\[[\Zh\]_]]_`__``a````````aa````````abdabaa``abb`adbababbeeddfC}РO⣂gȃvƮrgレ]g\Q[[[[[[[[\\\P/]qPDTxsda_\YVTTPP?IwI-/ƯӯO<>/HI6VUUTTTUTUSQPNP> x꺚w⓻vњxrbÜqİhtxqyE?d»Ɓ,*A / J+q~{ny{xxyxxxyxyyxxwwwxwvwvwvvxxy}mx_ebb]]]]ZY[ZZZZ[[Z\\\\]\\\]]___`]`_`_`````]aabb`a``b`aaaaba``aaaa`aabbaabdedadefDtƻM`Řeŵweڒs\ړӻڠmvS]\\[[[[Z[[[M6fkNGQdxeb`_[WTSQQ8p۫]=7QQOPQPNNJHGHHGMNC1'ԯJ$'yZ rs~yxxx||xxxxxxwyxxxxwxvwwvtwx~}l~pfdaa_\\[[[ZY[[[ZZ[\[Yg\`]]]`]_``_````a````a``bbaaa`abbaaabba`aaaaabbaabb`afffd?ƓGqlӶeߥwgמslʞ׻վk~mP][[ZZZZ[ZZO-jߵjKMZ]rtga`][YVUD'4ÇK2EOOPNNNNNNNMJJIH7&2ȳϟYHCHTPSSTU.[&7VUTUUTQSPMN(Dɺ˙ɩ|Ģе٥yjď¬xfτ˥xx|[f|vPTksE3/JPAJs \ |j{xyxxyxxxxxxxxxxwwwvstvvwwxm~hxkfa`__][Z\Z[Z[[ZY[\\\[]]_[]\`_]_`````````````a`abababaada`a``aa`aaba``aabddefeIvɺO`‚x⻜p_먔]psvN]\[[Z[[[Z[\6g߰`GDZNdjb`_\[YUH$DֹgF4PPQOON[OQNNNOMNN3[ӦlH;HQQQOQQTVD&KI&[VVUTSQPNN61ijЬݚߓό䩗ȹ¹ٰyݨݮYĸƏ«q|WxUästaV~y4-v{ $PUY;nS_Ahryxxxxxxxxxx{xxxwxwwxvvswvwxx|}vegba_`]\ZZZ[[ZZ\Z[\[\[\[____`]__`a```````aa`a`a`a`babb`aaa`aaa`aabbdbbabaadbddDv[Уl©Yݥ{dΝn]̼y{h__[[ZZ[Z[Y[4SgGOYY]|veb`]\ZVG-CnC7QPPPMPNNPPPPNNNA/֚Y=[[\>}rAaxpyxxxxxxxxxxxxxxxwwwvtvvtwvw|ra[daa`][\\[][[[\\[[[[\\]]`_`]`]```_````a````aa`abbabbabbaaa`babbaa`aadbbbdfeeE̿PbݵrϢxxsΝa։sk_[Z[[[[YYZ8Q`HG\YYQxtea`_]ZK&pюY2EQQQQQQSQQPQPSPF/,ɇI7;OMOOPPPOQQTTUVDHP#WUUF3Cr{syy}v{}}w|}ڣ⟟ՈߙɎ_ôβyD˹ûĦ⇲|ٝY˯s{v\ n_kî{ ]\]Q= y Gyt{yxwxxxxxxxxxxxxxwwtttvvtvwxp}]fd``_]\[[\[[\\\[[[\[\\j]__]``__`_```````aa`abaaa`abbbabdab`babbbba`aaaedddfAxWޗk¤V쪙rStӿե`vW[[Z[Z[[[[AGmHFYYZ\q{hb`]]\E$swK8DTSQTTSSQSTQQSP?$>]E9ENNONOONNPQTTTUUHƨ 4= 4h©̺qql~¬ђ蜢¥ߥyƶ̄Ű}$ѼźԅŲyځssksgxS&2|4\[]ENp t |rr{xxwxwxxxxxxxxxwxwtvwttvwvw{kvjea`_`]\\[[Z[[[\[[]\\[]]]]_``_`_```a`````baabaa`m`bbdababaa`bdaaa`aadbdbdde;ʩGs̴YjvteпԪbVQ[[[ZZZ[[HImNHZWWK`web`_]?3~sC7TSSQQTTSPQSSTSS?!gΉF3EPNONPMONOPQQTVTUTT4s= 3x©ѿ}rqnƿ}袓ϙxyyƶŐˣl»ĻĹyW𐰰|Wɖp|lfPMxY_AM[\\/ w 7}yxxwxxwyxxxxxwwxxvvstvwvvwx|sbZda``_]\\[[Z\[[Z]\[[\]]__`````_``````````aa`ab`aa`bbaaababbbaa````bbbeeefeFdfѤe޶xh驍vZy{ewN[[[[Z[Z[I-݉VOYYYVJrga``_>(qGDSSQSSQQTUSTTQTU-+pA?QQOPNNMNKNOPSTTTTTTUE9mʶ|jxϹ׿񖓿䪏~ӸӺxŻϟmëƶ[q~klsfY M| 9KJ={ 6[[\HNt ]xpyxxwxxwxxxyxxxxxxxvtstxxwwxyqv[gb``]_\\]\[]\fY\[\\]]\__``_`_```````a```aaaa``abbbddabaaaaaabaaaabbdbbeee=ԣMwΣYksrŎ_rײUQ\[[Z[ZZN3ۍPAZYZYY`vdb`]I4h??TTUSTTTTSTSTTTC'?ڐS9- ƶιtpʺùլ~钓Í́yijݬmИ~ĺΔp՘vxtqv}g_1 P]V1 N\\[23O8qywwwxxxxwxwwxxwwvvtwvtvxx|pvqeaa_]\]][[Z[[ZZ[]\\\]__]]__`a````a`aa`baaba`aabadbabdabaaa`bba`abdbdadbfDP|lYۙ|ȤU~t׼ևqĒvNN\ZZ[\ZM?SD[ZYYWOseb`_;6]D>UUTUUUTQTTTSTU8'nr?1CPOONONNKKNOPPQQSTSSG3'J̮۰l®˾Ť撟}|⚒qο퇂̠tѵĉpy}}`kkvd䝩~G[m ?QPA(<&[\[I? Cv{xwwwwxxxwxwvwwwxxwvvvwtwxwxpk\da``_]][\\[]][]\\_[[]`_]]_`_````]``a`aaaaa`ba`bbaadaaab``b`abba`dbdddbdeG~QsyU`n|ő_ӫ]ٝ`N[Z[[\[\3dUJ\ZZZYKb~{b``E7[AAUTTUTVUUUTUTTU6+[;6OPOPPONNMNNMOOQQSUSE2IʚWfɴݩߔxߔ~r˴֮gˎ̝p׍Ê􈯟j_ʥ|Èwrvx|}HHSSP+`w E[Z[Fqr {xr{xxwxxywxxxwwxxwwwtsvtvvxxx{vqfb``]_]]\[[[\][]\\\[]_`_]_]_`_``````````aaaaababbdeb``bbda``a``ddbdbdade=ΪG}֢JӤvŤKxsZ쳞kU\[[][[[9[ޤYD\\ZYYYOg{g`aJ9V9ATSUVVTUUUUTTVV/DэO4>&YYZM9 1w{xxvxwxxxxxwxvxxwwvttttvwwxy~vykeba_]]\\\[[[[[\\[]]]_]__\]_`_`a```a```aa`bbtaaabbdbbbbaba```abpebadedddDs[ۊxb[esrʐaڅVϠYS][[]\[?G`N\[[YYWZSyvdaJ/bDVUUTTUVUUTVTUUH(CѿτD9PNNNNNPNMNNNNNNOPTT93ߥe ̮ƻ˜ĺ㝭ƙﻊ¯tļɶяõɵx~я|Y|xmrpxqVY_FSS/ZÁ DYZZ?k bs{{wxwwxxwxxxxxxvwtwttxwvwxywdWeab_]\][[Z[[]\\[]_]]]_][`____``_````aaaaaabbabbddeabdbbam`bbbddddaddde>ΥGxяGפxșUjڥAฟ{V\\\\\]H>jKPZZ[YWZ]g~hbO/WAJTSUUUVUVVUUUT;$`eE=CMNNNPPNONNNMMMMNQ8(&bSƝW̬¿ʹȾ㰎Ĝx}×{οfƳŴÇɸ¶ž\rt|mŘ{j`{dP~`q ;TSH?!YWYN/ x~&|}xvxwxvxwvxxwwxvvvvvtvvwvxx~wy`fda`__\[\[[[\[\[Z\[]\]__]]````_`__`a``aadbaaabaddbbbb`abb`adbbbbedabdeEWx~ѴU_Zȭsr‚|ԼZlѢ`P][][\F4mKI[[YZYYZajdM6PAHUTUTUVUUUVUVV<.ےN>>OKNMMONNOPPNNMNOOC1,pݩ`1& p޸þ¹ɻߢxs[jԎxڭaŴÄ麓Ʋʹȏr{UItsfnpsPyt DTS8M >WYW=a G}|xvwwxxvwvwwwxvvtsvttvvxxx{mrgd`a__[Y\\[[[][]\[Z\]_]]]\_`__``````aa```a`aababaaadd`d``adbdabebeddeYEڢGwsJϔxښPwqZ߼~Q]][[\P/vݍYJ\[[ZYZZOggYAxUAZVUSUUUVVVUTTW6*׍H;FONMNNMNONPONNMNNO4#Fj7/x t8(~}kxxttvsvxvvxxvvvxvswvvxxxyx}pshea`_\\]Z[\[\[ZZZ\\]\\]]]]__]_`_``_`````abbdaabaabddbbddbaadbabbade8t\߁߼ӅfˣlߩSek𾟉YN\\[9EߟTI[[[ZZYWZ\_heIb>KWVVVTSUUWVVWD4YxEEUTQQPOMKKKKNNNPO7kڒO7eAο~{lwttknkdhjedhly|}֓rɺŹۣtijµƏ׍~ƿƺõ}bx3j詅KtSv`p+w#+QUS.HTUTY1P I|pyxtvvvvwvwvwwvvvttvvvxxxy{|}Òm`fed`__\[[gZ[[[Z\[\[[]]]`__`_```````````_`aabaabddadbbaebbdad`ddbde>ιG˼jYUɂIՠ׊g䫢~G[Z[I3]D[Z[ZZ[Y[WZTn[qNH[WUWVTUUUUVVI,_yNDUTTSPONMNKJMNNPEwJ8ENNKJJIGHGI;#S迦+W־{lhhtyľȳrmn}˺Ĺ٤|ȹПߍ|˴~ȼƥdʳΈS~s~qvb}dlgAt TQSC=} GTUVHMj pF!}nxvtvwwvvvwwwvvswvtttxxxx|{gfjfba__\\[[Y\[[[[[[\[\[]_\\]_]_`__``a`````_b`a`aaaabbbdbbabbbadabqV6n]~ֻwbѓlYڦehɤdG[[P1mKM[[YYYZZZZOI`|MI\YWUTSTUUVVVI2hnDFVUTTTONMKKKMNNO6MY7]aﮙTM[]9`یNF[ZZYYZYZ\]VTٍH?YWUVTTTTUUVUK6hbAAUTUSQQOMMKKNJNQ/m72ENMJKIIHGEEF<,KijW«hYbȹƺȺ´ꔔʫϐxƸWڇɪȢh̺{|Py̭tm[twpa/x?ST>9 >UUWECe `Ņ}}mxwtvvvvvwvtwvwvwssttxxxwy||lsrjeba`]\Z\Z[[Z[ZZ[[]\[][\___`__]```aa```a`a`aaabbeddbabadbbdabbaefEwTwڻ|m֥q~jhލnmݩlOK[G8߸ۨaIZYWYWWYYYZOHw۟QAZWVUUSTTUUUVC+`bFITUTSSQOMKJJNMO9 /Z?;NNNKKJIGIFCHI'IµٿÖqUb~̼Ѿx݊ʠч֔x۠w̴rʲ}ðђlø¸Mńa~w{6eQ~``3-.TQS HTTVW1I Q E{xvvwtwvtwvvvvwstttvwxyx{|~{py`fd``]\]Z[[[[Z[Z[[[_\][]_`_]`_````a``aaa`ba`babaaadddbbbebbbdbbdZ<ɻ=ݿ֖xPSۚ?ѫ__|`PM2׻fE\ZZYYYYZYYM4Å GUUVGK} bʅ ~pjxtvvvwwvwtvxvwvvstvxxxyy||tprwda``_[\Z[Z[[\[[[gZ]\]`_____`````la``_b`baaadabbbbbdbdadbedddebf<{T|ֻgmۦwln]ltڪ]>1b{NMYYWZWYWYYZ>?dGIWVVUUTTTUUVY*TfAEVUUVSQSNMMJJMN;&fn>,ANJKJKJIGGFEGG-/Ưô{\ZxźϢx~얢Шmڵ~x]ɳ׸Ueēj»ĸExlCeWxYk#;HTT'!!UUVJ4.V ߓUJZZVZWWZVYY;.hA\WVWVTTSTTUWW.V\>IWUUSTSQQNNJJKN!'ӺޜV37MJKKMKIHGSGFEG71ѮѵMõ߻x郄ϒx‡rfɲߩmð[µȯPȿxnsbx`skax/#ZVV9< GUWWDM{ Pē qpxvvtvvwxvvvwvtvtttsswxyy}~xpnfbb`_]]\\[[Z\Z[[[\][\\]]```]__``_``aaaaaba`aabaaabddedbbdbdddeg3vS}Ⱦ]ssߨ~g}IѬVϹnn魄\CYE[YYWVWWYWZK(nJH[WVWVVTSSUVW1J`EIUVVVTQSPONKKK>&>կ̃>.=JJJKJJIHHFFDEE9*{ɼqTe|UƸ۾{y¿сˍׅ}Ŵ詝]Ίasƻ_eyڶpDf[pfpbtyJYUU#+&TTUJ,( e ;vxxvttvvxtvvvttttttrtwxyy}}}tswhdba`_]\\Z[[ZZ[Z[]]]]\]j``]````_`````a`aaaaabbbbbabdabbbbbbbde[;¶<޼wOQYaڙQ˦q'TjONYYYYYWWWYZ3qڎFOYZZWVWTTTTUW6FaFIUUVTTUQQOKMMK? Yd9.JJJKKKIHHIGFFFFH(dϲãfNѤտt{ѻ㔰ϗ~⣝~_b¸{ɗɯnWxrfŠxwkqthn;g8]VWA= VTUV>Ov / m|wwvtvvvvvvwvvvvstrtwxy{{|}~qpmfdbb``\Y[[[[]Z\[\Z\Z\[_``__`_]`_``````aaamaadadabbaba`adbbebeg;yN~Ƹ_h靉WЍKѐhv`곅O NNWYZYWZYYWY7SOSZ[YZVVTUUTVV==bAEWVUVUTQQONNJM7g՞Y94IIIIHIIHGGGFFDDG'IӶɥfʬ$kڜmtʾɻy㹎\wwwSõ̯h{}}Ib[hw߾{lk{Y\UV* 1UUVY4'!b6t˓xwvvtwxvwwtwvvtssvtwwy{{y}}vstjfbb`]\[Z[[]]\Z[[\g\\]]]``_`_```````````````aa`addb`babbdebdg[;DԄmJ]qaZ]ӪxaxbIZZYWWZWYYZ>/`W\ZZ[[WWTTTUV<6tCJWUVTTTUQONNMN'vߞW62GIHHHIJIHFGFFFD1&hϾOj²>NȾۣ~n´㑿}ߌĶî㣮pJԯqùŰPxůGxʩvprl~vx~jxw_qCA`YT8Sq HSTV7`w >w pxvtvtvvttvtvvsttttvvxy|{}~~pĨg`faa``__\][[[[ZlZ[\[]]]\`]_`````````aa`aabbbaad`bbaab`abdbbde\<уDƸ[[MߜFmTÑSȺjJOZYWYYYVYWF(aIQZWVWZdUUUVUD7xECWVUUWUUQQMMMM-#ՃG3;IHHGHIJGGHGEDEF, 9ϔZdɳyƿ꺂y{sʨ{儩ɢmո\¦wİƳh|ƶ{v}}JbO_ddaggf_VG( 1UTVK7 (a 4ʐtxxwvvvvxvvsvtvvttttvv{|{|~wɹsrgebb`\_]\\[]\[Y\Z\]]\`\_]``````aa`````b`a`abaabaadaadaaddefeg<ʹDߺvw[ѢanSԩNb~֫pHލNIZZWYZYWVW[6lvNT[YVUWVYVUVVA2|FGIVUUUUUQSPOM?$/g<3JFGEHGIGGGGEHEG/өhV-d¸øזxxw¹ߓ{ŵ驵ʘڨPĺȠlwijƴ\ųº`lxqytÇvkrpyhy=Dd]W4Uy WVVU>lbCQb΍KSyߪ`J[[YYYWYWWZ?CڔWJ_[WVVWVUUTUC+xݍEHWWUUVUUTQQOON&,`87JIFFFGFGHFFFFFE' >ČGijbFŭ줍üwqŲʲӒꪏߊU`}`TbVf[bg[m'hb[D$ 2UVTI& +xr,1Ӓvywxtvvvvvtvvtttssrwvx{{|~}lsqgea`_]]]\[[[[YZ[[[[]]\]__]_```_`````a`aaaaaa`a`addabbddbeedg<̹MȘ}bߘsh{IϒalZꯍM㹰eGO[[YZZZZWZH4׬UO_\[WWWVTTUTI/mGFWWUVUUTUTQPON=N2?KHIFFEFFEGFGFE/#ϥHtex~Şߚɹxʓϫ~w麯ĵگSŒrň[İajԿ̴g~tplsp{rx$Qg`[4kJVVTW;x=9t t{lxwvtwtstvvvvtstststwx{|~}xїe|sjfdb`_]_\\[[Z\\[[]_]_\]]``____]````````aa``a``a`aba`abeaddfY=Ÿ7Ƴ`3O_xUƠ[ݳtTZPZYZ[YYZYYN&xKa_[WYYVVVTTH.HW>YUYVUUUUTQPOC$.T8CKIFGEFFGEFEFGF1 (οbƻ h۩ʻԓ}t≼|bչmsxºĝl󢐬ȹkѾŶżƁ{WɩSeFndZhfs4ld]G+y 9UUTJ7 2(6ߑvxwwvswtvwvvvssssvvtwx{|}~~jӸl}phbba]]]\][Y[[YZZZ[\]]]__]__```__`a``aa```a`baab``a``bdadde\4׼[kѓڼppq朁SЁPفaסּVƝFߵݬbG][[ZWYYWYK;]΍UY`\[ZWVTUUTU4COAYVUVVUTTTQPN?*;ݏH7>KIHGFFEEGGGFH9'ЌO{hWۯ}wɇv~ôbIJ|ĜդYƹY{Zô̶tżytylxmqrr!\hb]+ VVTV8 !/ɩa;РV\Nۥlr㯊8ĭqMN\Z[ZYZWYY?7ۢVMb`]YVVWVUTV<,_KKVVUVUTTTSQPP*AތE4AJIHGEDEEFGFFH8(ԲkSdĹƺ{yõЇx˴ʓ̩p[՗eњ][øl`о“`nSwVj[bfskKnfbK. JUTTC9Ah|C8txxwtvttttrsstvttstvvx}~~}kݲf|mfb`a`][[\YY\[Z[ZZ]\\\\__]_]_`__``````aa`aba_``ababbedbdeeY7׾rQлkŠI𥳐?jӉHȎIϦbdݔOD\[[[[YYZZN.߸`I__]ZYVVUUUTH#l=JVUUUUUUQSQQA'CވC3?MKHGDFEFFEFEG(O˒Aw,bżxsneg_[_ehejpphhxxx|~õ⼂|ߎȫ}]Ց|vhpʾɑ~w|s|gxsax.ekg`4 .T`UI,16T q{xvvtvvtssstttssrrtvx|~}|~kɄkrgeda`]]\[[YWYYZ[ZZZ[[\_\]]]]`_`__```a`_``a```````b`ebabeg\-Ƹ6ʦVÿHۢgplKx߫m[>ߨbSGZZZZ[YWWY/bnUS\\YWWVVVVUI*rIFYVUVUSQTSQPQ/?w=2MKKJHFFFCEEEEE$!οt`_jmb]bvʾm]bem~|ٓο堎|w|߃ɲİփ~fg_ʼ˵kޟ`lrQrQsbpqdłVQnkdKH} HUUVEVk>rm6=Ӂ~xwtstvttttssttsrrrww{|~}~mѨd|t[ed``]]][ZZZWYYYYZ[\Z\]_]]]_`_`]``__``````_a`````abddabfgY=Ȏ.׾wΦ3DތIѣTେH߼_xG[ZZZZYWY?2ߓWT][ZYVVUWVWH-AIMVUUTUTTTTTSE.4?3KKIJHFFDDCDEF9!ZgּȬk`jmĿоmddy}Јʚw|_dQɰS¨\Áp}|rhW{W|7vmed2 9UVUK/ F8M yꈄywvvrsttttsstssrrstvx|}}~~qxn\e``_][\[YZWYZYZ\Z\[Z\]]]]_]_`]``_`````__```a`a`aaba`dgfh8ʹCѶPƹfx{K{ɿU[KԦd~伸yf?[YZZYWWJ(Ժ`US_ZZYVVVVUU4DN=VVUUUUTTTTUQ28xqQ!Gr׸v}xwtstrttvtssrrsststxy}~}~r{՘e~lea``\\Z\YWYWYYY[Y[[\\[]\\__\____`````a```````bdb``babef\>˝,ѿ|ϯ1ОTى=ީdmVެкKZ;[Y[ZYVW.bj\d_][ZYTVYVVD(PDJUTTUUTTSSQT.2x43JJJJHHGEFCEDF.U֗1,њ󦩸įtm~įѬ~bbxpîЏѩˬڍ_ʬʝIvxj\ѮŦkqɊ}hx}heW|`yOkmjW9 ;UVUC3 H4T x䂄hxttsssssssssrssssvxx|}}~jۿmdmgbd`\[][[ZZWYZWWYZZ[\\]]_\__]````_````_```_a``bbbbbbbffY8׼[aϴJ?뮖3|[4ʠI|Qӻ`[;[[[YYVG1֑Pkb__[WWWWVUJ+qlEKVUUT`TUTSSQ7'ۇ>3KJJHHHHFFDECC/`Ƀ2 t٫Ѭhþijû{llxŶֿƸ}ߠڬ_lݒ_ewgĺκevysq][Zs{~YdtngAk2*VWUU/w?JfY;Etѳ~wvtvrttsssssqsrrttwy{|}~~wy۔_xnhdb`]_[[YYYYYYWWZZY[Z]]]]___]]__`_`a_```a``baaba`dbd`eg\8Ƹ/~ߵQۢ`d?j|Ḥ_qϺٟQU;[ZYYWK.֫V]g`_][VWUWUU.U}ECWWVTTUUTTTTC#މ=;=IIIIIGHEEECD+|g4?Ӧ]`ɹϳqh~yѓɣUюSt}Eƶŝmvѹʨɯ̪[Ըˌrqówtjkgjtmfx}ZxqkYH GVVUAC|T8M xrxwttsvtvrsssrssqtstx{{}~~~w޹hxrjdb``_\Y[Y[YYWYYYYYZ[[]\\_j__`_`__``_``````bdabb`bbbbed\6{=ߵOĞ2ƚ8[<שgt涐I߻JUA]Z[ZV8KlNjd_`]ZVUWWYD&KHVVUUVSUTSUT=}I#M8T nxxvttttvtvvwssstrssvw{~~rawqheda_]_]Z[YYZYWYYZZ[]\]][_]``_k`````````ad`bbb`bbddfgZ7Ś/K׮4՟Nt۰fnjwFWC`<[Z[Z2wݿYVVVTTVTUUTU1DO8=JHFHTHHHFFE8<Ͽ|D/.6 ԲݻÐFïyN¶Ӧnfƈ~QԸrt~|kɺ¤e̾[sź¢p|kw`srep~mverw~xq`; GVWVD2ȩ `AvF G~ywvstvstttstrrrrsttvy}||dpj|jea```][[ZZ[ZYWZZZZ[][]]]__\]_`_``_`a``_```abbeddbafhZ8ъ<9ɩ$ԞC}v`xPȍwmg9[\ð`[Ѧ|Ħ׺ƿΔKKʯx⊌j_~\tykg`~vrH|{ 6UVVV&Q FK9] ds|xttsswwsttsstsrssttx|~~mΑfsmhd``]_[[\Z[ZWZ[\ZY[[\\_]```_``````aaa``_`aabbadbdbfh[/պ6{{E찗1ѸZM֤KsʬF`9ZF,J>`da`]YVWV>IWUUVUUVTTUCr;;JGHGFHGHHGH;4ûdJ-FA#1оnFϳqy|xwnrnxϠhµќɣ}mtxUڊ]ԑ`x~̹]ɨƹĦmIJNqwk|qxVŃxbOyq`Ne]UVVU9ZӉ7(`AC Hnxvssvvvvtsrsrsrrrstx|~~ws֨`tphdd`_]\[ZZYVZ[[\[[[[\\\_]____``_`_``a`a``abdfbdfebef[=骼'=լ?٘q]ɻ{vF;ݞ]l;\=VCCvVa`[ZYVJ4GGWVUUUUUVUTI1yy;8JJITHGFHGGEG9°|A33A6 vƿ޺ӔOy®glytxӦgwFbskdŴblНx˭}ʾϞMAjnvQx]َwsr\veawpG ũ}#n|xvstsvttsrrrrsststxy~~ehtngdb`_`]_Z[]\ZZ[Z\[[[\_]______``````````bddddeseebfhTA𿬦'9ϲ>ޤf`ɻQ7AߙɸDkUWYV'= I`J- Pqxwssstssssrrrqrrsrt{}~g`phe`a___[[[\Y[ZZZ]]Y\\_]]___`__``_``a``aa`dddghgeehjM`ژa\ľr}(Ɯ2ndhm]đ˹U] UCVZtrba_Z[Y7ZQAWUVUUUUUVUJ(k9?JIGGHGEFGGG& m?1+A>D.3ˬüm_qp\bkʿƼslq{´|m}asʵ˻鲸yUZ>[{¯S]֢~ʻ̗hѓDFNnUƔpvZdE&y`UxIVUWT4`v'8_KPϻTfyvsssrsssrrsrrqrssvx}~tw_rkebbb`p\[[\\ZZYY\[[[[]_]_]]]`]`````aaa`abbdbdffedghGhŤ#4nT2ϼW=֤Q㳸֪DN8ѺS>WV_xda`_ZY;6jKJWUUUVUUUTU,N|?8KIHHFFFFFHH,ĿkF+C??A6v˵ţKļmbqªºūxpwmlPɹôɾѳ}|wѣv-T}|{D㾸$ݨWȵ8֤af˓`֓9ŝCکT>|KZUW`wb`_]ZM-DHWVVWVWUUVU97O6>IIGGGGGFEG-|J1CAAAA'=īԹňQƶ伸xtûqrĢwn_¸ϾѢ{tȵUh}xS~Q`n°ɳxĬ|¾٤YNȰں8`ĺ=wȐaĉn}tpsh mhdI1UTUV&I H`KKʔN`{vtssvsrrstrrrrrrrwy~hŢZnjfda`_][[ZY[[\ZYZZ\[[\_]_]]_````a`aab``abdebfegesg\3۩SpE/ۼ`hkrTƯɬC`޴UGWVKsq``_[YAAOCWWUVUUVVVVH&E2CMJHGSFGHFG<T׸H+1?A/CAC۴]xں}GȻdn¥w ²Ÿ˒xϖ̝ں`vxߠ.qv˩CA.&өϰĤIijnS`ƩsmƵjŏgհ|ϣOh{&vSv[S_b˶ղvʹ]qdra߿ӊvt{e< a–a]E'VTVV7hF .E;a Zpxwsssrqsrrsrsqrssvwy~mޗZpjgbal`]]YYZYYYY[ZZZZ[\\]`__`_]_``_```abaaaddeddgfVDٰKm+3Dk\wOƾfkIZVWG_b`_][H.d6YWVUUVVUVUD&ўI>?JIHGFFFFHG3O(4A>A>?An©̲ϐG⼳VZ¿6°ƺdsvtɦ|źēq}pƒxxfsMn|_srvx֖ѵrƵĬ{ƶAGЌ,!óû}OȤ_Wúaƺft̻Iѹw{xȂ.~_}lx]{βF}}efPlĿƿݸkľ׻n~Nqpˎfs[_qb h`r1 1=3+- &婴k]xvsssrrrrrrrqpprsvx{[vfljdaaO_][\YWYZWZWIZ[[[[]\]]__`__````````abedbedggV>ώ&ѿQ¬<ڥq_Hϙ9ßDޮy뾴bINZVV_|a`_\F3MEKZVWTVUUVV4Dmvl{wssrsrsrqrqpqsqqtvy{~lߘdqkfa``__[YZYUWYVZYW[[\[[]]\]\\__`_````_maaadbddfgVCϾKb¾!EۭJ}ND9[F[ZWJ`x`_]O&GJWWVUTUUUUHKAPKJHHFGFFD7\?44A>AA>?'թnbµğJr㈳жd}fxƶŻ‘Šdڨjlq#޿yZک]e֍gaEZWWWKld__]>AK>VVWUTVUUUV-mQ;PKIIHGHGFGFME!EA>A?>AC ݰWlβ`Yȶ2eƑx`ˆ٘y7m{xVv~l_y|||{qlݗPt}~|yxjlsyע[r[ŵEFVfxrpZ`Zf_qY ;VI_VbC ,QG?>AAėM~ڼ~Gq\}tο3Ķµ󗸴m4ĩ©?~~||~}{|nj[}~}xwxxxxp`|WdhA`óVk|[wvS;4vTdrb1,9]1.__As4 xt}wtsssrsrtrrrrqsrstx|~}fdnjeb`_`_[ZYWYVWYYWVWYWZZfZ]\\]`_`````_a`aaadbaegV?ٯFa¼#ϠOtlŒOČCګOjE[YWWW\s`\\6IGEGSVUTUVUUG&MCPNKIIGFFFE1Q39CCA>===2!x³ϻJpмԹPj˺²8lx잌}Zʮw|Dɸ|yQ{VkˌI}|{m{|mMThm}{xvxxvvwQj\~ED˻7Vʻ\à°_sw’p`}wmKʪ`TU ,27E]f]dA-'32 7WTTW-! S_S?| V{vsrrttrrsrrqrprrrw{}hx`jgba``\\ZYWYYVVVVVVWZZ\Z[[\]]]\_`]]```aa```a`beV?ü Ⱦ?̯l[歒 ڪ7ݤJߥOƨо,SsAWWWWYbp`];AWMUTUUUTUTUD!xQ>NNJIHFFGFF&4F7EDACA=?>2|֣˵NwógUɼyĐk; f_}vŹs̖tM߅*sk_Zf_f\Zxxxtsrvtvx`V[{NIMdѵm8šOϲsW,,'4||gG ZVTWCF[.9`_C, l{n~xtvrrssssrrqpqrqsvy{~g|]kgeb`___[ZZYZWYYVVWWW[\[[\[\\[]]``````__````abeV;߾`Q!ѤkKmrŒGȜ8Yļl7YYWWN}faO1d>JFTTTTSUUH&C;POMHHHHGF3*E/9FDC=?>?A H̭WwګQ~mƻūa`tMKϴЩ|Ŷ~Φ=Ӯ~3xpMfJ7mywsssstwwgKg~IM?Wdʂw`~xf`anߠ[Jb lˆfq ZUSUW#в`_JTq 1[xvssssstrsrsqqrqrsxy~l\bhg`a_\\[[ZYZWWYWYZYY[Y[\]\]\\]]_``_```aa`aaaaeWE̹S哩3$p]xE橺,11WWWW`d`DOCKUUTTTQSTT<3U>SOMKIHGHFG8 J47FCCAA>AA2ש¿Zn֎F'nvkmk1g`ȉ‘ߝѶ εxeEV,67k\lV|jۂHywrstvvwts]`kdV[ž¬g{Pa;h|D-S;MU`e Jgȍl`* ?WUTY-3 M``6 W{wvsssrssrsprqqrrsw{|bt`jgb`_``_[[Z[YWYZYYZZ[[[\]\]]_`__\```````bbbddfWEô Ű?ɦ1ﯙ#/P`e¤&㺼j2VUVJ`aT,kA!?\bnVл̴p_UTIO\]H\e\f{ʸ~nrg}xϸy˼f8h9>a?fkjHCWtwvtwwrtssAѩSwYZζ4P¬2ƜVWmknW1&-pwYtN*YUTVC<\=6__?s- Qgxtsttsrrsrrqpnqqrsx|~eךbmgeda]__[]YZY[WYZYYZY]\_]_``]__```_aba`aaddddgT7߮m*¾>ۚWڼhΐ>ğF_Wϵ|,WVUYtraGN>CTTTTQS`UVA&6ðxVE酪Ӻ][Zľps̭T(UԨgvq;kߩxp\Ţy쩅`VՙypTD_xwHӇMg]vxtaqqmp?A;A˹ӲHtkë!Q|PVKM;_\\ Ktn`$ DVUFW2N IPC! `{wsrrssrrrqqrqrrrtt{]mdkfb``_]][[ZYZZ[YZ[Y[\\\]]_]`_``_```bdbbbdedfhY<Ŵ ȩIԓﳝ+߳Jaln\ƫ9+-VYI`fFNIESQNKJHGHGFDZ33FEDEDAACCDnŰÉGکEиԬwv{NrdOHxsڸrUʿ]֨xѩ.1E4hq~{vYJxMyevxv[qqlpPgNEvĨ]̎épwmj\䩎v噖qbDeT /m{VG/ZWSVIP8 4A1Jl~xvtrrrrqrrqqrpqrtw{}`ߔ`kgda`_`[[\ZWZYYYWYY[\\\]_]]__``````addbddeeehY<Ƙ ¼qU?F`ߣGڦWPN뻵H+WVKaY-dDJUSUSQTTUC'VDFPOMMKHGFG*|8-GEEECCAAAA.̞DߣCũ۵ٹdNxW=9ZAUy˥x6]Ϛ{1Ȧ~x~mT\{N|}{xZ\YbxhqmpqrFќ+38ĸİSGO.fp fte`Tn_[Ȧ?ɶ9SUeaNY;;2`-fY{vvrsssrqqqpqqqpstx}n~a`hea`_\][\[YZYZW[Y[[[[]]]``__```a`_`bdddeffggUCߢdIڰѪ-1ˠj,˚;̟GԹ6W4&VVMphGEJHVUQQUTTTV-a=AQONMJIGHG; M2FEEEECAA?C, գ4ۓJʰߤ̢WP}T{eweeʲl־9{٢MZ<ĻDx|x|xbG?mxvwqsqqUNZ`ӞIų[s,t$]vKSs;.ln[s~9pvh= *63OVG՚S=JW|xsrqqsqrrppqqqrssx{~`f`jfb`_`_[ZY\ZYWZZYY[[[[]___``a`````bdbbeefhggW<ɟɿ`ߐ=3yNÉMȼx;p̬ڬ$/YYOh2fOKWSQQUSTUI-NCSONZKJHIHG8Q22DFFDCCAA?2aFևIӶяFW̶kC>qke񘑩nȴwkp~sw[n#PxS;exyv]GHg~~wewwqqnbEΔ#/ _Krnlۨm}N[rTb; hl̊V.+k8p4UU bsn~wsrsrqqrrrrppqqssv||`݁Tjea``q][ZZ[ZYZZWY[Z[Z[]]]_]__```a`bbddddeegfW< ž!Ж鬘;[Cdrtd>VƩY-ZZ_{P9NFWUUSSTTTV,aFHQPNMKIHIF1 G2EDEEDCCAA3$'_jû?ݹˎEf*j4gp~myp7HedfѫyZ~1Z`qvx{{gyxbG>{`vpppOaGgSésnģ#F[g-ffA{gݗ]`lUD* 4=lW-ZwfќmEYKNHT2 9Wytssrrrqqqqqppprvxy}hZlfdb_]]\ZZ[WWYYYYZZ\[Z[[\`]]`__````bbadadeegN<~_d֙y}>bIשg}G\¾#KZb7h|{|ejYaq?Vİye}&et*V_3`xajANS;yڍ`|{ЎF?p| FS`Cb,U{vsqpsrqrqqpqqprww}}sjaageb_]_\[ZZYVWYYYWZZZ[[[\]]]_]____`bada`deegTCʔEd˫b蝸+Y+ŜAˠOռ]Z}[-YMek4KHYWTTTUTSU,m7GTPPNKKJGH#aF/CCDDDDACF4 ˣ7݈Aѳ׵PYrmD\Hɿ}syΌß>Р~֗׵jAxwSq~}{}}yxvtvIਵ4sy{jsaOa>[DOM 8{!N߇fxK~}ij*Ftg]6/g_A=D.jT D]_At nmvrrrrqrqpqqrqqrstvy~~~]wbjgb`_]\[ZZZVWWUVWVYZW\\[[\]\`_]__``b``bbbeeS<œƮCێ Sk3NMEO޶.-K[pPTPKZYVVUSTVC!KFTQQOMKJHH2tE-ECCDDEEAE76ڲTȮԠGږw7ʭ.`KPň޳aykr_pѵbYSh_x~~{xxtsSa8UU{{|xxxybZ6vy _Z`~r hh ~h`\m]~y(ū~1(qa6EIHEGm4?_]K{, F_~xsrrrrrrqnqqqqpprwx|~`ۓW_gda`]\\[YYYdVVYWWVWY\]\[]][j_]\_``````abbeI;몰 ;ࢁ1O_rv]ոhnγ۩.$YOh;UEWUVUUTTST/sAATSONNKJGH12U7;EDCDCDDFC,#Tsٿ٠?żMxgd_kxf8xY'p}Qw~}{{{xsbG#p{xvew`G{-;Dv#-ò h ]q2kWQUdWa˩`˺F[38g\xn*MVUQI1V-_]PU, 4S~|tsrrrrqprpnqqqrrvx{~}~n`mjfb```[\ZZYWVUVVWYYZZZ[[]]\_]\\```_```babeSCֈ!ֶ/bfۓv,jڤSשaӻVsY(A`lQIFWWVTUTSTG'IFSQPPMMJII9 H-DCCDCEECE1 ߠ>³ڿٵ6ھyJlsYl{{s~ aa7s`W[~{yx|yvtsHk6AGxxt`qvxw]'a֑>9yU僢`pZ2weqt UqȊyWJVWTS.q`]_CF#brxsqrqrqpsrmqpqqsqx{~~~qٿd`jeb``_\YYZUUWWVWUYY[ZY\Y][[\]][]````_`aabeSDۘHpƨlx㢮,֏n˻t3˝FϠQ=TѸ/KbT_MHWVVSSSTT7]JASPPOJIKII 7T79DDDDDEEEFJ+߰<׻߳Kh!esh`\ZVfegx{gTxw8РrڥХ{=GhSѦN~}{{nyxyO_vvrp]r68P 2qxxтxxk*d[V|G9rHY PnS GVVSQ3`- S]`=T]~xsrpqrqqqqqpqrqpqvx}ax[kdd``_[\[YWYWYWWUVVeWYZZ\[]\[\]]_`````aabeMDş ӓ;8OWֹYF쾫Q*EgVPFVWVTTQTUA$D?SSPNNKKJI4mC1FCA?DEFFF#Kֿ2чw7_\C{= >Q}trqqrrqpqqppqpqqvx|~~gߗWleea`]][YYWYVWYUWVWYVY[[]\[][\__`````aabbdSD ӈ찃6Pqh貂aGPļ-'GVxsV[YVUVTQTT4STSQPNMMJJ?`<2DCA?CCCFHA#w[޹<6{}~ߍqq1}ayقJI\lnnqsx}I`WtbtltũgQKVVUUTQTU8EEHTSPNKNMKJFY1EDCDADFGF,I|F׾צ6ʼɿtfpѸQV3 +Ox߸ϥ`e}jDUfkmmrvx{h`n(x}}D}&bkjjhfh_q_b kxlG V lv \D aĪ8rtpkY-T- 7h|V-MJVUP8[7 K]O>m*EZ|vrrsqqppnqnpnqrsvx|~bldjea``_][ZZZ[YVWWVWWY[\[[\]]_]```_tdabbdddNIȘ ϊ ~=`MÑVIT'#.]GJWWTTQSQS&ZD=QQPMOMJJ3ZE.DA??A?EFH ~ߏ?1ޑ9«ĴѸwmY`]_TWNNVPMQ[W`~ɯm3=х qQݰw<ωr>teWE`bghxlmqa}dY\|s}{W#HnjjZhhm|rkbSY?xxq K;H{K}Gjs.9Y [ng#<e]n`7>YVTQA8ރ7\_D~J .8?SPQPONMJKOO7FACCADDDF,+-x?ರιnUWfwb[EVx״`x岿< |q̭7ה|Ƈ>7\_`gjhgVxter{yf;mkhjtZknvh? 'my{}pCC֭ЇxbOl|\\ Np-]VWTD4ѿ}]\KO ?gk~xsqqpspqpnnpqqpqtx{}}}~vs۲jlfea`_]h\ZZWWYVWZZ[[Z]]\\_`]_```bdeaefffgOFÞ ۪.CڑYvfڹdypVјUqx j~SMWVVTSTTS.spDGQPQOONKJN aG2CA?CCDDFI UqɭM~lK¯˾|gy9 vʖ “g`F H[蜳k۩_[ծTn(NJ\aqqShw\fCyxgeS =hNehgjlpfH';[xx|ss F xx `m jq4׶DMyhO ;hpU6QWUTF,x4 _\]6p8Ud~{vrrqsqrppnpppq}rx{{~~}bgVhdn``]_]ZYVUWWYYVY[][[[_`]]`a``abbbdbdffPA\Wɝ`~蓮k{{E~꥙ZѓqTkۭ PIJVWVSTQSF(;KQPPOONNKJOT-EDCA?CDDE$Cڥ3̼{PkG߾GT`⎘vEhg$8bךYxwP 韏kƜrE`$VY\_kOhwm/ylxtf7kgegfhhggm;81{{{{ ;rDS{ HxYT rkg[ J7'd`d SYUUQ;P$ Q\_9жT(>I}vqrpqqpnprppqnrsvy}}~~~~_~Zheb``_]\[YYWYWWZZ[[\[Z[]\]_`aaaadabbbbefVPʑů+у#\r퓢I|1ȸn~̢ ߹MMVVVTSSQT3GHFQNOOONKKMZG2FCCCACDD8Nż/lAũƵdCqxI7{xYC?>D=*>~MėÃZh`nyqG ﮄ*ʩ֬wMj,9TVUW`hx\Y`w|xtn7 Ise`na_`SmJ `{{yg}IDsխrVdrww_em!C8`K`** Qdw>(SZVVP?.U ;\];kQAV~wrrqrpppqqpqqprrvy|~}~lГVjgp`__`\[YVYZWYYWY[Z[[\\\\_]````aaadddbdMHè vU凓Q|ߣOڪ`x?mJZWWUTTTTTFASOPPMNOKK!=U'EDDDDACCG]ےJ¿2ѺtMſڹӠYWâɯwDΩP?DQQEZkw~s8y~xtmZA>Q4geQ]][Z\TnDbSU|}~~x 2-]xxeeS&x] Dj{Y7[VUSD!¨__]KQH Hrnd~xsrqsqnqnqpqprqrtx|}|}~j_lfda`]]]\YWWYVZWWYWYYZ\__\]_```_`a``badeOQŰ 'CNȃ|hZН[媾wNHJWVVUSQS>9ECQPPNNNOK?ZE3EDDDACCE3,_gж|DȰ٭ѥFSļ gsTl[FA>/<$.\~C\j׍-Z˨JMWVUUTSQQ$`EGSPONKNMN21ߨY8GEEE?CCEFjڢ_ڝ;ею=޲ZNĮynƾƴžtU><9<<;<=;<<<;<9>* 6x_~xs6OT6Px WYHVU,HHCvabdgj`COU\vnlgdW6 eebm]EGVWH8>8}}}f 7DȟTk]xHV.E][>ls!?as}xsqqppqppqqpqpprvy|~}}~_ˏ\gea``\[YWVWUWVVWUWYY[Z[\\]\]`___`aab`dfPIĞ x+rëmgK|h㲃m閻&IKYWVUUTQQ7DSGQQQONOMK7Y;9EDOAACEEe|f̩¸Ygީ,ںP[ lmCA7>2]6/4>>>;;9<9<==<;;<;;; 7E$?頗vwąן߸=/?Ŷ} jmyrkYv<<_dZ``adg? &q|}vlhhab/ Neba`\WZY\G s}~m >=;<<<>> $H`KH'(-AAA3E>;>==><===>>=?;;==< 3347' }W eMxk۩㲸U gj~ {άVTPQQVYZ[]U1drqmhffdd` VQ`\`tt`\`17}}e S`p~EbO Vʿ\ağ1ypQ4xDle]`l< `[VVS1q3 S]]4CKK~wsqsqqqqpqpqpppswxy||||~enahgb``][ZZVYTTUVWVdZWZ[[[[_\]]]_]_]``a`K[r4ŞxI􊗂W}SVĢx}ڍڣMd8ˢSMZZWTUQSP.YrHHTQQOQNNN.=Әh/HFCEEACA.1˫λxSö˰fdݐ+2g =a{ ,D3CACAA1=?=>=<<<>>>>=>?<=><<=? '/1/478 ԓ gN\ /f_}ej\ OCMFNOSVYZVZ]GN!Mnkjfgbba`D2 D8_``_bqe``2v #bm .? JyxѥfPQehf[ p Jhyxe[UTQ4A,M\_7xb.AYs~xsrqrqrnpnmpqpqqvxy||{{|`ʐejje`_][[ZUVTVUUUVZWY[[Z[\]\]]\]`___`abKKɓ-}9}ZjsvvWrZeޔ QNZWUUTTQQIFFSPPOONNCZC9GDDADCDEj;˳ٜ9k<ϴGa 1'*# $+(3?>==<=<=;<=>>! 2-/!4789 'ڹ( 䳌}ο }! W |C MKNQUVVWZPK$khsedabn``< N_k_bdednP*]YO?ySht Z [ZѓZ8 ΫM Ed_3I]USQE/l+?]_ENZ!My`~{sqqrrrpqqqppqqrtx|{|||~fΓ`kjd`]\]Z[VWWUUUVUVUdY[[\]\]\]__`]__``bOUà y-dQtPdƸJ▃gCdQ\YVUUUQQ>'ڲSDSQPPONOP4#ѯ].HFECDDAD1p1²\s¶Ӱ*]A \b .=TGC/! 2==<>> Гټ-k Z {FK} =NMPSQVSTY Nefddaad`_6 7]``ddddbe# Ě/} r Gy [g `9{_ 2``F=]VSQS!H&]]P?I S`V|{trqrprpnmnnqnqssxy{|{{}l٥g`hb`_\]ZkWYYUVUUVVVYZY[\h][\]__]__``baKM蘆 {n*V읝Zv'y|xSʐON[YUUVTSQ&baPISQPPNNNQ d`6FECDFCDDU/wŦխ+=DmƼyAe] &<>C ./.9[;;< h` TȺP  =g ]P IIKOQSPSU9'P\&Vnabba```M'9P]adadbbbf?v d{ E 6q}n+f` [S _MqKybWnd \Vdx2_ZTQ?$ɓ]]Q7I UMW|{vrrpqppqpnnnnprswy|{y|~jsոbafda`_[[[WWWWTUVWYVYYY[\\\]]`]`__``a`aOVխ }ׯ$},>Mڔ`ߩNrڨNOYYVUUUSQ&J>FSQSNOONP\7;FFFEDDC1*#AĬaf޹ֶ4¬}. PʾZ  #,-1;=;;' #} y ӂ aȶ( 6K1= Kx KVJJKKMPOT K````a`]_` P`bbadadgU*f;yj2HP kߍe{Ogb=by]\}??j JgygG&a\TSS2T/ Q]]9{ S?N~}xrqq|ppppnpnnqrsw{|{y{~eڼndhdea_][ZYZZUWVVWVWYYZ[[[[__`__``_``a`KV!̎D}I儓ITՔj䐬fȬH9 3émW]ZWVUUSQ?!߳Z>SQQPNONN-?߯h/HEEAEDDF#M1UѨߝ=ɮӓ7Ƶ(H  \ 3/#;>=>HF  s 䞏 6ڭ 'NdQ  $JHFFHIJNO+;.2`_````[Z`HK 6`ddeddfkk7 I}~?Ϫ ~ H ]\yЍZI~>d/ Abq!d]VQQ77 Q_`7F>>ap~ysqpqrqpqppmppprvy}|y{~Wэ`jffa_[[ZYYmVUVVWVVVYZ[\____]_]_`_`aabFVʅJgZe鲎awp`ya‘lw;yN#*,9nЖJV\YVUVTTS/]WU>QQPPOOKO#S=9GGECDDD9 D˨7ƴþ޺ƪ&϶_ ɶ¾ /26;=>/ $6 &̹d1ʖA' _Vb= 3O2v !A>4'C 6FEGFHJKNF > a`\\]_ZZ]a`e$aadfghjjpVh _e [ QQ} CQ Tr…A j˹ /\W* Q_VSTH/Y;]`C__~&F`}{trrrqqpqpnpnnqrv{|{{|~f̓hkffa_\[[[WWUUUVVWWWYY[[_\]]`_`]`__`aaM]Ó-֢Hg7wPy3x]71+! T1SQ\WYVUTSSHDEQQPNNPM;־֮`99EFCFCEE#8ْH!РFĴЮHlӴ$ѼQ Ì]Hf  =YĖs 27;<<2 /26 JȴMѢylWx+ $my| E; +C><<( + 'FEEDFJHKQ Mk[[]]WZ]_' Ueffjkhm|e2fWFrjl /=wnqZM sQx2&hrPUMhq/I_ZQSS!Z/]]JN2]TS}|vqrqrqqqmnnnppqrx|||}k~֤_mged`]]][YVWVUYVVWWYYZ[\]]]]]``__``abHa }#ӑ,f2s=/2,4*>ѯISZYUUUUT?'տQ>SPQOONMO.Mpb-FGEDDED7 W2aæ˻xÓ<ø޿9|õȢC ۣƜv?IGE'+*9,(99;+-2( Sݻw 468;r /,/68-  xvJ׃pP$ 3k3Ѿ ZPK E><;8;= r  DDECEHIKN9!3M!\Z\g\UY[[7E <;99<=+ ` 7DDDDDIKKT  FVWZWUVZf[ s~{fgefjkmrrZy _wjtŶ'xO“ O#`p_‡d[VZw=K[ >`rgP*`[SQS1H?Q\];a SAK}|xsqqrrqpnppnpqqswy}|~~fѾgrjfb``_[Z[YVYVWVZYZY[[[]]_]__]`````ddAwӟԓ$n6琢H©׶T# ʵO_lwsϚKY]ZWVUTUT6MQQQPPNNNCߑm3HHFEFFFEhnPѴȸlwGbë©n1 M믙T V ~+ 744674666666878879;8<<,! DbU  #./6769;+ ѝ|W >`ѳ#&a! }s] w 1=;;8889/ ECDEEHJNN!Y -TUWVTUWYZ Sgdefkmqnf4U]Qvwf|~} - F[ Sr1hY+h ;]k_ *a[TQS<''M]]>;AHZq}{srqrprppprqpqrswx|}}~`Ɋ_jfb``]]YYWVWWWYWYZ\[\]_]]`__```ababeHa{FvDf}\մ\{H <쑨_1FU][WVUUTUڳ7GPQOMOPNO,W`a7FFFFEEDGKIʨrqrΟ6¶gDîģn1 ɓӏ7 {vh* 2476N47637D968788;8;;<9;=? {¸ߙh! /78;;8 ڊ, ȹђ[] F]! QE s  <;8(789< Md 8DFFFHIMOD aw US`U`QUUWF/ Hfghjllmnr? /tsxhx#Er~p TA pk7W tʸ ##[gQO]TSSFP8=]]Dj`q.Mxtg}{trrrrqnqpppppqqvx|}}~efhgd`]]\Z[ZYUVWWYYZZZ[]]]_j__``aaadbfKtɄMsNNv_~Ĩ<шh438bV蒶mU`]YWUTTU98FDPPPNONNOYC9GGGFFFE$/ُ\ ѩ8nɶCöڑ&Ưr6 IڤëE 2 d;.$14869877747676889997=N<89= ٜkx 7 --1C898+ VŮو J~?{U Q_ QymHN 2A CO 1n“3qj><988<9 V ! DDFDFGJMN(H !SPQPPOQPT \egkmkjlm\F'Qwf| Udp axy|vKG]ET;ANZ JbTsDF]VTQS&`!_]SC+ YJS}|vqprqppqppnpqqsvx{||}l̦k_ed``[[[WVVVVVVWTVWY[[\\]]]_]k```abbCv {'ģT/`P]wxʚ?Y_[YWUVTTMDPPOPNONO,`aU3GGGHFFE2d?̺߰$dqӹ(óv1$y (#,-,/' w/ 4= -.7O99638688;9888F67798<8<-  2s 1228; 1Ϝ ,_ +[E .Z HA= ,.8 197E688<+ n 'EGFEGHIMA ~ TONMKONNQ49 Gffjlkklmm*=2fx}w (k 6q ah`pNjW*Y8`` A]O\6]VSPQ&me_]P<2 Z?H|wqqssrnpnppnqpstw{y{}}snénled``[[ZYWVUUTVUWYWY[ZZ][_]]_`_```bb? .Ây=H!;h˒g߃[7Td_[YVVVVIrQ?OPNNMPOO_H=IHFEEEE#I\ k٦`{…Y\dĭɊ-# ,M!2.,,,266#IQ>H313<<848977889898;;;88;<<> a #-19 qw 1/33  (m4ljN EGFFGFGIO 8ONMNMMNQU tfg6hhhjjlknmA _vym`-Ex'KSv Mh!\pS8pj 1[[K63_YQOQ4>#`\]DyFG_||yspqrrqpppnpnqprvxy{}}}aȭaea`]_\[YYWVSTTUVWWWYZ[[\][\_`_```ad?wưډmP-($ xnֶrnӃ ` UtU`[YWTTT8OWVDQPPPPPOA&]/HHFFGGFGd*̩ێP}{Ķڍ1ʵŲ4#G(/./.4779+ 6==8448;89E7;979988898;;9;;<=? $ 8( M >987788; 2K FEFFCCHJO/' -&OMNN=NPPU \hjllmlppsP Kv_ymZ|nqkS `Y j(Q&vڬO 4#Ze4#TZTNQ<7M\\HD7P}ar}ysqqqqrqmnnnnnpqvwyx{{}}gʬ`eb`]_[\WWWUUVTWVWWYZZY[\\[[\_```abVJyjvH/,~Ư<I{qƴgqŒ(]˄ѐ8H_\ZVUTT!NHQPPNQOPN=JmV4IFGGGFF1 `$1M$ ?C7/-,,.26999<24(?=>=;<989;;8799989<98;;9;99999<3 j $G, << ¹ } !6- j  -3C PSs 9HW2 2` 3C, | 2=687788  9HFFCFHWOA m ?MNMNPOPU3] Ngwmljwmlm.ZI7rbslx Q '_g bZ$se ں3 Jb1!VZPOQD'7#>]]MQH{$V_~g}{sqqqqrpppnpnpprvwyxyy|aɲ\fba`]][YWUTTVVTUVTYWWZ[\YZZ\[_`_`bd<׃ߚ`]љ|aPYp(ݾlƪr{dfYəPF_ZVVUUTTDSPQONNNAaA4IGGGFFGY_MZĬ&Zɯj Hx*.--+/37899<=><;<==;;99;9;9988886;8G9<;;9999<<>,!լ -, } /148# t 'C3>/=>>>=7 4&GGE& Zb8> F-* ;886E988 e GDCEGHKKO ?OPQOPQPSH6M8ehlljYfgj7tva[_ (} Gq fmxyv[N`}Mt&WZ~r I_4O!QYSQPQaW1]]P= ]S\|vrqprpnpnmpnmppswwxxy{~a_f`aa_\ZYYVVUTSTUUVVVWWZWZ[[[\\]_``b<}]yTU+H?2g}mYgMbA]YYWUUG$}S7QNNNNOOO֭d2IIGHEHGH V1ֺevȶȶaƗ}}>t\ֳK #43,+136997;<=>;8;<;<886;8977;99997;G99;;9;8989< Uщ1  C Z /18;< K 4?=<<=<tJwPŽSN[P6DIq A_Gt=E\TPQQ! _\Q> V7M{vrpqqqppplnlmmrstxwvx{|e`gdb`]\ZZWbUVTSTTUVVVWZYZ[\[Z[]\]_``;ީGJ*ACfxj~;b1?[YWVTU8AaTDPPNOONN;.}k1IIFFGHG-#_Ȯɴ̶8G3 6ڲI (4--,./489;===<=O||xsqqpqpnmmplmnprtwxwxx{nxb\fa_]][YYWTVUTUUTVVWWW[YY\Z[]]]\]_a?xگꤺ<<ߞ?{fZ}dr𓇄s ې#d=\ZWUTU+E>QQONOKNO$|NP<;9<<><<=;<99;788987;7968988889;;888<=m`(j  4,/2C998;/ n +=<><>???>& m ;6OC- $ '+ I 8646669< J 7EGGKKKJJ 3QPQPQQSQG 6abpeaa`df,}pqV{xxtYsyI{Aw{H[ bK jHjnC?Y e&YZkn|']TOPQ8I3 _]]=m QMW{|wrqrrpnnmmnmmnqssvvwxxylfp_ea`_\_[WWUUTUTVUWUVVZW[Z[Z[\]\]]]`9ϬhxEhkZȩmv ~mבݺ&ɑMKO]ZVUTUN?OQPQNNNO H2IHGHHGG;O8`߮93blxΔ;» ~ #2-,+,?77H<<<=H;<<><<;=<8969;8998888789;978888;79; |C$m#   +,247F89;  A><>>=?=>A xJ2 7CD> Wb}HE - kq -364648,*U=! *IHJKMMJJ 1OPPOOQOPT xm]]_``a_`_aG !yxYP|j /r wy ~ Z_ fVp `ڹ_[ We<7&]VPOOF. O\]D}79S}al|qqqqqqnnnmmmlqrtvxxwwxxhs]db`]__ZYWWTSVUVYbUWZZZ[Z]\\[]_]_``Eɔֻ\eK[mΉ~sklCJ]YWWSU`I==99;98879977998987649989K97; vϹPEbpar * ɾ -,/4899;; &=<>?AAA>?$ 1DAK9  } = (6476EH6 =HFJKIH2 [q PMNMNNPQT Q\Y[]_]]]>P dxww}]te( Px `8VOGPONMMMO46fU=IHGIHGI&V]U**λ˰̮;Q}˲ퟩY l 4.+.279;<===<==<<=>;<99;<9;7777677797986797867887/샳]6 #8 $ 4.,.247;98. Yj{ A>=<>==<>>9+F D>CI+ C1yf1 * E 966768<JIIIHGHVC<侮av¥ IJИx Yü '4.,+,179;<<;<;9==<<<><;;;89;88776769777777887486769 կϻ`x[! 33 ϑ 4/,12678<;# ϶ /====<>>=-ӯ 'C=K;! y <, K =787D'A d FEDFFFHF ,MJKOQQ_SG C][YWYY]_][ xd.ppqnNtp¸fy{ydW;J `fk[=wdJSIFx F]7.(HYSNPPV']]_9 ZHڶW{{trpqmnppmpmnpqrsvwxwxxxj\gaa__]]ZYVVVUVYYWYZ[[]]]]```````abE {4HUψп=~qYhv}ʇ,,b]YWUU-U9ONNNKKKN޼S;IIHIGHG=ّ`& Uڮ³|xŶ¸[ʸΥY< <߰ 4*-3D<;=<<<9<==<<=<89<=;;999F68699796786977786478 `W Ś  蘣 2..3A7><==?&, - DAAJ* (`7N $, 83664d twFADCFGF4 #<KKMOQQSSQ = \[WYYY\\Z$ +pkkl\O{p~ >{x}hH HP#~~aMŐjI\.T8Y /M;f6C[SOQS*Ѵt\[]1# ZHT{tqpqqpnmlnmnnqnsvvwwxxxlvZgab`]][YYWVVUWWWWWYZ[\__]]`]]]``adF ׾xVQwk޼ȑ`|Pqtqӓb-`\VWUU#_2POMKKKMCT-IJJHFHH.2md,|ۯՠ{˵ٝdd°v * -D368<<><=9<<9<=<;9<;=;=<7998E88;997866786666468œxnnݲHM -b '#.268;96! ? A=;>><=>?3 ߬{ *??U9 e + G 98334 2CACCFFFF ] CKMNOQSSS. >fZZY[Y\]/b pmk_qSv\ ,{ hd PJ Y!}Źsj8CIZ(*YUQE[SPOP2S_]\\/\ SDVxwsprpqppnmmmpqqsvtwwxwwfvh[bb_]\]YYUVVUVUVVYWY[]]]]_]_`__`ad<ƮghGlykӠwM;`rrWS1_ZVUTV'aZ3OMMKKKN81߾pd8JJGGFGHxQJ+گ\ƹ+T n lW/2//89<=<;<=<;<<;;;<<<<9<776677888;9876744766778 ůk+rn .!N ߏ[ ,//J79867 +==>==<<=?J! D?A> >$Q+* < #6744! _2NZ A>?CCDEE 4KKJMNSQS> 7[[VYY\\_N+8mllnU_W&{ Y { _g \a }`\д1wm`JUarg;]UQQQ>1* \[]EFI_x{xsqppqnnnnpmpmpqssrtvvwthkjed_`\ZZZUUUVVVVUVYVZ[[]``_`_]```b?ʭ`];j[|xpKakvp}._[WVU9EJSDMMKJKKM-]aP=JIHFIGJɿ[<.+96hvחgګx` > !>/-.28;<998;<99<99<9<;;=9;K99789;8988766347484468 㠴`gbr1. +  4///698766 [_O ?<;<=<=<>+ݩN />?J7 Ѧr r *9 a 7464տ! '???AAACE, #+MKIJMPPPQ F\Z\ZYY[\[\ pwr(fkkmmStjvjV}| 1x S8jW|6`f Z VaD-]UPPP<- Q[\IdnA.Wlbj{xrqpqqnnnpnppmnprtttstvbxkfd`_]WYZVVSTUUVUVVVY[[\\]]]`]`]`d<ѢZ3꼢v_|PHEtw΃ĿьFWN| /_[ZUT1dQANJKKJIJJF>KIJHGGI>l2(F۵ MqĪ|~!֣x *'.-/28878<99<<999;;;99;;<;;977797697D866326673437 쟐̦Y&;./-16( !78; 1 4-379632! ӣ$>,<=<=<<-a ACK9 ɵ /9 &T 84464*#]k >=???ADGH dy=KJIJNQOOѸ6 ZYZZVY[\[!eevkpZ`~ `Tx9 O߄NvOKH~ۿ]j F_. 1_UPOPG#'+C\[JK#x'_Vweyxspprppppmpnnnpqqtsssstvj{mfe`]_[ZWVVVVUVTUVUUWZ]\]]]]_\___VGѝd4꼢lbeۣd}ݰБsha3̄..][WWU,V4ONKJIIJMU=JHHJGHI-;߹Ya+wѫˮY{ſ߈ߣ1ϫĩ8 w$-+,36;;;;;<<>;<<=;;;99;;;8;88E68876&66642?3667447 өkps #,-/69799787< yt +#1.38D42( [IO 2=<=;==,=./t 3AM> H+ A8< ? /44677-( + C>>?=ACDF  WNM><;+;=<;<<;;98;8878897844623222342667(kr߿= /,-264774786** ѥ' 8!/147466? ><>;<><=6. ?C?*  C98 y 727279+' tsx 6A?==??DF H]OOPPQPP7 6WVY\ZY]`K- KadfklP`Z 2 6[ Q ytFTjkSNAWtx 7Z2 &VWONOSaG6\[M7 \EڤVyysqqqpppnpmpmppprsssqrsrf]ea`_]\l[YWUUTTUSUVVZZZ[]\\]]]\_`SJ&V;꼓j`AɩO`Js=f2\ZYWI$jZ2MMKIIHJ1D`T4KHHGHGJe,6!ŬŪ 1 ú d 1F89<;<;;<>?=;<;<=<<<<<;;;;;. $86C363324666466, yZ ,-/A6848784988 7127636(+!;U A<==<<;=2+7>J D>Q< _ +=7 2 9636477< 'D??=>=AC. ONOQQQQQT A'UbW[ZZ]]]9DAdafe\YUx`,{ O t xD [ qx>`H?Q /Y?7&VYQOPP'K&[]]=& WJʼWyytppqrpnmnlnnmnmqqrrrrpsgafa`_\\[YVVUUQUTTTUYYY[[\[]]]]\]`SG2۟`3h`2ɲJPH|q}иxJ;_ZWVD8QG?NNJIIJM*f]A>IHIFGFJȮn(-,Ӹ¹ƠޥfaȥѼ Ӭ 4-.6E9<<=9<<=>=<<<8;=<<<<;999>=;;<;?,> *AA< hn6 '>8- [ ,7644379 4 CA<<=AAC9 UsQPPQOT_QTN VUW[\ZYZ[O eb`dfwkJxkqfGl` 9d h\ rU pO6 xIC>#+JM9CKSQPQ2m_$][[CA PGOxyvnppqnplmlmnlmpqrqqqqrg}`jb`]_\YVYUTUTUUUUVYZYZ[[[\\]]]__U<6{߼Vd;ȟh_+ϲSPſ9xӊ}嫏„-1_[YW3WYDNMMJJJJJ۴h3IGGGGGJ3-ײjf!-GгFY󬁗 jYS (!/37<<;;<<;;;==;9<;>D463324333344766& /a&;; 677777789468679;=  8., AH34'n 4S />===<==*C+ (CCI$ ! E3>>9 y 876466<+ .S 3?=>A>NAD  GQSQQUQQT& IW[[\]WI\& feUaeh{Jswʴ `&2w h [ \y {a 2٥e 9`VHKG[WQOS7SJm][]=~y?YVxytpnpqmpnmlmllmnnqqpqrrrs|dgaa]_\ZYdVVVUUUUTWVV[[[]\\\]]__`U>޹=j*h7ȟeb ϨKĤHտ.w?Y3.jՙmDNZW/f1NMMKMIJ=#q1JHGGHHG&U߯NM-,jթY}ߦ/˸ Ѷ~ #167<>>?==<<=<><;;;;9<==;9;=<9> ﬥ 4433142434674476;, Yx +;8;<9988887D77997+ #4.4743Jʳ ->>><=;<&= G 4?A; /==<  9666799= K 6A>?CC =POQTTUQV24 FZZ_j]ZYY;W [hgeggvjm| Awdh8j P!N9DrF_[ OD V VKeHeC\YQNO4DM[]Dk9Vsdxwpnpmnpnlnljmmnpppqpprtt{rZa`__][ZWUVUVUVTVWWVYZ[[]_\]\__`S6F\;|6ѐga ѦAĢ=,qOUt׈gw{ΰJ$  a/ONNNIHH6&jg-JIIHHFI }a>2Ӿ p9 A׃ 1KE;>?>A=<>=<? 632222332242246799A &$ !-;;;<;;;787776676989,G]P 82.1A624'} * ?<<;<=<=6q -ACI'#F/ v ;ECCA>A>C b\ ,787789< >=>=>?AA(  PPSTFTYZJ #9h[\_]\Y[Q AVhfjhftOfb + `{ Q`GJaDa |ka HNJ t9\TPOQ<7 \Y\JW=A3Zldxxvpnppmnmmmnmmnmmprqqqqsrlw[b`_\][ZYUVTVVTUVWWZZZ\_\_]]]_``SAHI8|/l[аOɞC2wSQQ˦ݢn(mݢWPNNKKJK/;g`3IHIHGG;t,<& ĩxOs .9 ̫b+ 67=?=A=>=<<<9<=9<<8;<898;9;99? ̐~F' 344224632642476O;;=>6+.1-=;9G<>H98878768666648771 ʹ #7.4612, ϲt +=<92=D  (DA??A>A2  #866687; !A<=>?>>>8 EE!TTkWarmtf [Z_`]_]\[\_ >4xI4?hjjdOVU # xdN!bTT{8x ûNP >\? 4_UPNPD$ O[[FM k#W`hkxpnpppmnmpmmnmnnrrsrrq~rgvhd``]]ZYZVVUUVUUWZYZ\\]]]`_`_``aT;DQ2n+ƈdY٦O̒EpsMCCs󓈐ΗH '29?MM,[k=4IIIGFH9m346'ʫ!y8Ư ]xï| =<>><=<<<<<;<<8<;;;9<9<;=<;/ (421346A26633636898<=<=>>?<=9;9;=;;8776646466668F+ fv .4.1J31D3E >?<;;*7(.  -AQM2 8M& 'CA??>>=?#< 776767;( -G A>=>==??6 I[kh`STSQT!ƹ_a``]\]]]$>===<;;<9;<;;9989<<<<9<8;8;96D644344766899< e <473(`( H D-;989;<=N ?A=63P6 x C?=====>+ = +87677;+ V 4=>>==?>E IOJI=<=<;8999=H<;;998;<<994Z 98644233222436647679;<<<><;<<;G9977768777666876779= f A7!2K2(C } ><<9;<<=3 =FC?>8QC /=<==<<=. n .977789> ,A=>>>?2F&H 78GHFGHJ8$ F_`m`a_]\,` ~Gbex?# P|l 2} f wF v` {] #3A9KKN!mj9;!y׬V¨p qmq] (=8;79+91  /C?8-9C. ?><<<=>A &98668;= W (??><>DDF+ !HHGIKIKJQ &U]`nb_]f+&  =<<<9<> V EA8 2\- .< A?><><9>+ <889;7;# C==>>CG8O CUKIHKVHIJP FI?S[psa_g;!3/ɾ1depIIf 6~{||~tځ*<` b{ P{,J~Uq!ˮ qF*+'VCw+J[UNPQ-++[ZZ>E NJ`wwrnnnrqpmmmnnlmnnppqqqtrryyleb`]][[YUUUTUTUVVWWZZ[\\[]]]__`U>J/j$ޑTA ֟PmwHxOV# #m9_M[.`!bV|ïrw$ ٖv+=(Ѭ Ӫ Ŵ =f ׄ ߩv( (6$48;;8;8F98;999<9999*<>;<<;966274223243243434747887788698778787977767666764696799< U &>3 '+ =;;=8;<>. +; FDP-OA C 2><9<<<<4 6 ;8796;9- Y] C?>>AGGJe J 4HIIJIKKJ ! QO>Wna``N [\ Pdx~AjO *|{kl{{ `j Kx 8{C/Qb ` [UG2M]VPOQ/h`E*Z[YAw G[_wwsmpmpr|{{nlmnpqppnpprsrvldba_][ZYVWTTSUSTVWWWYZ[[[[]___`YH68h#ߞYGrڢGbՁNMY nA_ZZ1m9.-+/Ghо;ڐ; $#6Ъ~ ƶ} Êtt l' y D< 1 xjm E==;;;;>* 4 4CI74K g $?<;8;<<- x .787;78= 2A>ADFY[N =JHFHJHJM QMK8V]v`` !\WQevCvI2lw{|~ km78t22jH?P6_ 2vJ 'HHk8AK\UPOQ?NV&ZZ[GtY9O_trpnnpnmnnmlmmmqqrrqqqqs]`|{me``_[\fWUUTUTTSUTWYWYZZ[[\]\]__N>4=v ߓS<*vOa~IyAb k7_[Z.x?4NNP9!#('SѸ ӾOC ypӭ}-­­}_U»ĭOJ 9y9Ⱦ? 9K6;;89986898<9;99979;898;77674466243442667784467987666687669978467787666688899G;;< j $$>Im 1A???>>AC} &A?E1/Q#  >;<=;=<= .7767;8> &>CDHMgNHN 2KHHVIHJN*S =MNNOUsnb8 DyI`eeAg1J*ewx|{~e `th sb+E 8e$e Wd`y 9 TNVCF]VTPQ=; bYZWHq+2Zv_vspnpnmmmlmlkmmlmmpppr~}y`fal]\[YYWVUTTTSTUUVYWYYZ[\[\]]]V; ?s [C`ݮ?VyC!G ,KC UU 2<=<<<>AG G799889 O *?AH`WIGE1 ,IIJJHIKN= -KNPOE[rdPb 1hJ``bfaId*'?Vxxy|||~` Dlӏ69vCA Ja&x IM̮ _ GOF YH\USOPH, t Z[[GZ 83ergswtppnqmmmllkllkkmmlmpmpry\hba_\ZWYWUUUTSSTVVWWYZYZ[ZZ]]]_V4$>sM6YڦHTI/_ k7][Y&2>NNMJKJJpO&18Hf묶֖np#Ű3 ˮʲ< 4¸Г/64n TQGG7784798899;8698899E887784463623222447784677646676747868;76678838D6468697879<;>  aڿ‘pU SAADC>?E4 OJ 4AH2 6C ۣO EA?A??A>1  9768;99$  3EUVGFFD9 1HGHHJJJKP '2ONOOPQZpED E`_`nb_bd-տ Q_{{yxxy~P * 7sڤ 16 gU < ˹Ep6 TNA g8]VPPOG# YZZMY I4Wdgtwtnnpnmlmlklmkljklnnllpqdh{reb`_Z[ZWWWVTTTTUUUVYYYZZZ[[[\`_V4+GrڤD<տS޶HFA$-f p;]\Y*.9NNMJJJI&}C1772,,J~Μ9» ʶ ִѬ »kd? !9P776E7888779899976776D9776467344447H64674347464644767778897887676676776877;9<+9 `qj` 1DACC>AAE & 8D>J/2> { &D?>?A?=E ED 96799882 -9 7TTFDCCD7 bfY HGIGJKNNP NM PONPOPEY_! kwabs_abdF D|xyxxx}}M . Z y}N [E, $ GI7 <`VQOPF MZ[OV VTbkttqmmpmlmllkkkllklmpmmnnqrx{[fda_]][ZWWYVTTUUVVVYWZY[[\[\]_`M93 Wr ڸF/Բ14P9C,kr 7][Y*t13MNNJKJJsM7KJJKM<7 _Ј~k²vy wŪ~¬6 ߴl{Ŝj! & <8J666777887869;896976463667443423442644366686D66666667866887997747776668E897<<9A=??AD!E 1CCO6M-  A=;<;;=C Կ& ;87996;, x HIEACDDCF =JKHIMNK> hANNQNPQSY D,Yqd`_`aa`SG 8{xxxxexxy~GPhl U{ & t` }E[p [1 DY? ;`ZTOPF M[ZJC .bYxswvpnmnmmmlmllklllmnmnmnnnbx|{qkd``_[\YZYZVUTUVUVYWZYZ[Y[[\]\_S18 Zq ڹD-/-M8> ,nm } w1]YW&19MKMKIIJH,JIIIKK<&#.„ՙsgƲ}aԫU>* xp`~ W'36646796787798999;E6E877776662466233663246764744774766688687876644677477986;9;98< C U֭Ga!== DC??=989,=C $99889;> IECCFDDEE =MKIJMMJK xOPOOQQSTW xQ22`_[__``aU; 2xxyxxxwv{N<}_ d|  nw hhEq VP GKA 6TVQN\Q, JYZZO #bWxfwtplmmmlkmlkklllknlnnnnqpqxxga``]]\[ZWVUUUVVVYZ[ZZ[[[][[]`S4C Ŭ_p G+6'G;7(+ve y'\ZZ&/9NNMIIIIF+IHGIHJJ;(1ѩ}&Aɺ»v а嫁g~3G  76334C77877644478979777778877844676344664316473664798664747489888647677768E9;8;;;;=+ 1wWY?H C>?<<.,'( A<ED 3DECGQFDCk 7KIKMKKKN~ EN\PPPTVW W&\Z[_```dd gvwxyvtgy|eݭ |_ |w $ N Yv| Ekn =JE 8UWSNOQ# NYY\> 'bVxswtnmlnnmkmlkkkllllpqnnnpqrx{wdqd`__]gYWUWUUUVVVVWYZZ[[[[\]]`S69 шlp D2?D>8 Mm ~ '\[W &3OMMKMJI>3JKHJIJI`-8-î|Uv՜ ߿tė97$  64/2366487763647778788467677873664122346334263443864D477648797897777687897(8899<;<;1 H`/׎G '?1(?EFV`1n GC<;A/N 3?A>??MA$ ;999<<< N (ADFFCEED2 ,NNPNNNNO9J >OQPQUUSV t\\]]__`be arsvwxwtxxW 8qY d -q.9*Ip|A ũ (6qO ;WA.bYQNOP*8 CWYWE8S]xbwtpmlnnmlklllmlmmmqrmnqqssxywpnxd``_[[ZWVYUUUVWWYVWZZZ\[][]_`S2E hypE'E C;- G|$q &]WY!9=MNJKKIK>/IIJIKHKV$3>ڿ ~j{tٯ~~ ɭxG?`#. 32146668787764776648786676666464414433647774647D64766777677779677989847889989;<9<<=>&! lqP 1FHjjbg]? w 6CA;8/8'b 2NQA>=>?A 93 9;9<;;< DDDAEFAE8 #'PQ\ONNPQI +9POSQTUUT8t ]]__]_QdfQ Nnsvwwtsswg ;_wa b EQ[>e4 Y3b* 7VP73U[SNOQ/V DWYWGM6N\xftplmpmmlGVwklmlllstbnppqrvwqhba`]\YZWWWVVTVWWVVZ[[[[[\]]_`S2V Pvn O2Z J1(+3`m+_ZWD4MIJJJIIG/JIHJJIKb#*Mڰ1ȝ}sjנV +e9ď /d 2324746664473646466666'D36873762667444647876779E6877647764767786988878844;F88<;;;<<=3 IQڃ; YS,fYFC,!&'  'C==K3 D =<-;;;>D 9b ;7;=<<- 94EEDEEDDD6 .2!QQPPNQPQD +8TPNPSVVUD8 `__`]k`ab!Qmlptwvssvyf Vdp2]-K9{\!v[+q x&A7 .VP[1fZUSOQ3};WWVEpk>NgevplmmmllkgklkkllmvanpqqtvxwqlYba`][[VVUVS`VVVWY[ZZZ[\\]_`_`T-[ NvnJ8xq` I+/ /!][YI4MJIJJJHF*HJIIIJ<J,|水?۶3DŚU  NkZ~ޟGmښM /=163424264344676476678D6366672647444466847664476877777666686899;999787888987;;<<<<<<7A  =<<<<=>C } /;;YW[GnC;F[evvplmmllklmkjlkhmnwbpppnpswrlhfe`][[ZTTVTSUUWYWZY[\\[\]]_``d+f DtxC7qyf M,4}!+ ~!][ZM;NKKJJIHJ/I8HHIIKN$ Эï߫Nµæ s_nx̥{ I . ڦߞ\๘ !/1364H4412432367676266666836476766744477884643774886666646366E7F91!!.9769899;;;<<;=<== > >waO ? Qj]]OK7  E2/><C h +<=1 eИ b 7FGFCDGIG \PNOOQPPQU |=9#NNNTUTSYI G][_``ma`, 'Tlkmnrsvwv{I ]]wOh?kwC dxOT NFΥY 'TQw4QMVPNQ2x;WZYDlNGg}evpmmlmllmmmklklkmqdpnppsvxwsnkre_]Z[WUUTVTUWVWVYZY\]\\_]]`aT/߁ Dr~$rN;bb V&3y'3( ! ][Z{H1MKJJJJJ N/HHHIJHJ N$ɯó߶J߻à ĵyʬٻg6 -.- &tO̺ŤD 3/4374646443234224774443366664468767787'666364448878766636C767879 ;W* +6877;6;9<;=<=><-  D#8 $ &C1+;<997 Z6.?=<;4'  3>=<;=>C1 !>3 ̾ /HDCDDFHG QNNPOQSQUѿ I#P\QQQQTbZ 7[[\_aa_`E EMkllmpqrtxx? ]sj¦GpeWH b wv՝ 9U =T`fY6W\UPNP6e`2YVWKk ]Eeravtpmmlmmmmmlkllmklmqpnmmqrswtqkeda_[[[YVUSTUUVUVYWWY\[\\]]]_`N!ڔ Ms}1Y[CSh `#7> #]]Y MI4KKMIIIJ N*HHIHGIJ N.ڴOѻĹƚä ϸƚ(eϾQ $,*, 'W! ѵq,6364477646364342436444632467466689=<9>?==;97876797899877484644798 *879988;;<<=>< yU>><9C.x 6>==>F  .  2DGFGFHH DPQOOSQSQ( O/QPPNOTUVZ `vC[[]]```dJk KExljjjm}txx>9Frt ;kxTp[ a f ,p` I U`J$2N[USPQ4Q7(7VZZN_ p;e{rvvpmmlnmllxlkkmklmmnmmnnqpspkeb`][Z[WVUSTSUUTUYdYZZ[\\\]\\`T,֤ NamACDH1 +A?<684868FF(77377777688. a9887799;<;<<=<> b A8#!T&1 xbE 2A=>>>><G =.2=><8- C &><9<<<>6 # - q 9GGHFGG*; &>POOOQQTU4h a!ENNNQTSSW 2 D\\\[]`baMD _Jkjjkknsrxx9m M{ A`vj d as /|E W T\Q >Q[WSPQAP1.VYWJQ }>Vprtqmmmmmmmkkmlllkllmlmmnpqttnjbb`]\ZVYUSTUQSTVUUVWZYY[]\]]_`T/յ HdwDCdFDgs!jD#N {P !P][!3n4JMKKII;_[&9GFHGII 2s-_ٺõ Ĺº~{Øsٸ Ϡj /8.'*.38 &nbrQ$D6<8886879343224#34464443633244448;KSVSEfw4+><87899869E678898787<2 ў,8888;;9=9=<=><# 28/2_&1#D j CA==<=>9 W,?=>F2  ?>;><;9C ` J 8 IHTHFI> !7QOQSTTQQ17 w.EONaQQSVZ (;Z[\[]```d. vGllkknnqsxN~ E~ H`n ;|k *WY[ 1g.ŝ V S\H =I\VQPS=P 4+WWYITώQmH xD8s&x+NS,a! bΠ`3_[Y!Ik>KKIJKIJ >q/HHHIJJH >>8676E989988897;;;'!ũƔV4+9;8>=C  $;!Z&4[ 2>=;;<=<( x>>>=<>=<;'  D =?? <1F446G =<==<=;/  l9-=>=<9<;;. (E,(-367;89;8;99;<;<;;9;76744666424434A347744436Aw6??+/++Fhq<\]aSAAJ988889679769977;/ ϩ/98<79 ~ | <2>G2(M $>><9<=<= x_.===91 <7 ?;;9<;H< gK1 +OOQPSQTV6r _EM[[\`]`bbDInqqqqqqrvvV ;j 7` `gbgx&I7h t x SZG _[[VQNPbb+>47phx`>1/G24E2>?98678869787EE78;qɪ <;<8<97668;;<<<89=<<> D J Ÿ  /KMN M8TQSTUTSVW [sT=N?PSOQUWJT xW\\[`_`adbsONppnppqswttJ K\ 8f PVyg|2?A9I l PZG nWMVQOSFN J+VUVWT[xFWnttvqmmllmlljkkjlhjklkkjjkmnrrqlged`][ZYYUVTUTQTTUSVUVVWYZ[\\__N..GaFheڬDWFfԙ>wZESE 9 #G[W7SIn`TKIJKJIJvFv8GGHGIHH'P8Q? Ĭ``컸ù{ úgź̎b -++(,1488G;9<;79;99;8889F78966C4424647664_72664;I+.D.D*`j_D/3EGH4?=7886877E476668;/ $=;<9;;7679999;<=( >6-.O1 U <<<<>=3, Y2>987;9=&  2MN Z8PTUSSSTSU xFQ8QPQQQUUYQ?#vbNZ[_```bd( Hmpprrpvwvv` S}e;~_ _QT|pAY3>MS f+ S[M [ZVUQQUøf ˵k꼼H -,*(+2D9;<;9;;;9999;;;789888876464326436k96426>J;JMCG8aTN2ClHF< ><8778788468668<<,#S> #=><<<;;;998<998;9?  *3./F22* ,=<<<=>== Z E w9><4.+ W [2;;887;>(  f AN w2TSTTUUTUW O6QQQT`TSWK44r{bN[[[_``bb+ Npqrtsswxye e~ZC~f `N?}fjFP?Dj~e P? PZH gMUQCS6S f-TUVW?}6Pbl|ssqllmmlllkkjjjkkjkkjklkpppqpljeb`_[Y[VVUTUUVTUUUUVVYYZ[[[]]_E,]/}\gh#>,89x >* '-rQ6KW(/y7?]ZE1[4ZVKJJIIJJ!M[$FHFHFGII/7Hlf[ 㺬Ŗ._ڴe µ}yϾӓ1wZ ,*((*,27;<=;==+999;89;999;9;88774264643464744348Q?;--E_V`UMIDH`I1 }N(<76686&7477768(9;?414A>><=<;;988888;899<< g 6,4614 &<<<<<=<<1 J h#8G92,* , e.(;8788<=/ * 8 4! w9STTTTUUWV ZASSTUTSUVM.JtfF\Z]_``ab2 Arrqvwvx{|e jU T|b#WE?yr`OI<;|Zy YO& PMd W\UQOS;S ~*UVVIH>YVjrpsqmlllkjlkjjlkjhklkjjjmnnqqnjkeaa`\[YVUUTSUlUTTUVWYY[[\[[\__O(s`jh-|A83Gx C$ ,/ڌ<*a8+7dE7ZY<#l4[`NKJIJJJ(6Z*{THFGHGIH4#Ime_ mծŘC|Tඹg م|sѼȺИ[1 +*'(*2899<<<<;G<;<;;8;8888889868667866876664239[K;#Y`]>,(3DC>JHF;99Y[<66478C4664487769>>>><>?=<<;9;<;G66F9;98< Ͼ 6,2623 /=<=<<;9>- b*P6;73/+ l>&8;768=>? UeC_ n ESQQTUVWTU QDUTTTVUTaA]=hP[]\`aabd; ?rprvxxvw{}nw l[/T{|}m [=`}PZH;D|'tƭ GMx+ P[` ZZUQOQ;H }6SVWWJ9eVk|rvwqlkkmlllljjkkhjlkkjljnnpppqlffa`\Z[YVUU`UUaUTUWWYYZZf[[]\]`O,ɜ Ink9SEG~,Qx H+\7!;x 4I8e;\ZM 7Za=MJMJJH/ l3ja<'aKFCCC16;>471*M}] ;97447433777668999<=<<=9<<=<99;4 GF&79D62+ -}_7789;<=- 4jJ 7 OFQTTUSTUV& eEWTSVVTTTH(j_]__aa`dfK Drqvxy{y|||~w}S9U}}r k9 dd]>AQ r Jax7 QZK!xfYQQOS>Cy7UVVWA,fTjstsmkklhmjkkkkhklkjlljjlmppqqkged`\Z[ZVUTTTSTTUUUUZY[YZ[[\\]`OŸ 3ljErNVG6GD񹹸n ôÜT;x뼻Ķ$  '(+&*,2E<9H<<99<;98;899879998979;;879677786743'M;=>F\DD?CA=.7A;9;==;;I;9<9G99766799N Q 6/,.?63Q j=;<;<<9> l{6 JSSTUUTTUV& sEVPSQ`VTQV kT_]adbbehH Astx{y{}|}l{\?xSy}|}g lx8 e`Q;NPv HddG OYO3ˌeYTPOQHG =UVWWI/hejrswslljllkjkkmmkjllkkkkkhmqqrqkhda_]][[VUSTTQSTSUVVWWY[[[\\]_`U*ѭ +nmS*KZW6Yh#]CUv!?eD#Y=T!2][Z2\mCKIJJKI6 |Cxn2FGFFGHJ P[ ϩ9P=󸺻Ťl ȴ—Jm𻼺ĺ4  '+(('-28<8<<<9<<8;9<8;76899889<9999796667D63476O'=?>=;&nCN? !J84733667476769989=<89=<<>9=<=;979847779# Z 41,-32$+ (/;;;;;<;A ]vm'$263G2* e|888;9>>? h8w2 ,TDPTTVTSUV*~ sHSPQQUVUWYwb```bdffjT Hxxy{|~mg$syY?e~|}g s9\q`6MQl!DlO; P[T;rg[VSN]EJ ބ3VTVVF{&kNk|tvrmkllkmkkljlkjllllkllkmqqqnkje```][YVTUTSPTSSTTVUYYZ\[ZZ]__K-պ 'qn[_]>8_e>dF?q/NYVekS HP2_[K`xDNJKJII? *dy3IFHGHG< Ah!ڭ4O(ɺ| Ⱥĉ>FYƢ>1 *('3,3E8>==;9=9899;8788999G;<;;99987677424764';*9TVC><<>>=;-'H'K& 876746367786367778<;;8;9;;=>=;;898978799& r 8/,1?1.-;<988;9> d]m#/626/, td*799D ssA`;>\bHQQTUUTUT4e rNUQQUTVZZY lba``efhjjQy Y{|}j(rx`?x`~}q tyj##}SmVKPw`f,'?xN< QZNHph[WSNQ>Gx>UTWVH/jFkrtvrmkjlllklkjjklklxlkjklmnprmkjda`_][WWUTTTQSSSTTVVWYZZZ[[]]_K,}p]n_2WmQdTyD(n9s6p,S-D YS '_ZY ]x9MMIIJI> b+GGFFTHH 2kڸSVϩׁk ̺Ļ;q/ũ]  ($'#&+/8<=9;;87(78;99- 2 4>,+/F2 !8-9<;8899. jF}1677I, P ;==>A?CF _E_7?df?QSUVTSUUCQ ITQTVUVY[\}WaabefhjkZl |||lx8qxhAxv|~}qJkTx.dbxTS`hf mf=g*;y;Sx P[MF]gMSQOSEOt>GVUVE{1|Ujrrvrljkkkkkllkkjkkjklkjjklnqqqmjdb``_[YWUTUUUTSQQTVVVWYZZ[[[__O*6!qkݙT p`A~+ڔNsQr$6GڶI mP +]ZW`t6MIJIJJ< #e&GFFHGFI #'Qکp[ ̹ȺZ8ߺɸÓ9~ ȼqd&(*'$'-/H9<=>9;<;;;<9887799;98;<9887887766677437[9;AC=*789;J<634&<.GUW93>*77466646D43666979<<<9<<><;=<<;<<;;9F8999/ Ma73,,-?6 F`G$;;99;9<< ;~M2C484< >?AA?CADD ~FTU3Fdg=UTVUTTVW;1q`USTVVVYY]|mYqefbfjhkZf [|kCUx~hY`y~g}/4v|_`{T_NVEaY}yQxFr/A1Q} P[V[IxZTQPQE?2NUVVW>{(}Mj|txvslkkmjjljjljkkkkkmkkjlnn|qpmhfba_`ZYYUTTTVQTQSTUVWWWWZ[]]_`P+=v*pl&ޞP3Y>I }\d/7[D xH $NZW# mfCMIJJJI< d&GGGGGGH14AyT ¿̼ΪPSӹĺ4 Kh!$6&$3(,49=;=<<8;=;=997867;89;;;G988789776447627W->TN<987;;>]*469<2#$.*9!66477763666668888<;98===<==<=<;998;8987;> [H8.--.16 DHA<;;9<;== 4g6E(D6/ 9#DCADACEF }DUf#IYj;USTSTVUTH3kaISTVWVW[`.*{wfhgebdtjhZbjqty{;Nx~YGa|~}q*#YKq6\QKJW\rx`vHW2;/Jh P[VVObWQQNS>F9FHWWW=;~Hhqtxqlllmlklkjkjhjljklkkkkmnqrplhdea`]\WVUTTUSSTUTTTYVYWWYY\\_`P,[[6qlAߥQ=K9 M{xY 1,e7 ɓK(S[Z* x]CJKJMIHKs-HFFFGGH#{j=;,kãWȫC\|޵¶ɚ; ȼî?y'(#'&+179=9<==;;;;<88889;<==;9<;8;;998686627436O;/YE>998;8<[<8>=<;;99996967. jG7/+*.36! 9>J 99><>==? 33=<9;;>CAKCDFFPFFEOCQ;867236447466688788;8G9<<;;<==;<;<<=;77;9= = 4/*,29 *mF6;I>??>A ' '>O!K6- 7vCCAAACCE {J`J3kJY 8STTTTTW$.UeDbWWWZZZN'lgehhgjlprt\'qx~G9yybNk{}~l 92ZYfCJY} Iw`H?9&=C PMTY=rKUQPQD<1?UWYWDp3Hjrvvvqklkkklkkkkjkkhkljkkkkmprpkhgd`_nZYVVUTUTUUTQUUWWVZYZZZZ]]M-Ο'jyVr}96v469SD϶K 28T'NN.A9E[Y?N(xJSMIJIKHJmvwCHHFFGGH..{GZ>GI+]ϬCŻĺƢ$+Ż[{ пλ##'($'&--6;99;<<;<9<<<;<8<<<=;<;99G9;876666442444H>>=K>?ACDECDAD??DC=96344664466877879<989<9;<=<<>=<<;H<88F9;< .71*,-3;? $6&'9I<>>?? 7 9J=A ;SSTQSJ8NhNVVYZZWY[$mSghjjlnmqx]'p{I `Sk~~w(YAZEjPKN NeZQCA&O6Q[Wa*sCQQPSDE/mIGTWZDq=?lrtxvqlxkljkkkxnljkjjjlljlknnsrnlkfb`][ZYUVSUSUTUUTTVUVW[[[[\_`]G7۰xPs =3>}IU\<.IIf9+g'S`UM[ZG.8{F`KJJJIKH*>-xnU?=>??AADCACAAA>ADM=;!A66673664489668;9G98<9<=<<>==;;<8989<;< ,+1,*.29_ +?.&6;= ;˞ <>ACA d(M[sM3l>M TUUUWFOvNWVUZZ[_`2#xZjhkmmnnvxU/PkW a\Oq!q8];bdKP?gg4GCD1Q]Un2HQSPSG;>qOHVVV=nGpGl|swrklmkllklmnklkjhjhjhjkmpqrplhfd``[ZWWUUWVTTUUVVVYYWZq[[[\]_M(߿ kKv >1HlQ[K4?JgN.2t ZJW=\YJ'MnDWNJJKJJI/-;paV8GGGGFG=&yj!GGGGH-&\3㳶ɣ ˶xt<۾л n -.*(*(,.C9<9<=;;;<;<<;=<,<<=;;9;7;978884864663478==-?YC?>===?A>>?AK>>>>>AA>8434646462789878988<9;;79;<=>>?<<9;99;78= , ,2*+-49( !6$997G<< qY =M?,G6- 6 AA<<==ACr+&lgGWp1P&JVTW!CPlAUVVWZ[``.n_hhnmnrrvx_/VhYa[J\m!>[WYYHDy Y`g;A<#N !P]_Y*rHSQPSDEGlJHWVWCpN`Hmrrwxsmkklkkmkklljjjkhjkljjlqrqpjhfb``]YYWUUWUSUWWUUWWVWZ\Z\_]_]G< K_j,Gj2Qt6\~7$Tn[=/Mv &xx.]ZKsY`[CJMIKKK=Vvf[4FGGGGH< YH(FGGGFG9,' ԮѴy ŸƺZ ںƻºƙNY 7 -**6',.67;;H<<;9==<=>==>A??A>=889>>AA>934474$644667697679;79989;?<=999;7;<= J *1+-/4;& 4G 6D467* drx CDC;;7.+ ګ< DAAA=<>Cp,1wqKfxE[*ITYF;l7UUWWYZh]81kVjknq}vvvx_64rT{a]Jtr[nyMSI]t?E}Y[k?KC] *Q]ba3sCSPNQG==P<<=/ &;&(9F7773772C63477;=<99;?J>>?A>=A>O<639>A?>8766464664678798799868;9=;>=J>><>;;<9<=<> ml ;2,*-49 ( ( A 77#2/' NxFYE>=6, ޢFکJJHHA=>Cp!S{l`m/\O 9CDAnAUTVW[YZ\6,SWhjmprwvwgU7SmI,OZE`Wɗ{KEag]E[k\Vx6WF h (QPp`-vCQPQSD?;KJEUUWCn[H4nsvxwrljkmkljjhjkjjkkhjkghklpqqpmhg`a][YbUUTPSUSSWUUTVYYZZ[Z\\\`H2>+rhxۄxMd!x=.s(QOڏa E 2`[Y.bANKKIJIJ Uxh,HGFGHIH1!HGGGGGGH6' *V̶Ĵ 4ϼȿζ+' #/++*14D997<<<;9<>=<===?Al'79667662646348;HO<977;>?=>??<;984436664776866789988=>===><I6. Q#QNO_ID1E dtwdbw,n(GIpA4;DFWUYFlQ72m}twxtmkkkkjhkjhjkhkjhhjjklmqqrnlhe`a]gWVUTSSSSQVVTTTWWZ[ZZ[\\]`E8tf$dhIבsk`4tO};~ tpfJ!s 1`[Y# F9NMJJMII ]Q3JIHHHHH!~ &#IGFEFFFG< xd ⶸζ ɻ̶C /,(&+3899<<==<<=<<><>>>+&#;8877447674C6677=>86&46Q>==<<98467;>?A>87873643763888776777;89>A>AA>>=??? m& p (4,-/7<D# 7J;633( j PNIE?7. ta,VSQSPNJM*tr\]p?~ H4q><>>Ar-,;77642672474686;S=77244F74821$679>??>=877627776646777688776;<>?>DAA>MAACj } /3.28; ry +IY,788$ `6QPIHA7. e~,VVVVV``T>{h[e`Z TCa=Ye[[_]``7*aNgjlpprtx{`||x2gTAMdpxN `` je`1Txy 8STxa'k4TSPeGI4'4IVYWJkFK7nstxrljlkjljhhghhhhjgjjkjknprqnkheb`_[YVVUfSSTSSUVVUWWYY[Z[\]``H=GTH 8TYpb EHd ÐSy4`]W/k CANKKMII!} /,JIIIGIJ,& #4HIHHEFGH { O£ ̹, ĸ̾ʙ ql 1/*,*,A79;<<<==>><=<><>? Ӿ\tH29776662676664668;H9734222/2.>289;=;7346336777736668897769A?9 ]9SQJIN7- D,UVUVVVVZ6}dIx̠\[~KVt>YYY\]```E!tPfhhkmqrt|m1On-j|vnA9b`#j|Q n` *nd(K|8 7UM{]`GPQP`WAF#!VVVYCkAQ'm~vvtljkjjkhhjjhgjjhhhhkjhmrrpmkgbb`]\ZWUUUSQQSTSVVUVWZ[[[Z]_]`F1 WNF# aQlDM˓NE?E ʬ2,;S]Y>K F4DNKNNKJ+H s 7IIHIHH6 (HHEFFEHJ A ,4laƴƻa Н ' 11,8,-6F9;;<<<==;;<<=><76467346364C438436798;;ACAD7 (3D ࢉۖt/ ē .<hFSIINI9U]M[N6. 6s4YWVUWZY[7`A|ɬ_j-x_{{AM*KyC7;3CH<8 ( 4a]YE' <====<;??(8874446676C62432678=H96!24.277;=>=;9664676446636666778;9;H>AC* *f7 7v( mέ >HdIMKKC/JA>VPKIC7.}8WUVUWW[[&`*ĸVj.rS3Z\\_[_``9Hffhjlmrvmm |}{#vkO'rVxFhƒ7/rC*t ù 4`\ZM 4MKJNMJA (IJJIGII ȸV &JGIGGGHH*G T-CJ<#3Ѩb+ ϼ r 42,-+-2M<<<;9<><><=>=;==1 +74473447466334444379O>Q9F7437;;9;=8872464347698647678769;;<># sh Ih~j]__ `KNNM.Nj+VUQJS?2 !#|7WWVVYZ[['(b!?+-P[\\`_`4$>geehmq}v{vkvlgW_$sNd,g̓49xC>s4`][YU 4OOKMKJK E ,JKIIHHI ($JIFHFFGH4# (;MM=9WȲȹ bƠžϾ>C #1/,.29P>>><==<<<<>=;(T88766442664426A$66369H=>?IHG;<<=M997626446788986677968767;=C𫪰  ~;xĤdO*  ?SS#ШHUPIGA3 6kH]``_`(Hgdghjmmsxy xt n`ONg_l,kr>Ul*`f Wx NWNU -FQPQS7U?4 WVVYDl8(ntwxqllkkjkjkkkjjhkkhjhhjlpqspnlgdd`][ZWUVTQSSTSSTUUUUWYY[\[]__F>q`( E߄! IY d|rO9 =b`ZYϘ*MOMKJKK Ԓ!JJIHIII(O {'7HHGEHFH; 1KJII; /,ȸĺ+ ˫m , ## 7[>?<>->=>><;=<;;;; gn2 ;8847744467664146444348;>>>=<<<;8874632462C679;77467886J86;=-yp  Կ7 &חs& VUOKGA4 ><`EUTUYW\]\-xڃ  4T_``3ڸ֟Mdddghfkqf| ϩ~}x nxSHIIhx&r8]g1g[fy PZPM 4>QPQQ=Y9! WUUVGq.pvwxqlkjkkjkhjhggkhjgjhhhmpsrqmmhdba_[ZWTUTTSSPQTQVUUUYWZ[Z[\`_I6ڥ9 ' S' vxӌ Neقs/b`[Y*-(ONMJMKJ/##JIJJJIH9& 7JGGGFFHJ t -NKKIGG.p|fɶ{| ˫ t M`6f EZ?=>>>>=;;9<89677<,(+488646322476736363264637899F886E87242447$46467897978787668; P$pk  WѢ89|ƚVUOJF?7 VfJCWWWYZ\]M2g p Ď9>aa.&ޜDbdeffggn` x xtIx F&#sr7x]Nxm _ P[MW DQPQS4V/ WVUV>t*+ptwywnkjklkjkhkjhhhhhjhjjjknqrpmkged`_\ZWUQTSQSSSSTTVVWWYZZZ[\]`I= #IMÞe[ DJ`_++da]W3_ rPOMMMJM$a l?IJIIHJ? #!,HHGFFHGJ . *>KKIIGG-1_bƲ ] yٲV2'3[C>?>;>>=9;<9;99749877676446644664446778C673446463463333332247C664668988876766888 [l -22 8ļIp *,NG=4rГ7DWVYYY\]>NJ [ | d6M!-Dfbddbdjm[ CJ /!x4\ T'\ 3P]SD GNPSS7b27 WWVYEs(+qtwxnlkjkjkkhhhghhjhjjjkjmmq|pmlhfa`_[ZYVVSTSQTT`TUUTYWVVZ[[]]_?= Zr{_CH>KEG [̨] +f`]WF2 9MKJMKM.- 1IJKHIHI $JIJGGGGH p I+OJKJFFE3 4Ȳ N9` Q/[HAA=<<9<9888<;6644777426424764666426778634442464262646242246664677876476796D467& UkI?ae #./269- ˉ EóžJ +JWVVYZ\`+*{ . n с` 7TbbaabfghP y vp ' h,\ FT Q_T> CPOQQ.V+G WUVYEr +qtxywmmkkhkjhjgghekhhhjjhhlnqppnljea_][VVYUTQSTSTUTVUVWYY[[[[[\`F= - ȹ1q$36GdQlT= ԣ !ga\YY 7MMMKIJ> 1KKJJJII 1'KJGHGGGG.8 &7JMJGHFG y  P; vW Sf/=<<97F;777;86674466664663422474668768664622763466344636446678477688899F669789 WvdC C #1!68' x $  `ߏV. $WVYZ[[__' \ ` w qEpH````bdegO |{w Z - lNŴU ڭ<>D 1E_pA# FPPQ]4n[ WVVY>q .svw`mjlkljjjjhjhhjhhhjhhl{qqppjgfd`]ZYVUUTTTSTTVUUUVYW[YZ[[]__GAAd NFۢH *-YմxM x (ga_WYJ(NNMNKJM M!JJKIJJJb 4IIHEEGHA 1NMIIHFF + b` ex9x& V`4;<787978887F;6767&6644 43464478474744326424366463634466474778767776989;7887G( yshPv mť 386O <H shʥSsyΪ!JWY\\_]J3 P{3ݾ A a`fh=`a`_abdd?n} I9 ζkְT Ɲ2Uޣ<' 6T`v'M QOOQP.p WWVYEq7rvxy`kljmkkhkghhghghghhhklqrqqmkhea`]YZVTTSSVTTUUWVWWWYZZ[\\]__A>w~ C e 8<, `jGF} qb_ZW#ƣ-*ONNKMMM ݦh (KJIKJJJ62 3JKHGGGG= \ 4NKJIHFFp n<ϊ|k6 73IaC;66997664769F68E78674774222447766&67446424662447322466668784678987;99<<8;8;Q]_a-v?h/ɭ 4Υ `- *# ɝlZ KOT Ghrbn_\Y;= 'CMONJJJ+F ;KJJIGII ©q/ KIJHGGIHr e6DMJJIFF< T ɐC fa?Z/W< I}84446646799888798873372347C33376667742644643444644776487888;99;;<=<==<;;9<<6ſZѝA2N  [. ;9*/U 1! 6(y` yI_4'Ȕ+M[$#2GV2~jjfplDnACSUɐ>  jp ù } NWEn SOSQO,r VVVYFr+?twwtmlkkkkjjkjjgfjhghjjhjlqpn{mjfbb`\WWVUTSQQTTUUVVYWYZ[[[]\]]_=>$ `fmDM ZTD ڢ! at`\WM( *NNMKKJ? (KKMJIUJ [#8IJHGHHK.8 $1NMMKHGH ګg ꠁɗ7{È> VbC'6336462666767688978&646624637668777633432667662466476779888;<99<;<=<<;89<=.!ԭתѩ?PY4  {ݎk 7.*r 'b&UN<6 JaւIɄkqԄ{qCDI }s7' T[fxU_KQthymv}bk ˯ PZO` QOPSQ1 WWYWFt4qFtvwrlmljhjjjgghgfhhhhhhh[mpqqpmjgba`[YWWTTQTQQSUUWYWYZZZZ\]]\\_=I< Y+C'K=Ypq4 `}`]YY,&2QPMNNKM ?*NKKJIHH3F $2KJHHHIJ=&+NNJKIFG} gY| mDg { !-{'6344344387D6877;9987736634267646886664464466664376467877888<;;<<<;<<87;9736686447676886787777264244244636D4344634444663373789797798;9;;;><<;98<<9=>1 }ѪƵIC<  | 61# + /7 U!$VPٞ~{Q{VnmJ K}7w`dZtV.||QJs j CPZTg QPTQQ/ w$VWYYCOVOsvxqkkklkkjgghgggggghhhkjmqpmlkeba_[WWUSQQQQSSTTUVVdZZZ[\[\\__8Ey#p 2JHSfr Hwb`[W&hDNONKMN p8KMJIJJ=ڜ+#>JGGGHKK T-ANOMKJF9 _ {` |G 1 $/6OK766784364766488777734446232436636766C4C6776767787678899979;<;=9;=><;H;<<8<<;98;<=> eԹզhkx  = *.+.38; l!D4b7;`;-POMKIFG!T b _ObȦ7 -;4.--6H=763433424466676766D6333341324477666467677788378899;;;;99>?><;9;=;8;88;<<=>6.4j6IZ[_adM+l>]ʮ1y9w帐pn U| .`wJSshF~ݞNx?? CZVxw&bTQQPFA\ -6ZWYZJJ&]swxnkkjhhghfgfhfgffffghjhqrqqmgeb`]ZWUVTUSSSTTSUUVVWVWZ[[ZZ[\_4Y= 1Me?Imww> xAObt_[WW>=#NMKMMKN 9?KKIKII=-(,JHIHHGKM ߘx ,OPPMJHG7eb y` E3.,-49=7322377437777646674633A44444367776D64887367788676;89<9<>=>>=<;;;;<898789;9;;- \w  #/+,69* … tɗ+,]I*U;2- `9޿ɳ&Y[]``f$}`ӓ;AţvpCjCl߫ E&Z t{NHn<ƠߩTrAD CYM3]QOPS=DJACWYY\D8'rtwwmkjjjkgjefggffegeggggkpqrsplgga`]YYUUVTSTTTTSUVUWWYYZYYZZ\[],hT+ qS#n~8*Oõ_1PEF A?K`x`[YWٚ{NPPNMKMN1kCMJKJIHJ 䗘1KJJJFIIM],3NPOMIGI =[T\< 832., 9M873374624366676786376#64433378679868887766667766799<;=?# *9;;99779;9<<;9;;< [1 g,   (-++/C; >F ( ɟ{h1KC?>'. |((W[]`bSf咽j>VsyPU>_U*ȝ3?x S-OOPMIIG'! IɁ1 ֓NY2 44=-,2JF74366432698786663664467779;;<;;<9777776767899<;9<=<=2 ٓ/9;97887F99;;;<<;= wJ /,/38 9 74 \| 8ğwe$ 7$3/ pD/DZ]`d[ w[ H3 Ŧn` HW( t4IOmd][YK((NNMNMMA vCNMYMJHJ= [/KKJIJJJK ѼM2-DPNOKGH= x `U 42,.6K62264646477477864246777<;<<;<9;;;988887898;;;H<>9I<>3ש_*=;8997;8;97989;;9<14 ɜQ &2./24; x (6#* AMm  ̨Y[_`e=WJxpEN˴ъxKSq_`FT2p1hNԾp&_-xr,v-(UaW >TTTO,p WYYWNS?svwrjhjhgjhheefggffgggghklrqppmkeeb`ZdWVVTTQSTQSTVTUWYWWWZZZZZ\]'mD ðmjUFmdt f /C[`t_\YIxJ CNMKKKN/mANMKJIJM VN 4JKIHJJI!g 18QQOMHG; #1 ]G 321+-38944277646447678676878;>??A>=9;<9778664899<<=?=<>?P𫩲~>;=;<;89;;9988999<;<=9<=1, Dߤ 4//26, H '2 3 4 Kf =r 軃!YZ_ahr`ύKQErѤxޖ`Ka`ptdA?tvNrT,l*S9vf 1Yddx TSTTP-q YYYYKYOsvvpjhkkhhhhgghggffgghhhhlqrpnkjfea_[WVUTUTUQQQUSTUVUWWVWVYZ\\]]'sd xM(py/;/Jòl(y8x9 79[``\YY(3FNNMMKM,Z -NMMKIJMq 4+KHGHHJK; 1,PQQOJHI.6 |Η ڐI{ 31,+/4N7I64663448667677999=2 -CC?=<<8878989779=;=>=<=>ߥhe <<<<<9<;;899;;<;==;<9+=>-=A Vʾ{ !/7 3,42 ns '] bV>Y]af9Z]OU՜[kq\k{KSvPykN4bJFwWv ֢ ;[Zr TSSQQ${ YYWZGWg#vtwljgjhhhhfgggfgffhggggjmqqpmkhed`]ZWUUTTUSTSSUQUVUVWWWYW[Y][]\'t鉗 -J KA?䞶 7VWdVQE1\Q}a\YU4P !.NNKKKN876 NONKJKJ2#CKJHGJIKM 듏#+DPPQKGH= | tT m1 62.,//D87346336647467666+( 7ՃD F??=<;8<;997;M;<<>===>?_ <<9;;;;99;889==;=>==<<<<>;;? TG  a&1 / 3r`Cߨ$[\`d[vkdsF`넚 fG]vNt>\NJb`V]~ߌ D_Jf WTTTO/WWWZQ\.vtxlhjjjjhfghfegghfggghfknqppmlfed`[YVVTVTTQQPSUTUTUVUVYWZZZZ]_]'n`/` /{| Ёڔ HSP s.P\xd]YYH=PNNYJMN PONNKJJKK ퟇; NJIIJJJK t 89QQSNJFI~ Fsx wV 3//.38836D7C76777676;$ J ?>J>;9;;88<8;<;<=??>==,è==;<;8;=<<9;;<<;>><=<<;<<<=. sH8 H 63V .! p-{~Ԓ(]`bg;qC]|fUVɴEsqgD?Yl[(a[Nf\~dE‰ H_Mg2 WTTPN$3VYWZF]6vvxvmhjkhhhggfgfggfhfggghhmqpnmlhgb`_ZVUTUTSTQSTSTSUVUWYWWZZZ\\]]$tC 9 Ѧf Ym/ p .=Omd]YYWم QONNKKN 3MKKJJJJ //KJHIJKK=(;2UTSNJHH6 KO 9 '2/.,/6747746667977E8 Y <=A><<988;<;8>>>>;>=?AH2<=<=9;;9;;=<=<<<>?><;=9;<<< O̍ h64 ~Q r, vC$TdgaxTsbTxIUwlӏxx3W#dqx41heKYx }k HlGnQ UVUQN*kOj*VWZZIb=tvw~kgjjhhhjhggggffeghfggkmpqpjkggb`[YVVTSTUSSSPUUUVUVVYWWW[[\]\]$O wEqkO?K~Ih; /?[as][WW'! v1TQTQIHH= b 2 h M 21.,/2666648D688866 ݰhm} >?>=;9<;9<;<=>=>;>>A<3gf?=9<;<;;<=;<<><>;;=>=;=<;=>(  rߜQ7$Q!2 f]?PG 鯓W-E`/_렏Velffe֫ռn}?Жh`]ѳCrM\w pNH Ia\xg!VUSQ>3CP/WVZ[Ab?vww~_jhhgghghfffgffffhfgjknqnnlkjd``ZWWWTTTSQTSTSTTUVWVWWYWVf[]\[(xsD a6'ŠI>D}`ĨT'wxgGQC 2[]s_]YU9J &QNOKNK9C?AMZMKJJ= m6$=IKIHMMM S=8QTSKHHJ h{y y v 31,,/347764698476+ sj Qp} FA;<98;>J=;<<====>3 2<;=;<9<;9<<<<;<=<<;>;<=;<;< 6(( ӈ 6#v~  v K>=;<=>>>>=>-;=1??=<;9<;;;;;<;=<<;<<;>=<===<<= }+//! Mީ߳  A1!/ p $DE;;Hsdp?d릒nagUJrĴq}GgsSdT] CYx;Z]\Vp,?8WTQO1I !>WWZ[JxsUWtwpjjhggjgggfffffegghhfkkppnmljjd`][WYUSSQQSQQQUSUVVWWWWWZY[Z[[[*H \j W FaM d ;GNam_[WV f =ONNNMN-T =4NMNKKHJ1/ V'KKJIKNNQ S'.HUUPJHHJ  b [G;j 63/,-12386C.9;<ԵI-l ;WE=;=;<=<><<=<=>>==;<<=<9;=<<=><=UTPO/M FYYZ[P~nHftwvpjghhhhgggfffgfffgffegjq|nlkjge`][WUVTTSQPPQSTUUVWYYYYYWYZ[[[[ {> 婩4v\.[[·Kb; -9[am_ZWW+t 6ONMKKN<!;#MNMKKJK= l-NMJKKJNP 8;TUSMHGI*Q A A1-+/348 ( ӓh4`x- yS?;====?>=<;<<=<=<+;;;==9;9=<<<<9<< ` 6/-,/4< VjGWb1_Y/66>616 }/;ΔUpSgAkڪ|g~yn!qrV*~7w+~6/` !-aOp JTSSP(b MWYW[Ix1etwlhgjhhgfeeefgfgfffgfeflppnnljfd_\[WVUSTSQPQQPTUUWYWWWZZYYZYYYM(O f {yxfC`}{<[EYU=(\`w]ZWVA* ;ONNMMKNK;MMNMKKK b,3MNMJIKP8+9-US`OJHH=p 9 }| 3D,-.27 HNeյh{9f O?Q9;<==>====<<=><<<>><;;<>=<;;9<=?=<=<==;H<<<<99<;& &3-28= ~yۭ G#HEy]T&+7&3' O\*U,՜OvWa햍thѲf‡fx]vjg;׾\krCn ?eSt YUTQP*s YYWZOQx'vvwlhhghgfhedefeffdgfgfgjmpnnmlgdb`]WVUUQQTSQPQSSUUYVWYWYYY[[ZZ[M*쁰',3״ |M# Ths N_w`[YVVl QNKNKMN 2-ONNNMJJ,< H-MNKNKMOQY /AVVQKIIJ pf t ,~[ 3/+12 & q O ;-N9>===>><<<=<9<;<<==<<9;<<<==<;==;=;<;<;9H;> J7 6//,-69 /Z 6 !P`3A\76 yWnads8>=rꞈ`q{`g|FYѲqmhUԺ8DfTr Hfxf WTSPN$t ZYZ[P` vvx}kggffffffggeefeefdfeejmnnmmjfeb`][WTTSPQSPOQSUTVUYYYWZYY[ZZZ[N$` >a ~Eߩ J[m*[ .7Owd]ZWU$$ 7ONNKMN9*G#PONKKJKA v((?KMJMMNP*l S3SWUOIJI1Z A h Z/ 7>- ֣ h Z*++7F7<9<>=<=;<<=9><<;;<;99<><><=<<=>9;;<<<==<<;;;==!w */-,39& f-  ~2aT+?=J8(9Cs_sOS䫂k̄NNmaъ]P|]|™Zlt7v` ;9HV} `\ld YUQNM'? YY[ZOUy tvvrhhfhgffeeeddfdderfegfknnplkjgra`]ZWUSTQSPQQSTTUUUVVWWYY[YYZZ\\,? T ߥbv6Zbw\Ԏ=2N.Omn_YYU97 7*PNMMJNN 쟂D'CONNKMMN G-MMMYMNQ?Q//IWUPJHJJN v ԍrh M 41 vџYh4N]($48<<;<=<=<<;<<<<<9;<;<<;<=>=<<<<;><=<<<<=' /-,26; q86( _*ϊIS'=(.s,6/wg`CjYxJrh]ghѾpUї k,?=UP` `ItxP WUTPO rGFaJ=hh(vwpgfgggffgfdfbdeeegeddfjppplkjffd_]ZVWTTQSQTQQTSTUVWWZWWZ[[[Z[\O'D m(]wj\\Q;ZƠTm'G`t`\YVGV PNNMMNN 18PPNMKJK.$K'OKKMKMPQ QCAWaQNGHK3-(4M p ` * j ݾOʯ[3pO/$4!28;=<><;<<<;;<;=<==;;<=>==<;<=>T=<<<<><==<>><<( 12,+/69 d3 --xJ G$3 ;7.ФYf];;VZxZr7=täx sѨI<6_thr dYjx 232N /N1/7H,vvwqghhhhgfefddddeddfefdgknmmlkhffa_\YVWVPQQSTSSTTTUWWWYWYYYYZ[Z[\-_pM7* ~M+sx ײglV APxa\WVU!E HNNKKMN>,E*CPQNKIJ< Z-,AMKKMNPQ1E I3WYUNIIJ? ߍ x m ?W Q & ߰nȰE>v]`6/38;;<<<<<<<<<<;;;;<;<<=<==;<=<<>=<=;=9<;9;;;;* e7.,-19' 21/#I]+#1g -CFU[>Vbm]reMᅬˇ]Zwꂸaxy {SM?8]mW .v8y;m!=?<- 옄Q><>;><<;;<==;<;;;=;;H;;' M67 +-28< =T &/. 764 mxx N-*~8kՙ`KMF_qxEG~$ϙn~Z]AbgQʦs9 r x_m-Jvv~lghhgfedfeeeegbddedfggmmnkjjgeb`]ZWUTSTTSPSTQSUVVUVWYYY[ZZYZZZ\&N |w,Gx[EYtrOJp_] Mmx][WVHJjPNKMJMN| =/QQNMKJK7Y7'?NNMNOQT# K4WbSKIJKO m ~mF`1 mZ~A .2 8rHPf 448;<9;9;<<<;;9;;<>=;==<>>>?>=<<9<9<<;9;;=<9<> >D 72,+-17< 1-,/1 1/4 J]+7 =dd q3CS|ajV~b\-Sëes3=pMy`MK n9 ֿ x{޴;[tPwsjgffgfeefededfdeebddfhlmnljhfea_\[WVTSQSQQQSQSSVUUVUWYZY[Z\[\_P&A( n+Mw}jN6Z}C rY $7`t`[YWV6>NNNKMN='K$PONMJMMK n?>ONMMQQT>V/9GdVNJJIK#jG~V | x= 6..# x˺Ц7[֩G 12;<8;;<898<9H;9;<;;==>?>=?A?>==<<;9;<99;9<;<= ,g (/-+->6<+ < 1/-../// t lH ' _a KtweMI\Il{WbPsS* ĺxƾȼk߭JfkeUEJ(p`_twqhhgffffdfeeeefedddbegjknmljgrb__[[WUSQQSPSQQSUUTUVWUWWYZZZ[\\\_&\xJ.* \7qb ɩvH+`| '<]s`[ZWV6] 7ONMKNNP٤tM 9PPNNKKK6? H$NNMOOQST#(JD9YbPJHHK?d [ ~ . 8ݼ\ԩ69<=<998<8;<<;;;<;99<9==?A??=?=<<=;<9=;=;;;<- $!#/,+.47& j] #2---.///2 W G} h( ٖdqSÏaZ}`UxbrVaTs=T# ', ը _׫xbNbUD7;sx 39IPIY7ewphfhfggfededfdeddddeegkmnlhkgea`_ZYU`SQQQQQQSTSTUTVUVWYY[Z[\[]]Q+}D 4E x+paQ_d|\ wJ(Ewa\YVVCJgPNMNNMO(e =7PONKKJMC q+>?<===<;<;9<;9<<2 &34/-,.39; њ(/-1212!$# 8 k{a ꠜ -l G9Dq\EMa.M£>¼¯pĩsQmW_QH?$_ ,?\Aɔ 49C<> nZY[[QI9svmZgggfggdfeddefddddddfjmmmkhhfb`][VUSQQPPPPSSTSSUTVWVYYY[Z[[[[]Q!W {~JIy~1Vr{M =d~_YYVV3 4OPNKMN8CEQQPNMKKN| K.PPNO\QSV =G[bPJIJJ8k N F8ઑ veTqx8 #9=>><;<;899;9<99=<;;<;N=<><>?=>=<<<h ; 33``\YVV4C C+OMKMNNO1r.=PONNNKM;`'#ANPNNPSV+a'T4[dTMHJMPώ t\w颜-tw   bՎrq 4<=<==<>=<<;<<<;;9<9=;<<99<=?//>?=97mC/>?=> A<6 =}.2 A.-.2698 [ -/14E87<>A f?# bYpMab aO 46Of斦tMf[ȫwfgVO-K}΂sWڙ.4Umew|(UTPN/\'>Y[[OZvaYsrgeefeefeedddddeeeebeejmmmkjhfb``\YVUUSPSPQQQQQTUUVVVVYYZYZ\[Z\]S!xr/ EG*ݰj\=>=>==J<<9<<;<=<9;<;<<= P C=& -(W6 #< 71--1489* V!//7898,>?( m$ `Pm`pDN/sM .8 ビ߹e[SseK߿kԒT`betQ>Ь?`ONOPSUVE$eHKeUNIJNO9k ;ʞ G֖V 4/.. 369 v 2J>?=>;><<==;<>=;;;99<><;;- r 1AF#. <8 ./17;;& _['!3F=>NNYUH 4 `Or4NlH #qd엖H`ꖥH`/g`D6mޑCIGI{keDTQON&h YZY[Oa-rt~mffggfeeededddddbddeeehkmmjgfwb`][VVUTTPSQPQTTTUTTVWWYYZ[ZZY[\Z]`'7[ l, 幗}g]O tN}N'HA J`\ZVUIpd FMKKNMN<+7#FSQNONKN&Q P*>OOQQTUV Ԛ ?fWOJJK[P{  պ !} 21/.2' 39=;>?<==<=<;;<<;;;<;==<<9; A ., *#//67;<1 YQ.# 8Q\IH<87+ GY t_\r1a>=<=<<<;<;;=<;=;99=<;9=2 GJ#_Y !//37;<>=;=<==<98<<<<9;;<9;9;;/ U =? $!2684 ݖJ sl` |ƙrth$Z[w?(J}`[ZWUTĩQy;NPNKMMEkEISQOOMOKE~-COPOSSVVC*w,M]ZQMJJOP9ݓ I. #qÄy  #/389;=;<<=;<;9;=<9<97;<;;97;> ,- 26I;K;8 q{/G<443--,,++- bG $=3Vkxx~.]wb Wשk&>֣pKWTQmUhpS~ݐ>}k`TPOZ1mDYZZ][&rt~mfdddfddbaaa`b`a`aaabdhkljjtfeb_][YUUUSQPQQTSQTTVUWWYYY[YZZZYY[Z\S 9ąFmP!| Oen]2TѢ& YY1 ,;}a[YYUU1Z J'PN[NJKP# D9TSQPNNJNe`/PPOSUVVV# F\VNIJNPOMW ё dbJ ?꣍h C 1/2438899<<<;<9<>;99;;<;999<<. }ۓ' 2489986' -& //-*'*,('- .,/abk{$x /1舓޵EFh߿aՍf\Hf2xf{Wڙxߤ7Ы.m/{jbS2TQ>K+t YYYZIV#qs}lfeddbddbbbab``a```bbdflmkkggd``][YVTTSSPPQQTSUUUVVWWWYZZYYZYYZ[[`'V* >?ZAvjW}˜[A;K #ZYE(.-,dn][WVUAs] FO[ONNN<,1<(VUQPPNPM=e!2CPOPSTVW9/|$P\YQMJJPPDƻ e8' ՚ * #223347669;;<;;<<<;9979;7+& _鶚ݜO *2788662# 13/1.,,*''++ ΅ *;s]|{Q v / ߌ}4bjp捶IPs `h6ݘ.Фmޓ=A?Qxkf$DTPMN-x YWZ[M`?tshffbdddddbaa`aa`a``bbdjkjjffda_]\ZVUSQQPSSQSTTSTTWUVWWWYZYZYYYZ]\P݁r {} JM HEG$! +* k ZY[ɼ=vE`[YWUV# =-NO>NONQ#|>]Y&Z[Z[!l;!ev_[VVVT'(6NNNNOPQйMY8AUTTSNPQNڅ$-ONQUVTTZ;nMnM\UNNN`_N44Ԛ ڊ јw 'A$ `mw1 ZpNJ<9+822 `,+62-+*'(+,$,#d|dTsxQ8 9> # -'ӒOۺee~\fQZ`x.޲jߩVhڒ4({wdpUNKMΎ NIqTlx=y([YYY# &D`[YVTS2? UNKNKOOP1[ U6VVTQPQNP4sFDDPQTVVVVH( pOYDNNQgOC#h K骝ΑV C? VÓ濲Ѕ1|ET+{-6  x((4 ,.++&!3<̢ɺ=dpvs]U dCP୾{ xsyxIMpp$|fnգsݘf9ˢ#{Q{vd~-TNNM,v IY[ZI`'rrgeeeeebda``a`a```aaaddgjjjhfea_][YWTTQNPQPQQQSTSUUUVVVVVUVWYVYZ[Z[S TI à>a 'j`Mbm\ (YYZZF= 3/y`\YVVTEfCONMMOPH6/FWVUSQPPO -DSUVWUY[OQQN,ynyt ۖ $4 Dhߵݩw+ 3 b*˵< mV  .- 7mfk_t m  1-݂IJVlq|!egJ˚Eٝtڙ8?C}xvb<8PNNN*~ YYY[Hk~DnsyZddbeedbaaa`a````aaaadhkkjjfda__\WVUSSPPQQQQQQTUUVVVVUUVVVVYWYZ[\[O-G4Q#`K9A,׃{gx{E$[YYYZ$ڨkQex\ZWUVT#r D*OMMNOOP-rZ2JWVTPOON4*M/VYYPW>\plfbbddaad`````_`````adfjljjhdbaa_ZWTTTPPQPPQQSSSTTWVVWWVVYYVWYWWZY[O$K _bx H1گd gam` (ZZZ[Z9K 47~`ZYVUS?yr!;NMKNNN<D?MYWWTSPQP_~G3FSTVWUWZD=b h[SNIMSQPnr ༖v ¬ |e M  .f߸vD ,?ˣm{p1~xvfp VPKM8Oa/WZZIf'nqkfebbbnab`````````a`adglljhfeba_]WVUTQQOOPOQQSQSUUUVVWWWUVYZYWYZYYZFsxD JQ 3T|{bJmߍm{2Y$Z[ZWYJ(g9{b_ZWVTS! =,PMNNPNS6>g;ZYVTTQPP=[7TUWYUVZ_2PYPKK]eO3*|*ʾ~ sw~4 *48#* !,288, /==;88446 ? g - *36NSE+/󻪞xy_Ge{n ĺ]Ś]ө`/V[MV{E*ީb٩K`ڎ.b~xtZwQOMN2pCY[ZHg&ns{gedbpbaa`_```_]`_`_``ehlljhgfda_\YVUQPOQPNPPQPSUTTUWWWWVUVWWYYYZY[[O 3H[k|eFSpUbȃޓtβ[j'ZZZZZ[1 [p]YWTTT7,7UPNNMNPQK/V9YYY\=*Tڨj= < 6jdqvSvvw!ʿG [DglJj閑`rff~qڔb/Γ2x}|wtZ#QKKN&x KWZ]GhEprxZebdbbb```a``__`````afjklhtefb`]ZWUSQPUQQPQNQQQSUVUYYVWWVWVVYWWWZZ\O- N=v JK\br` ,[ZZ[[ZF=E3w][ZYUSQ 13.POPNPOT&{T;[YYUTPOP>٘n9QUWWWZ]`=х}]SWQMO`aQ(1 Ѫ; /䍊 ?;&('&&!4678;;;FF8777&333./ ,. 'Nk݉GOYGQ-,E媐ĨH  = ʐE}_{ׯ1Ww2 .> xjɣDsKwН`PeAdrK˒?˗tԔ8VOyvgf?8SNKM+WYYMVDQqrleedbdab`_`_`__]_````dfjjkjhfeb__ZVUQQPQNPOPQQSTWUVhVVVWVWWVYWZWYZ[O\TZY(>y~`kF䜵yʂh7ZY[ZYZZ&'hb\ZYVTQ/8/d?NNONOQ?-pFUO[ZWUTSQQ*Fm6FUYYWZ]`O/ù vMUN?TgU> w ƪgn dY A<<8$4!&43!&&&3#462#$ Ksl3 C+ 7ī֮h ' 3NM7D# e M/3UxCIP]f̮ʫ8̯O̖O U|xwdmIOOK9Cx'ZY[Hf-pr{jddbbb`a`___`]_]\_``abgjlghgfaa][ZWVSQDSPNOPQOSSUUWUWWVYWYWYWYYZYY[ZO=JqZ|xSmT EՇԃ 9.[ZZ[[ZZAI ANq]ZWVUQF=23NNNNNQT's{A>\ZZWTQQPC/TVYYZ[`bQF kZQNAajD+3ʢЪ, 񞤂µvl *E>=977(646743#2' &EnxxH IĶތ6 8լљG /M!,JN tedktr= FJߝO{GgݬygvhE S4̥yڑ r{wsVw QNMK1m66YWYCh2nrgdaab``_`\``____\[_``bjkhhheeb`][VUUSSQQQNNPQQQSTUVUVVUVWWWYYWWYWY[[I$ OD <JMMg N` [YZZZ[YM(ӣ[G#t_[WWUSQ19&`PPMNNPQH#xJaK]]ZUTSSS6*|JECVWWZ\`bg9tjSHMMTsZ7hyԯ}UT2NssT &22/+*-A4/;pn 2֓~~* 9qh`p wI M= \ԠN΁ ;+ тWJ6{ٓՔqĩN&h9ݩk۝HE֒v=}r{wrOsPKKN&x IWZZHtGp|mYdba```_]]`\__]`[_``bdglhffdba`_YUTQSQPNPNPOQSSTUTUUVWVWWWYYYWWWYYY[PD_wbm/(/r,]W(.2 / kxwsPw SOKM4]8=ZZ[Ek/nqneb`a````\]]]\\[]]]aabbf{ljheaa`_ZWUSTS_PQQPQQQQTSUUVWVWVYWVYYYWYWZY[[KF”vZәPvl[EJ D4AɎOk O-Z[ZZYYYFnP;j]ZWWTTP/I-rPONPOQTN,ʢTb_]YVUPQH¼;V[Z\ahjkY;˺J}Y?OTv\7Ȳ  p$ϖe`xׯ]IKhpxʓC#6WhVbmW[{P;;2KUZ[;CES w_ȻC8624 6emVqZSp詿>өqWEG'x`ߟCɸOˑ ll|xwtHj PMJN/xFZ[OPsJpqleaaa``_]\\]_\]]]_la`adgkjhgbaa_\ZVSTQPTPQPQPPPSSSVUVVWYWYWYZWYZZZYY[\K{n?t' bd{nsqad<ITy}PZYYYWYW1 G``\YWUTSGݟN=6OONOPTWAUUPZa][ZVTQQ/=v?K;WZ\agknmZN gFOEeqHVy'jy Ѣ ѪxdaW[WQQkbT`ACG`prn|sÈ{ٲw.2PQbgp+*4j4( ` 4/ #ז~=d|ߤ{J߈xsp[rb̏>ۏ8ɒgќQ߭*2k~xt`b28OMKP3 fZ[Hx2npxgba````_]]\]\][[_`a`adfjhjfdbd`][YTTSSNQOPPPSQQQTUUTUVYYWVWVYWWYWZZZZ]I7㝳UlџMmFMr!-ڔ|JkOZZYVVWZ*P`_[WVUSQD՜7P3NNNOPTWAIfZ`]b`]YVVSS6 t>Y\`gmpppdCʥGrIA;[{JfЬ ~.fr 1tk]YpŪƒ9$>U`Vx?`Yl`CNbxeO=19jxWd'bCHJx2l Ϋ6濸NƔpڜ q_|xvqD S>KN2n>4Y[[Dh=pqld``````_][[[[]]]``aaabgtkggeb``\[USSPPQQPNPQQQPUTSVUVVYWWWYYVWWYWYZ\Z\I|r 6m6 SSmPGxjjp} 67ZYYYUYYE3T[NT[ZVVTTP.>W*DOONQTV\CԢYYgd`[WbUTT$VwUJGZ]elqrqq\K|?ATxp6ľˍˏ ?xq ϓ QZԭմ] .VaUU9eCCvQM6JMJ3ԫ &߳(UlPgԩڃ{ݼ1Uh׫f\Sr(wگZ=伭Eɍp ]{xtmEpPNZN7{JYZMTMUphaaa````_\\[[][\]`aaaabfhgfedb`_\WVTPQQPO]QQQQPQSVUUTVWWVWWVWWYYZYWYY\\M!(8edq[(\ɰ .m̄sHjNZZWYWWW($fSPZWVTQPC-r.NOOOQUZSA$_hd_[YWTTH̨W6\]bkprrsr[a e>;--.Qx8/2`J (_  e>rԟGWW'Ѫxќlљrsxe{_f_ڦhNޭ-ʥ 3axvr_Qx$AONC-ZZ\Gv'npxf```````_\[\[]]_``````djhgfea``]YWTSQPOPOQONQQQQTUVTUUWVWYYUWZWZWZWZ[[\MFs MlIaʖ6ޗ>ˑpє[߭ lTjtnMy14NNOCHs+[[ZAy1pqle`b````_\_]\[___`````bftjhfed``]ZUSPQQQPNNNPPPSQQTUUVVWVWWWWYYYYYYVZ[Z]Ixv2([82`CyP [jpy&*['ZWZWVVVW#PdwP\YYVSQPE/x'NOPPTU\b=Ř&[gd`[YUTTS&hxgAH_fnsvtvxgQȟFD>Hf+FEe3|x޵ ɞC .`t|kMKHFGFEKNGA>;9763//Z8N\9/>4?F!d y fa Ip߫+ªw|tm+⑃ڤyjަp\N&{ ˣ<龴WȏhӖ< FvtqkA ENMN.r3?YY\OtvFp~ha``a```]\]\\]_]``````afhjffba`_ZVUQSTQOQQQNNOQQQSTTTVVVVVYWWZYYYWVZZZ\]?2fT`w.!]ЮT'vh-G&AYWYVWWVD3GyYT]YVUQPQ91e.}(OOPOTY[dQřp_jd`[YVVUT31-v?aksxvxxxx`w+KM+٨+ `sx?YީŦD &]T|K~l]<6MJHHDEFCCE[EV;6-+ ,J#kFVxh_pnڠhyד[ݩ4徼S rlYvtnPd|NNND7Y[[My~&mxja``````]`]]]_]__`___``dhhgeeba_]YUSQPSSQOONPPSSTSSTUUUVUVVVYWWWYYWYYZ[\[E(Sw=YJ}Sg-AGEds~81>ZUYWWUVF!jل\J[WUTTQP=xgJ6OOPQTW_YCʚ*Zea]\WVTTT&TN]Efpwxx{yyy[~Vq䃢 t(m꼔w {\IQPNIIIGEFFDDCC,O9 -2;A(2*Dr(]FCGG&Eq 9 VGa։TW m˝nIkN}KW=јnޓfQ2kȩ,̏4ȖrڒWޥ #Ojt|kD|/4PNP4Ua2[YNGpEpxgaa_```___]]]\_]]```_`bghgeeb``_\YTTSSQSNOQPQPOSUUTTUTVUUVWVWWWWUWWYYZ[\\E(j {Yb /māsf]$KWVWVVWV&~>F[ZUVTQPP$K'POOPQU\dPa`x`kd`[YWUUTI=Ymyyy{|{}\kwn?+w#wלVwsО֯M F9UTOPNJIHHFEDEDE>(<8 3;.(? 4 DbVTF4 &J FE|7~He}$IrGeݦW-T쇓p2 ˮH?ƏkpȎ GQvtngF F?OP'GZ\NnbITymd`_`_`_\]]_\]_]_``_```dggfeda`_]YVTQSPQQOPQQNOSQQTTTSUVWWVVVWYWYWYYYZYZZ\;*Mm$Y3P`ylT&nyl x#AZWWVVVVE$qʓOGZUUUSPQEJJ3ONQSVY`hIE\ha][WVUTUw(mnhd```]]`]_\_]]__]`a````fsgfdbba`]ZWTQSQPQPPNNOQPQSSUUVWVWVWVWVWUUZWYWYZY[\;1TU_\U 丵+PDbh},<\MWVVVWUU(pA<]ZWUUPPQ!d|x+ ;=]WI]pHC7/-; V &;_FIH ];DW( N; ߮IF ]Ο4MOOߴDAӑyqߥS4d}r՗YɌgߤD߲ E_kvqjGkf PPN=<(YZ[FyEne```_`_`]]]]______````aegfgdd`a]]YTPSQQQPOPPPSSQSSTUVTVVVYUYWYVWVYWWWWYY[[<2=` GsAdU|&kݒw v9>ZWVWUVVD ښn`?ZWUUTPQG6y-QPQSVZ_fH||t]Wa[[WVUTTF lYYw{{|}|}\]˶G4I}61.*!#8DYJƣhxуm֔UMxvmYI1NNQ$4?ZYMmfISmld`a`]]`]__\_`]__]__```dghffdb`_]]WSSSPPONOOOPQSQTUTUUVVVYWYWWYZUWYWVYWZZ\\<2sˌhPhC۵ 줯FpQ1_xs+6m'MVWWVVUW$QJ>KZWUTQOP1$sw?6PQSTW[`g;ȵjKd`[ZYWUUTCtSsy{|[ɰڹKK\nl lOą > HC,,<7.DZsyU6AA>8-,-3T4.6(_HF;7`DMS jIj}}||jy{OK}`냢(\_с=[p`Ԩ|sьMگ3߹- \jktpf[`NPOA9!YY[<|߸2mld`___]__]]\]\[]]____```bgeedba`]\YTQOPPNPQPPOPPQQSTTUUVVUVVWWVVVVUUVVWWZZ[[F6DUM\1w=vxgqAwtϙ=2}*ZVWVWWVY6?S;PYUTTQNQ>SP.PQQTUY]dE}ق|JM_\YYWaSUU+d?xh{~~la`ΒG_d+t~OP ޿Ȼߩ7 9ۚx 3KWWUUVVUTTSQOONKJHHHHFEFSFFFMZHF{f`YJEE>7/D4M4 -/&`SEJW}QJD UTY1apn~_`?H#nF~NO[ÚlջF֪w$tƬ;ڇ?ɍxטU Fq~NvpkeK19N\O-pQ6YZOZk\Pxja_```__]_]]\]\]]`]__]`affedb`a_[[YTSNPPOOQOPOPQTUTSTTVTUWVVWVWUUVUVUWWYWZ[\D3||֭f\Z8sV䵵 >x׿=&Cd=YVWVVWUW$ӠM2KWT`QPPS#p-9PPTUV[_W8/b#,, /9AFDI;s`O\ 7``;}|}|K'{?xƒ;kxQFS&јtMxv ʘN߹MŎQwъGhwOrlgdC TNPO'AZ[Gv{,lvd`]``__`_]\\\]\]\]]]_`_bdgfeb``_]ZUTTPPNPPOPPPSPSQUSSTVUUVVUUVUUTVVUVUWYYZZ\;A?UNvUWޣفrUhQ+9FՒ8JWWYWVVW=-tTFYUTQQPP>D(PQPQVW[`N>ID]]YZUTUSV?$fx{~hԩAjZהYVWWVWVW&w_p6MVWUSNPQ-2|hI3NPQTYW__8fxa]I]ZYVUUTVU8+̭6m}ndWjWߔ?`~PsOJ̑ն l ZƤe >KJVUUVVUUUVTSTQQTQPQOMKKIGHHGFFEEEEDCFW8YvdtYNWF<4/ '8?,, 7=CC?A;qr=C 3qv|~fs~q [37p}6m|ӜPapn\G=v+ߖ{`!eɐgʔMƄWڟJժEgsy\dnhfOlQ$PNN6_]7ZZPNxeEke`__]]_\]]\[]\[]\]]``_``eddb`b``]YVUSQQOPONPOQOPSSQSTSQSTTTTUUUTTVTUUUVWYW[[[6?`m q|rGe֦{<WVUSPNPSڑh$  *6-'&?.(*,368;J=>C$bG Zj~;&EnE&ZQmȴѮfkwrrpnkU==1ԶO}ь7jf&ӺjݤIŔ/ëDhrgSnfdeEQbOE2YZ\>1lg`\__\]][[[[\[\[\]\]___abfedab`__\YUTSPPONONOOPPNfQQSQSSQQTQTVTTVTUSTVVWWYYZ\\6Ek qeyxQ{WޫZ/k*ߜD.,kr?DWVWVUVUJ!̦N8YWUQQPPQ+I|y=6QQQSUWZ\81-+*,,(.28G<;A?A*=>, ]䤞qs2bmx8+{6™Iԭm~xvsslljkZK,nߒb\M2l|~{ɓYƊTө?ڬ K}dJbkgdMgbPQP7mf.ZZH_}eIve`]]_]][\]Z\\\Z\]_\]]`_aeedba``]][UUSQONNPPNNNOPNPPPQSSTSTTSUUVUUVSUUVVVWWWZ[\?EU?y]rJ nYմ|n˩*2dӁm+KWVVUUWU='~mTp|3?vH>9?.-**!EN;<>??AA?+SJ +OZrmp8kj69xQrl|wqssmmkvgVS3lѺD۟awע ȏFĩlΊ`wΜCtr`?njdb=*݇34{j;Kޔ={l ボ}|7Wm _\3WUUSTTTTQSSSSUTTUQSTTSSQSUSPPOONNKMMNNKMJGJIHIIIHF7wPNDry22mJ?;4-,.28>MT?<4kf_][]\ZZ[\Z\[ZZ\[[\]\[``dfbbba__[ZWSPPPPONNONKONNNNOPQQQTTTSUTTTWVVUTVVhWWYWY[]3JIgHVf hU~ޑ1k1-л+8A`.MWYVUTUUK$ĴT7YUTPPPQC+HyD4QQQTTTWY?'Ӛq9JZYTUUVVUW8&̃`~||}{yJ2㞙$rse( d 1HTUTTSSQQPQCQVTUTUTTSTTQTTSTQQ]NKNNNNMPNKNNMMGJGHHGH`NKFq;>wJF92!28FOMOFGD=>?7}+9mPG>78M>AAFGGGFC=<>?A>>1OvJ 3j]||}qlV$UqACȸ˼l\~κ¬aVxsspqnlljhV<ՓjЏ}ک⁓mנɅGŢqۉpe V~fq8\fea4>dNP+CYZ3&jr`_]]\[[\\Z\Z\[[\]]\h\\_bbbba``_\[VUTPNOOPMMNMNONNNOQOOQQTQSUTUUUUVUTVVWWVYVWY\]7Jf[FCFFFGFGHE><>?CA?'-K/ ]gpqbFwrfq`<M[3wra}Efdd`/FQNC9YY[?8tb]\\\[\[Z[ZZZ[ZZ[]][]`]`ddba``]]\ZUSPPPONNNNMMKOPONONONQSQQUUVUVVUVVUWWVWWWWW[]]8Ub' /Uѻ7x{Q2#ޖ&=*ӥ`.YYWUWTUUAڦV~9WUTPPQPP1OrO6QQQSUUVWE#NGWVVTTU,YшFtFOߠA  vˮ WVSTTTTTTTSTTSQQMQTUSSTST`UTSQQQSQPMNMKN[NPNOPNNKMMKNNHGHINM/3KNbFC*KCEGHGGEFGGFA>?A=A>!OK Kј`g1xtxh;(Cw.ưw|m~ywsrnnljlOJԪ*⍿ی}ےbNx{xќfщYIM jf~MYhea?sf#QON4tP6YZGvDYs`\Z]\[\[[[[Y[Z[Z[][[]\\seea```_[YWTSPNPONKNONMNNNNOMNQQPTSSUUUUWVWWWWVUWWYYZZZ[\8UNfFPmlA{~fOڗ?(Nޢl6EjVAPFwN-rqYH,yx\>PgEʯaVyxr~spn\j9pEq6Tєbݟ#ȂEţeԏ`x F}sh7\gd`1?POO#JZZ3x#lr_\\]\[[Z[Z[[ZY[Y\[[\\]_bbbaa__]\WUQQMNPNNNONMNNONNPNNOPQSSUVVWVVWVVWYWdYWY[ZZ[]]6V{3h~๠`7됗{S-&ƩM/ng,YVYWTVUVIіw,KVSPPSPN4Ů[,FSSQPTVVVF8Ƴ\9WUUJݜ=,E~=kQ1 Ӈ Љ !MUTSUQTTTTTTPSQOOQSSTSQPSPQPSUQQPSQPPNMONNNPOPNNKMOKMOMWGJJMjK6NmHA+NHGHHGHHJIIIHC?>A?J*'=; [9k&=}qm+C|4ډJɬgywssnxjaG׿AFݎs}ݹM(vh,ѻ\ޠUŊ9xj|g~Dee`N9POND?!YYGT}8ta]\\[\[Z[[Z[[ZYZ[][]\]\`bda```\\ZWTQONOONNNMNNNOPMMOPOQQQUUUVVVVVUVUYWWVWYZZYYZ\_-`?h-?W̟ސ'6~aVA$g?=F#ޟOl3YUVVWUTUA-]k8WUQOPPNP.D`\1QQQQTVUUY.\Vx3JW'VM?PDG;fJ?(Mv1l  f-WTTTSTSTQSQPSPQNNPSSQTSTQQSTSQPQPQPQQOPONONPOO[OOPNPPPNJJKNfV[INnJ?.AYJIIGHJJJJJJGA>>AA<'bMV T+|xwe4-pU$ƮSU|wvb}nx[D.Uy6txwtњ`yфPڮHG~ryKVea_8te+NOO-H4ZZ9x4_w_[[\[[ZZYZYZYZZ[Z[\[[[]adbaa`__[YTQPONMOMNONNNOQPMONQPQQSVVVUVUUTVVVWWVWYYYZ[Z\]]2krA=3𳚌T`ф`a#&Ԩξ$I9Ml݌/=USQPSPNDɏ>4QQSQSTWWZ-ms761n3[[[DMԄ\|wsUKI61х 9 G VTUTUTSTSQSQSQPMNSSQQTTQQQOQSQQSQPPSQQNONNPOPPOOPPNNQOPJFFKj[I6N\NA=1\JJHJJJKJIJMID>A?AP4sM .b2xbH'M{kDP}/Gxmr`tԸ26I&Ϩx*WWWUUVTUF˚,KTSCQQNP;ߜ2?SQTTUTVYF$鼇K߈9KYW[PEG֐bnOIE<2t| _r ATTSTUSTSSSSQPQMQSTQSSQQQQQQQSSSQPOQQQSQOQOPPOOOPOPOQS\NH3II6EF;NqE.>GJKJKKJKJKMMKID?A?P('wKJ /Nf21ȴԢD`߰ÿʗTh|yvWsnnOѓ_fKГjÖďMɄW[psxd>Tn`Y7yU.QOO&'?[[3h'je][[fZZZZWYZWZZYZY[[\Z]_aab```\[VWTSQOMONONNMOOPOPOQQQQSQQSTTUUTVVUUWVWWYY[\YYZZ[]_.aa >M_xArdәV (DZ/dm,IVTUUSUTU3KpI8TQOQQNNP'Snd2SSQTUUVW[D2ތߨ˼OF]]\]]_ag``ѥ{E~eZHJ4t s 7 TTQSUSSQQPQSQPOPSSTSTSQQQQSQQQQPSQP\PSQNPQNPPPQQNPPS_QSJH9b6CGJNeM>,FWNMNJKHKKKJMKIA?CAS'=fJ ZKmèY2xWw}|yxxtNqNbAQpFԘe|'֏!ēMtlρN9tee1e`ZZ*DNPA2MZODs;h`\ZZYYYYYVYYWZWWYZZZ[Z\_b`a`__][WWUPPNMMMONOOONOOPQQQPTTSQSSSTUSVVVVUWVVYYZ\YZYZZ\\(vbrJtp&mF&/ϓ{&YO'ˬW,WVUUTSUTI!߁2JSQPONPPS7>TUUTVWY[_?Jڇ|VI`a`abbdgkpxl~ӥwHt~~}xqUKUK'{ 7TUSQTQSSPQTSPNSQPQQSPQQQSSSQTQOPPOOPSQNOQQO]SQPSQTSF(9I2CGKNlMA=DJNMMMHEFKKKIKHDCC?P&`II~`3`tWCϳŸ>Owyyxxx`aӘYYe<_|۔_xOtsaEŠdՊ>œ>Sav{jvFa_ZCKQPO4qh([[8xAVd\ZZYZYZVYYWWWVWWYYZZ[Y\``a`__]YYVUQPPNNMMNOMPOPPPPQQQQQSQSQQQQSUUUWVUWYWWYZpY[Y[[\]/ E`vlShx>U KY8=ws?DVUUTUSTT;!ڴf,HPOPPPOQ<̳{.>TTUVVZ]_bGU˔-=`abeghjlpsx{jxxqrx{n|nOJH4/4 ?2STTTSTQSQSQQNNSQTQTTQTSSPQQTQQQQ]PPPQOOQPQQSQSQQE3+ `J_4J-JNmaF-C\NKKKFEFIMJKJFECAAK9D_K PgѴlfڳlJ~lxxkNpZedIE{Pe٩O=ӘڵVÐ?ď[ޞ`>vx_3W]ZW4>/POD*MY[6_2g`ZYYZZYZYWWWWWWUYYYZZ[Z_a`_``_[[WVTQPNNNONKMOOONOONQQQQPQPQSSTTTTUUUUWVWWWZ[YZ[ZZ[]\*yYx=qВ~f6[veC1Ȗx/ZK*ނ-DWUUTTTTT6?yv1TSPQONPQ13㹹f.IUVWWY_aej+\ѰYPKddfhlppvx{}whȐZqq}~kOHV+Qnx !hETQQSTQSSQQQMOTTSSQSTSSQTSPQPQQQOSPOOQQQTTQSTST2 - >\8kt;KUgHAC_NJKJHFHJNKJKHIGA>AN,pK9ksШ#vMʵŰUWj{gpʐVkddQGэsVpCy Ğ[ޠVxĂC\j}kd+`ZWY3;NP;K!KZQW\Kd[[ZYZYYYZWWVUVWWWYYYWYZ```]__][YbUQONONOMMNNNNPOPQPOQQPSSSQQSUTTSUVVUVWWWWWZWZWYY\\]/q Meefr+»d *NYFөh.UVVUUSTTVp£79PQOONPNQ(Q\x2VUYZ\`ek`Fij~㊠SNeglmrtxy|~vj̪StbKT?*m섖|'b ?TTUTSQTSQSPNQTQSPTTSTQQQSSQQQSQQPQPNPSPSQUE1 6YF * K=dN6KTnNC*HMJKWJJKJNNNMHJHDDAJ7#`KK Kh7ީĝEڢ7ϺưȻ=[m{K`bhdeQxK&=|O=J˼ŴĿɰUPåhJѶSakjjeZ8CNN4qx/ZZ=wHP`YYZZWWWVVTUWVVVWUWWYY[\_`_][[YUVVSPOMNKMMNNMNNMN[NOQSSQSQQTSQSSUTUVTVVWWWVVVYWWYYY[]]2ZE?k斓WCϣ}y ߜey2ݦ],ZYE,fp.VVUTETTTV3vY8QPQQQQOQ?'ům6H`fnyaxlƍ띍p[twx||}vlڮdafn}eMUH-Px;p 8TTQSTQPPQTUTTSPQPQQQNMNPSSPOSQTSQTST< F 7GJ}]4NTnKF2UKKKNMJKKKNOMIKJFDCQ+#FIO fjKɸɟJaqɻųӻAmɦThQnlhhgUCxns4wϑ>ʼnIाQE{w\Epy[TaYVVUTUUTTVTUgVWWWZYV[ZZ_`_]\ZZUTTSSONKKMMNMNNMNPPOPPPTSSQTQQSSTTSTTVTVVUWWWVVVYWY[Z[]]-I2dZ{sj߇8Vw vޞYt3ϙ_3VWM$*HUTTTSSSSC>ߒ2FPSSQSTSG.Z]}Hk\}H`le8Pψ`l{|}~qdӰ~xbkylMVV=#hyq* VUSQQSSUTTTSSSNMNMMMNMPNMNNNOO;! w  C 9IEDeHFHO}fKF7VNNKJMKMMJIKJKJJHECT (FJ;-yxª{ePȴťȸχ{Fʮ}vdNepmjkgqN=fn|A{mNϞ_hN—FKxwYg1UUUFpOON+}<=WW8h,f]VWVUVVVUUTUTWVWVVWYYVY\_]]\[YUUUTQPNKKNNMNMNMMKNOPQPSSSQQTQQTQSQQQTTUSQUVbYWVVVYVYW\\_.V$hH~ѺDt J]ʵ&YYYG*ֶj/VUUVTTPSGAFɵt$GQQQQQQTI+dd29ZOsjbT?Hڈap|}~b}Iq~vf\VIA,kttK 2TPThSSSSTQ_SPJ=NKNMNNJKNNKKMM, ' ۭ 8 9QKFDF6FFNakMH7KNMNMMMNKMIMKMKKUECV98CJS P2Y$¯Ɠ´üKh~tjlYqnxkhhfV8tѳCWϸGpNΤ4DœQۓOjxwtJ(EVUV'k(2OOC+KWOS>aYVUVUUUVTVUUTUVUVVWWYY[]j][\ZZTSUSPOMNMMONKMMKNNPNPQSOSQSSSTQSSSSQTSTVSSUUVWVUUWYWd[\\].fSUs_mbxMh{x fMFёO7WWY6C||I9TTUTTQSAVEdדt/QQQQSPTUE'mWxGvmd`Q6Hޔ]mr~jfШQnrVMUW=9f~hV ]TUVQSTUSQQNMN_MM[OMMKMKJM8?1?, ( a8? $SO/YFDC7JUyNGF8WKNNMNMJIJJJKMJIHDDT,C>`}\\˲ƳŸƲʍkAΝfwkrrnllkvhfd>Jrd|~\ߤb}Kxxtr`UJUVG3l j=Q[UUTUTSTTVSSTQTQUUU`UVYZg[YVWWUSQ_PPMNMMMKNNKK`NNMNQQOOSSTQSTQQQQTTQTQSSSTUVVVWVUWVYVYY[\+ ?tmĺhY~$ԹvC'EWWW6*re3VTUTSQSQVQ.w/KVV=6My7`{!1b~t_\\_bYE|ݿTtp~jsՙ]G1?IF&ϑhk & TTSSONMNNMMNJJNNMNNKMMPQZ7 ,AjP$S+ d QY8HGF`-IQsQGADUJJJJKJKLKJIJKKLKJGR

ZJ?m1`WVTVTUSSSUTTSSTTSUTTQVY[\ZWVUTSCQ]OKKKNMNJMKNMNNMNOQQQQQSTQQSQPQPQSPSQTUSSUUVWVUUWVVWYZY\#ZdZPpn߁ÝJ! v쁲n{m2YVVV.dk>CUUTTSSQS[F>n1KECwdл= If][Z[`dgVnԂdlp}~m_ʈS?#<8. ?SPONNKNNMNZNM[PPPOKNQSOk- h?C#/ g Oa6G6G2#IO`eJ+CHJJMJJJLSKLKKMMNNQKP")CK2*n/ȼ¤ι̪pK㫮eU_tapkjfhjkgZ3>hs×Y⳩Yێypdvtp`>IUTE&_>ON6Q KZ=y`IZUUTTSTSTPSTSPQUQTUTTTV[\ZVWUUTQPQPNNKKMMJJMKMKNMZNOQQSSSPQSQSQQSSQQQSTSTUTUVUWUVWVVWVYY[Z! E{dsfj ۶- EWWVZ$ވ!HVUUSPSST_=a쮐d'C_ 8adYY]_ahhqޔ}fm}~gl{?-#&N ,PPNMMKNQPNNOOOSPOPOPPQP1r t +W\ MYHGHIvGFNVjNEAEJJJIKLONNNNMNOPPPNI5:?YM &{ߺŰ˸p7ӭQtrlnmkhhlhf=hgxεIp1ffIԥlYԃe|~shTxvqlPq'TTT;_CNP+|CfYYW\_bhbdௌnyf{|xy{}pa~߭? 7 PMNPNNOQPOOPPPOPOOON?NO W&$s l et #7MKI7G/gE+KQxPHACIJIKMOPPPPOOOPPPPOLL&-OI EHs˵ŦµԍtG}qOxsqknkkklkjQHݰAj|œĩ>}J“`ߞ'Qvsnh?48TTT,aO.OO=2~#MZEavAYVTSSPTTQSSPQQQSQQSUTTUYdVTTTQeeCQONKKKKIMKKKJNMMNNMNQPPQQQSQOSQTQOPSTSSUUTUUUUUWWUWVVUVY[\r ZjQùpl[w. ªbr(=VWYW6HV6VUTQTTTT\P(xgɲkM QaVUW[``gpdˑkbaertv~fTڣJ / FOMNQSPPNPQQOOQPPPNN[PP! # 7EP<6 p 8C?>NMJFHGH*2FOUdH*ASKLMOPPPPPOOPPPPPPNR3"AHI Y Ѱ³˶ȩfbvճðyMewrnmmllxlkj7F˓Ms/bn-ѬUُrtsKxtpjKZTTT?Is 9MN(M7Z[2`+HUTTPTPPPPPQQQPPPSQPSSSTWZWTQTPSOP\OKKJMMKMKKKJJMMMMMMNOPPPPQQQPQSQQQS`STTVTUTUUVVUVUVWWWY[[(l-<ٓx| Ø PtV*WVVWW ?¨Y & TSPSSQQQQQOPQOOPPOPNOQNPPPONOPPQ r m .7QTPOONOMHGF*JeGHNV_I3BSSOPPPPPPPPPPPPPPOMS1-C S ߰ůŵȿdۥJòïߟW~y{xpnmm\lkVA;ՒÓW|,mÂаGњ\} `bsmjNEVTQF.jAOO1`/YW7_,DSQTPQ]QNOOPPQNONNPQTQSUWTQQPSPKKMNNKMJIKJKJIKKKKJKJMJKZOON\OQOQQQQSQQSUT`TVUUVTUWUWVWVWVYZZZ!tOϊ끊qg Ġ ZYn#WWUWV=.歾x,VSSTQPQSf`-W̾TwO䩯ɏ[ dVFUZ\[]]]GCΊ~OMlpw|~~k]֫? CUSTSQSQQQQQNQPPOOOOPPNOOP[N[NPP*' J j/TPOSQQPPPNMKEFDHj3CKUxME.IOPPPPPPPPPPPPPPPPNJ4==3jv>œy`ݵA£|D}~yspmnkklAltN{~s|~_t}Y굜VvGvnjf/b*VSS,t NO<s*IVEKp.USQQQPOOPNOPOPPPOOOO]QQUUTQPPPKNMNNNJJJJIKKKKKKJKJKJMNKMMOOQPOQPOQTQQTSUTVUTTTUTUVVVVWWVWWYY[#_<|d9}Nn{aߐ#UڐM ̶ʐ]43WUVVV4SZ(UTTQSPSYnCFΙԦWڤ6ŜÓTT (sST[``]ZWZG9spbJVpw{v_O߳jgG ;$USSPSSQPSQQQPPPPOOPQOOPOOMNNONNC J/4JQheJ9MPPPPPPPPPPPPPPPPPRKC/DH;&ըsγųĥxsyƯ{K}yxpmKyں32p-+|Iaےd-P{\pkdP$œ.=QPD&y&.MN,sx(WZ8`S;PONNPPMMMNNNMOOMMNOONOPSPOONNMJJKKMKJJIIHJHIJMKMKJKJKJHIIKMNOMPPPPPQQSQTSSTTTUVUUUVUWYWWVWVYYZ `IݦmÙWۓ (ɪx~IVTUUTA'ٺ&FTTSSQANÖЅԠȂA[Ѯ1#PE\vvMITUUV[1?xpUUk|rUI'+h۾rMQ ITSQQQPSQQQOPQQPPNNNNOOMMNPOOPPOPOONQQOOQPPOOPQPQPOPOPPOJGC:8;D`UjN?MPPPPPPPPPPPPPPPPPOKU2>G6 mG۳ އbð|<~yfS[pAyϳIkrjfИdgy[w.bsaIrmf_7{QQP.tNMD}+AYEJ`!EQQNONNMMNOKMNMNMMNMMNOQPNNNMKIKJJMKIHIHIHHJIJJJJKJKMNKJ\IMKKJONNQQQQTSSTTQSTSTTVUUTUVVVWVWWZZZeJsxԂ`& ߬AV(VUVUSV6F~+HSSSP>`яШ rdֲQ6\ZN[WJ[[Y7,撬lbFl~~ma\C,H˪~V & UUQQTSQSQQPPOPQONPNPNONOOQOOONNOPONNOPPPPPPQRPPPPPPPPPPNBE=97.`SbUKDKPPPPPPPPPPPPPPPPOMX02WI M=۲Ü˶сbA˜W{QA-Ge<ӑlEरa&\hYnh`G+#8QOE(k-1ON.q(WW4j<8POONNMMKKMKNMKNKKNNKMMNNNNNJKJHKIKJIIJHIIHIHIHJKJMMMMNKJJHJJKMNOQPQPTTSSSTSSQQUUTVWTVWUVVUVYW[[sȁM`mݗx?ˤ* ٳ<&=WWUVTI-gh+GUTS;rw΍p̨p{mˊ|(jrlh`]rYVTA(HvdZ`s}j`ZYYA*#_jl ATQQPQPQOOPQQPNPOkPNNONNNNOOPNOQPOOOPQPPOQPQOPPQPPPPPPOOHIL:7.TSW>LCSPPPPPPPPPPPPPPPNN?HG3H3*Ϣkµ[NóƵ|xhfwP`H<ԐϔS]nj_ϠjTxWw9[qrQrhb[4v&QPO/`APE#p'FVE7j!ENNNMMJMKKKJJJKMKKKNMMMNMKJMMMJJJJJIGGHHJHHJIJKKMNMMOMOKJIHIIKNOOOOOQSQQSSSSTTTTUTUUWUUVVVWUWYY[{gWИg{ `n` JVVUUUJ!̩V8SUS3sxpa~h`tVژ#6q}nfhUQSTI7 v먂bYm}xre\WYWWE1g}fgY lSSQPSSPPPQPPOPPNOQNONNNPP\OONPONPOPOQQQPQQQPPPPPPPPPPPOMLN>89Da>[B=KQPPPPPPPPPPPPPPOLM#F? [>Ųƻ\<ɲŲô}Tb\U\TߟeьOZ|~Wlf\E-36QPP!s&,MN-s{*VV4`1/NNNMNJWMJJKJJIKJJKNMJMKNMJMKKHHIKIJGGFHJFHJGJJJJIKKJMMOKKJJHKKKPOOPPQPSSTQPQQSTUUTTWUWUVUVVWVYYYgd}ڜyp]⒢`JëO Ϩ{y,7TI>xʰΙևtqU}dQaGCCshJPPQSEUI*3׉n`dw~~}|xd[YWVVZ$g TUPPQPO4PPOOOQOPOPPPNPNONNONN\QNMNPNQNRPQPPPPPPPPPPPPPPONJ@:9>EE}ACATPPPPPPPPPPPPPOONMU[PJK;ڵż_$γóӪ|Dt}pv{p7{yGjpZˠmUpQ{;YywGqh`Y=eQOP3UOPA(p+EVAGePNKMJJJIHJMHJJJJKKJMKJKINNKKJJGFJIIIGFEHHHHJJIJMIJJIMNJNNNKJKIJKNONOPQPSQQQQSQTSUUUSUUVTUUUVUVYYY YƑ|Z EιJKVVTUUUPPPOPOPQPQPNNPPPNPOPNPOOPPNPOPPPPPOOPPPPPPPPPPPPMMF=:;CNZ]DAKPPPPPPPPPPPPPOMKMC CH3 ّkڵx´ij¯ɄDɦxSsqm4ֵFߣaԚ&vH橰YQPx|xYlaZZ#ŒH-PND 7-OP1tm.VW+`$3NKKJJJKJKJIJHIJIKMIMMKIKJKIKIHHGIIIHFGFHGGGJHIIJJKJJKJKNMMKKMKMMNPPaQPOSSQSPQQTQTUVVTSSTVVVVUUWZW{nebq娔eyKn ۥH>4VVTUVVT2C®߄E|n`Ӣ2qד{H Јyw8`nldGCOONNPSSSVG9.阓Yfkw~~}|xxvqe_ZVVWWK&`իJ ]TSQQQPPQPQQPNQSPOPOPNONNNNPOOPOOOPPNPQOOONPOPPPPPPPPPPPPKO@<;=GSt?FCSPPPPPPPPPPPPNNLKA~.(GK nH飼˅~ κö}`ftgSmbkS4~Wq.njZ՝lYpWrDk}gOpe\Z<\޻FQP7N>MC&`!AW?CkAKJJIIIJIJHFIHJIJIJJIIJJIJJIHHIFGGJGFGFFFGFFHHJIIIMKMWJMMMNMMMMKNNONONOQPPPQSQSTTUSQSTSUTUUUUUVUWY'}`}gEVVWVVVW-TބYVM_՜sUl{ e㙵6+IISOMNNNOOQSSSUF2>~Zbgr~~}{|{xme]YVYVZF`Ӧ UTSSQQQOQPPPONOOOOQPPPOPNNOXOOOPPPPPPNOPPQQOPPPPPPPPPPPPMMD>:=AKI\@@LQPPPPPPPPPPPOLKKNUx GIC*K ʻ{yrar_x`gC9Ԕ]߈ß|9棯\Z[}{x]j_YH!=1POA$41KO2x.VH,`*6MKJIKJGIIHIHIIGJIIIIJIKIJGIGFGHGGIHGGFEHGFGGFIJGJJJKJKKOONNMNNMMNNQOOPPOQPPPQQQTTSSSTSTSTQTUVTSbYYё/ bϼnx WUVVVUVHZ㓄K>t?իs֭9[3*n+/DAPNNNMPNSPQQVW?,Gջa\et~~}|{xw~ne\YYVYY<P 9UQQQQQSNPPPQOOONOOPOQOPOOOPPPPQPPPPPPPPPPPPPPPPPPPPPPPPQJSB:8=TPjHADRPPPPPPPPPPPONMKN&$=K3 jJ'ɉļ|NĤrU~xmsJ2wո>脾7rsspڙ]`pNJ~qGnbYU4tEPP+m?K<1f!IV;\qNIJKJJHIGFHHFGGHHIHHIHGIJJIIHGEFFHGGEFEEFFEEFGIGIHHJKKMKKNMMONOPOPOPPQNQPQOQQPPTQQQSTTTTSSTUTUTTWZ[wtx|{梈pW(яʓj9=VVWVUVD($Ð|`ݚK|xȈxZ`‘##8G3ʄ89GSONONNPPQQSUTVYA1dٵa\h~|yxxwsl`\YUWYWN!>* fTQSQSQPOPPQNPOPNPOOOOPPPPPPPOOOOOPPPPPPPPPPPPPPPPPPPPPPPPMF>8,2MHbCBLPPPPPPPPPPOOLKKO*v/M= V_θ?l乼{fT\yvryhQ.НǨ߶PwteӒMxtPUsdVk_ZU3sDNN.q߄VHIGGFFGHEFGGEEGFGGFGGGIIFHHFDEFEFDEDFEFEEGGEFHFHIHJKJIMKKNNOPNNPNOPQOQQQPQPQPQPQQQQQQQQSPPSTUSUVWY!υT޲{n`~rqfstsF`]]]_eߓʼn]VMtqڈv+&/?HKN;+-{EHKUQPONNOOPQPTVVY_?EȤTWZg{xxtmfPZWWVYYM#E 9SQQSQNPPPP\QPPPQOPPPPPPPPPPQPPPQPPPPPPPPPPPPPPPPPPPPPPPPLP:BQ,CKFoDAKPPPPPPPPONNMNKNN44G(4a KڸÝxFȩ{|a{|xwrkga&g<}Gw̗޵<ړdNk`qaZYG 63OO;!v#2NN q?>TF(V6HJHFDGEDHFFGFFGFEGCESFFFFEEGFDEEEFFFEEDFDFFFEGFGFIHHIIKKKKNNNaOPOPPOOOPNQOPPQOPSQQQOQSPQQQPSTTSSUWYYQƮ|݁t69SSHb`npqW~plb_mhamȄ<ȿItyp☳|>7_IHNNP*ߐ]HHWSPPNNPPOQQTUVZ_K?DxfTT`jwrwd_ZZWYWZM(3e e SSQPOPQPPQPPPPPPPPPPPPPPPPPPPPPPQPPPPPPPPPPPPPPPPPPPPPPQQIA[FA1F;x]BHPPPPPPPOMLMMMKNN# 17 /`ڵ̨¶˴уrQjK}y{xwpjeb j儈οqGτT{_dqOgKZV1v#DPO/~h>M2Kj'UU+yhIFGGFFGEFDFFFEFEFHFFFFFGFFEEEEDCDEFEDEEEDDDGEFEEFFIJHJJJMKKMOONMNNOOP[NPPOONPOPQQQOQPQSSSQQSSSSSSVUVY9p|﵅E~TjYUY=]PH6ݘ;C9''ރڹ{(mlWѮI '6#?eGIMNNK/6MJIUSOPONPOOSSUVWZ_VDGʓs`O[`qhb][ZYYWZI* FQQOOQPQOPPPPPPPPPPPPPPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPPPPPQNEIG].>HAã;MJPPPPPOOWMJMMKMN9  H ,ĺéƩtS۩pGh}|xwwqhe`!ٟS݇߹9m4ڲIهjZ|U]`ZVH++APM8&p ;KC#` DS=6O;GFDFFEFCEEPDEEEDFGGDDFFFEDDPDEEEEEEDEFECDDDFFEFFFFIHGHIHJKJMMONNMNNMMNNONNNNONOPOOPPQNQQQQQQPTSUTSVYZΗ[gvגٮx7wUݔrpWHHHJMKJI;-Ԉ{k>GUQQPOPPQPQSTWV\`aUJNќ{jUJTkb_[Z[[[YZ7# 2QQSPPQQPPPPPPPPPOPPPPPPPPPQPPPPPPQPPPPPPPPPPPPPPPPPPPPPPQG>P5-,3?e?DENOQPOOMNMMKMMKKK 8(>aֵţÏ{jvʟmS}}|wxtxf` }aDp[ѓӿv*|HⰉ\}x|Ne_[W3w݇PNN(YNO3WvZ,UTyDKO[Z[[[Y4 Q TPSPQQQPPPPPPPPOPPPPPPPPPPPQQPPPPPPPPPPPPPPPPPPPPPPPPPPPQKJ:`v&4NAdKC=INXNMOKNKKKNNKM9 p F1#˜d˶øɶʩ}HˠƲ£rm}{wqO`ݞMt-̲{EݦyxsrQZbd`2xq*DOCJ.MN-3;SF$b ;EDDCCCCDDAACCA?DCCCDA?DDCDDADA?AAAD?CDDDCFDFDDEEEEFSFHFHHHHIHGHHJJJJJKIKKJKJKJMNONNONQQPONNPQQSQSQTUUdY̝j龹k䘎ьըn ߠ4-Դ/WVWUUTU&q빩ׄEUm߯V4JJIIHIVJKNN7!SÁJ&>EPPOQPQTSVUW[[``bgph`\yE-!;P_\ZHI ,+TQQQPQPPPPPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPPPPPQPPPPPPPPPPPPL:-l$;G7=:6KNMMMN`KMNMKMKN -6my̬ʵ}8ʵî_~x}hb#r=xbmlqxёU_w,gytxDSggk_J}.?QN+T}DM=+`TP/lP 1G`A?AA?>AACAA??CDN?CCADDEDCDC?AA??>C>CACCACVDDEFCDCFFGGHFHFFGGGHHIKIHJKJJJKJMNKMNPNNNOOPOPPPOQQSSSSSTVYZeìn‡m˚mr ů U㠴f3VVVTU4>ڴQ߃aS|f9 ȁ*AA?AAC?AA?AAC>ACCCDCDCDCC???AC>>ACAACDCCD?DPCDEDFGFEFFFFFFGGFIJHHJIHIJIMJKMMNMNNNPNOPQQPQPQQSSTSUTVYJwߵx鿜4ӳ 뙺O;WVV>ڼ$GqSZE?((1=A( ]ℵ7;IKIHJKMMOQUO>J츍_$1TQPQPPSTUVVZ[\`admrsv`N`ѻmF-'48! ASQQPQPOPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQQPQQQQOPOPPPPPPPOKE=-`t!8D1;>FKMMJMNMKMMKKNKN G*DӯmԦӥٝsߑN¸ưxJw~yqmgj}7g;wYx =ޟlvx7Uv[-IVV4s ON3Mk QP.g /EA??CDA>>=A>>>?A?C>AACEDACDCAD>?ACA>??A??ACCEDDCCEEEDDEEEDAFDEEEGFFJIHHJJJKHJIJKKKKNNOONNNPPQOPQPQQQSTUYK ̦湰vőڣ{ ~ӼO ޙx98UV'jѠ_-3*抏SF<[W;>F3>??AD2$1ߖ_6JIKJIJKNPQU\GAyڙЇO!7SQSQTSTUVVWZ]_`bjprsrdSNtœόU2 q F!SSSQVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQRRQRQQPPNOOPPPPPPOLJE?/OV((<1[x9HGWKMKMMMKKKMKMKf -4,kbѳΝlk;̴ˮéxS~wwqnY_ݨ>vlt˔A⫢J~ grO`-[`haWP>[VH+r/6PEhEO=19*CAAC?M?>J>>>?==>A>CCD?DC?AAAAAA???CA?=>?M?ACAADAD7G7DEDED2CFDEFFFGFGHUHIJIHHIKJKJJMKZNOONMNPNOOQSQQQQQTUWY!p_䖾yӠœpq ϩv2C;(ֻ2DC(D訅#!FkUNHGEFEEHFI(*v!KKNMKMNNPTW_VKMԭ}{4$9SQSUSTUWWY\]_`agmpqqrqSKMa   FSQQQQOPPPPPPPPPPPPPPPPPPPPPPPPPPQPPQQQQPPPPOPOOOOPOONLJHPA<<<898?4>=HKJKKMKNMNJJJMN;  =(EW˯ôs4³xgx}|vsqPPAߪKїppP⻥ۅh\lGTW[&ݞ/ZWW/*QQ.q~h'P>*y DAM?C=?>=<<>>===>?A?AACADCC?ACN?AA??K?=>?AC?ACAD377gZ7AAACDDEFFFFFEGGHJHIGIJKKJIHIKIKNPOKNMNNNPPPOSQPQSTUVHnsϳ㾶t&!ݹ _ھт#;..U~q8۫D GgSNKJIIIJHHI.~ڇŦH1MMNNPOPSUZ_`OHd̲p2/UQTSQUVVY[\]\agknppmnm`E;]ۿ/} DSPPPQPPPPPPPPPPPPPPPPPPPPPQPPPPQPPOQPQPPPPPPOMMNNNMLKIGGFA>;978$97C7=FJVJMNKIMKMMJJK vۮq{#Ѳk|yvvdJd=swkԗe_Ѣ ,j\j8v2 3*>>.jC?YYD=vٶ/6T<2bCN,YC (>>=>>><==>>===><AAMCDACDCAAA>>?>>=<->A??CACCDJtxx2A?CEFDEGGHGFGFHIIIHHIJIIIUIHKKNPNKKNMKNMONPSPSQQTTVZڦūΐڭn yj ٯɖ~DՎ].JP3}xp?aTOKJJWIJHGI83ﰃ-AMNNOPQTU[\adSAxٓwn17TUTTUVWWZ\[_`djmmnmnml``D7F}ѫ⢏( eTQPPPPPPPPPPQPPPPPPPPPPPPPPPPPPPPPPOOOOOPPONMJLKJJIHTDN>MA=>;6847-*tb;9EHKKJKNKJKJJKN& !FT혈]&ѳVxxxw`ݒQsZѦ-vI‰ 9Zlx 14 ڇ/JYK+Q1SQ*;/O?*M]??=>?><>==>=>>>=?>??>=>ACAA>?AAA=<==>=<9<;=><9787'(/>FEJKMKMKKKJKKKO Dr߮ 8߿ߣS~jxhYx>Փgf*xZAQnߠ` /ăVS r;DVVI]t(US1N\?N/x *=A>?;<<;<<<=<<==?>>A?AAAA?A?>A=><<=<>===.-$Oh~|W`d+\jke.CCEFFSFFFGFFGHHHHIHGIJHHVIJJKMNNPMMMNNMNNNPNQQSTVW߫~̶䮿ڐkxtn뮟{tZMM]p=NQF2D댓*/WUQNMNNMKIJKO;V .QQNPQTVZ\]`_`Q8=Œk1&;UVWWYYZ[\\_`etjllkkjlhhgfQC,*O帗 ATPQPPPPPPPQPQPPPPPPPPPPPQQPPPPOOPOOOONNMKJJHEA0=:9766477787M8;+G&;O{3H(IMYKMKIMKMMMOd Z{&Z'H˾K|ed\Aָ6yQנhTC Tn`` a-N/Nhp'TUK3xA>>><>I;=<<<=>><>=>>??>=?>?==<<<=>,/#Aav}x\dedbbv?6ADGEEGFGHGGHHHIIIIGIIJKGIHJJKNMONNMMKKNPPPNPSTUUWӰ۩b~Ùڭpڗ}h}{s}lݣWJKWWPkEFQSQF/4״;!YUPNKKNJJHIKI7#+}4#HQQSSTVZ\]__\]K/Sxd+>HYWYZYZ[[_`bfjkklkjjjjjfd`UC8*2eZ qSSPQPPPPPPQQPPPPPPPPPPPPPPQPPONOONMLKJJJJHH9D42/.!$4444#2269;;!7 $E.GS1wnlNO&_ /?>><<=9<;<<=<=<;;<;><>=;>===<==;<<;<1!$Qxq[A-,]Tjebdqh.DEFGGEGHFGGHGIHHIJGUHIGIIHIJMKNNNNKKJMNNONPOQQTUWʩHϒʐѥ șۂ 7GA>=?;2<9 㗲<6?CIG=PQSQPQ7qfNSQPNNNKKHKKK>2렞k(TTTUVY[\\][\\O9$dʃf2-KYY[ZY[]_`bfghkjkkjjjgdd``]]G=1+2M| HSQPPPPPPPPQPPPPPPPPPPPPPPPPPOONMLKKII>KNNNK\VT\ZDA<7&221134K;MM(*476K&[KKKZKMKMMJMO P\׺#=bƭwJ}xxxYڑQ~wyȇV΄]p/Jxrf޸h; U}I8YYZ?2QS +F2;q6>S>=C;N*\[ &>>=<;<==;<;9;;<9<<9====9=<;<<<;<;<&<(`gZ=+\JJZMKKMKKMN6 Tt (_ŪVv~~{wx`՝DӓTɬFמn[OGxr`jm Ox&]N`_4? .2pe-SG!m8.M94H8 A>>><<<;9<8988;8<;<9<;<=<;=89<<<<$(UrG*/`w}epbkl|KvedddmpN7DFGGFGFHIJHHJIIHIJGHHHHHIJJKMMKKMKNMNONPNOPSTTF1ڏ陜Ŝљ1w3ڊ߯*7TSQQQSQSPPQG#6T2GQPSOOZJJNKJM=3n訏#,?UVWYYZYZ[ZYZZM7#Jږ~`1&AM[\Z[\_`affhjjjhkgseb``]]`]_``]J s F URQMOPPPPPQPPPPPPPPPPPPPPPPOOMKKK]]WJIHJIKW_k`KGIFGEDTG4.-.2EM;CV7=$VA7IWKNMKMMKMMN8 W vijwTmy|x_m6˃Ѳ<ԅʾlCeaڑ=ppWՍ|Ky۬36dE#*.aj( fxߩ+FS.pdCM,y 1===<<<;9;;86876;;8O8;;9;79;G;<;&#Qv`*&Nx~xtggfede~Qeeeddebm/6DGGHGFGHJIFIFGIHHGIIHHHHHKKJKKMMKKJNMNMMNPQSTUѼnyѲ֜ƅםè$Ʃ̬֓#>TTTTPQPQPQQE($hx&7SQPQONIJNKKMN;(+Ą`8IWWZYY[ZYZWWWZY7&G~m?,4O\[\[`_abhjhklkgjjeeb`]]]]]```N3& GSQKRPPPPPQPPPPPOOOPPPOOOOONLL^\JFGEDDCEC4D38I__FEDECD?Q6!/2F-fy>67 7Ś7O6nJJJKKKJMMNN  &6[ȼkrxy|gpJ悸VrɌHx\wڰ_apds޺et,Mjr`ZWf ]D2SG6I#=M3KP =><=;9<98987788777(698;;;;;899<+<;<;<88F7786778687898888;+;$-{e4#Tw~lllllkjhhfgdfedadbqffeq.F_dS2'4GHHGFGFFHHGGHGGHHIHJJJJIKJKJKNMNMNPPQUH ž.ʣxĎޟ嵢𦯌ぇYڦښUѓў8SSQSOOPPNPOQ4!V}U6SSQNNKJMKKJMN<#9ѐe-EYVYZWYWYYYYYVWH?1Ƙl7*=OP`adgjjlkhjjjhgb``_]\_]]ZNDTRJQPPPPQPNMOOOPONOOOLNLKK]MF6DDKJ>988767;=>PCCADWFAC??A>9#/2J9?\7+ JQ-JKKJJKNMNMN? ; ˞!>ڜtlyfme{[ϘPvk(m_ڔTddaݞg$xnݣ` sM,Na,?S7`Y߇#?N(k +><999<988886648664666;99.(+Ud|}9g~mmllmlmllkjghffgfebdbQ6/.-A|v#4HIGGFHHFFFFIFGJIIIIHJIJJKMJKNMMNMNNPSU&G׊|寰ӵ侮x sĹФswߢѮ~31TSQSPPQOOPPQE* s&*HQQONIMNJKNKM>. Tﺄ]8ZYYYYYYWYWWWYYWW=+`㰒m=/>Maeghjhklkkkhga`_]]]][[\1 >RGTQPPPPNNPPONONNNMLKKJJNJFEDK=74322/22344#7=>ACCFFCAA??J<3#3O-*~&&71Þ8?;YMJKKKMMNNOZ _}mf{[yreC`ݐJƲDfϗA׺x?h|ݰVZqwv۸mr|y;q`x\-M,k-GO>9I!>M6?S <9;;888;77773446768 +3Tyq|msnppnmmmnmlkkkhgfffed``J]ը$9ă8#E[WZWYWYWWWYVVYWWYE#-r-'D]kklllkkkgea`_]\]_` TRMNOPPPPPONNMMMKKKMJKNHFFC=4/./.2/.A,.1123//236?CCK<6G/gC,<963G48gJKMMMKMMO* $vTrxMZ|?ъqh̊3ʐ k޵G[tyvgxselYkr{3[f+QE 4D*9I-3P=9787D8446222424 = p~{qp~myWqpnpppmllllkkjdd`ablMb96J.1#ԓ$21FHEGFGDFFFHHGHHIIHHJKJKKJMNNONOOQSH!I4NƁpȈȬˮٌ֩xW}ѻe a⩼ˣw?SQPPQPPONNPNP<Es&#=PNMNKNNKMNNOPD+(涂f'(NYYYWYYYYWWYY[YYZYZ=$'`Բa-1ITallljgd`_]]`r }QQQPOPPNNMNKNNNMKJKKIEES;21./,-+-++*-,,/.//./.1/47H?CVE->?CAG6<98766;1`ݗ22;aKKKKKKNOC w ldN8Y~HenW՜UϢyg`M OfPwyeZvpOgrGAMV}k׏ g['=3QW<<8776634224422& `parqqpppqm|pqpnqnnnlmmjjjd_Z]`]IKxZa,G+` GGEFFGFEGHHGHHIHJJKJIHKMMMONNNONQST!PK-nŅÅӅӲ٨x]D w䚾ڣ2TPPQPQPPPNNOO?-鍈l!4PMONKMNNPONONPF#!ćj+,H[YZYYYYYZYZYYYYYYZPA*\Ѯe8-2FU`mjfaa`P HQQQPPNNNNNMMMKIKIIJEEM=32,.,,,-+,**',+-..././-.216=?CVE?>AAP79F64646 |m39I_KIMNMMOQ\ (8f[mDxs`۴?yԹg;ߖk*;|KxyjӤJtnDwШ?pK`Pbypk;ڑZ qq7J$|~ $7876463222/3/3#&t4fsssqqpqqqqqnpnppnmllkje]IUY[Twh C,q,FFGGFFFFHGGHHIIJJJKKJJJKKNNOKMQQST(OZO(rфóם 󝰗}#+CSPONONOOMNNNO;Dqޑ+(DAOMNNNPONNPNOS7>̌_',E[Y[ZYYYZWeYWYYYWY\\QF.9dйb>/-?EVTWNxJ (QQONNMMOMKNNMKMKJUEFD<4..--++''**'*'$'6,,.,+.--+-/4O>CVA?=?AQ!4N87V736.#P8;JMJKKNNNO< $;IYgjq``skk߹Dkϼ37#=G9Nxkg`\}SF`л}[mx8kځ K E+1J/G[ 778633122 2/.2 V}~ Ofsrrqqqqrpppnpppmmmmkhd]TPTFb[`bl>h7 /,+*+*6*$'4&&'<*+++-*,,,-47=ACY>>>A?;6J676449&?צ73&\KKMMMOOS .v 4֢K]wE#El]elt{тZUxŜ=Z#DIAvYdxeaԊJhe3bkfljOgڢnvv|V{UgFT93/S? 972434411/121 &|g#UvsqqprrrpqqqnrnpnnmlhbgSNN+t}&vgT1J=,.b&FGFFGFFHGHIHHJIKHIIHJKJJNKMZNOPPS \[ZZ>2߅ߓа׬(ө =̿YfW?SSNPPPPNNNNNNO;&JݪsڴE 3ONNNNMMOMOOPPQG4#p⹊V 9G[[[ZZ[ZZ[ZZZZZ\[]]]]]`?72OƵޮ} FPPQOMMNNKNNKKKMVHDF`<#.+-*(('&&$3(#$'$('6*(,-,-+-,2;==OO==?==3D98-T!*. ބ?34fMKKMKNN+ & [;<>IT3M*W~C*9*m+7IYKJNNONS rD _];<.P]\Z[\Z[\]\]]]_]]_]]]\_]]_OJ=4.?_ꪪ /PQNNNJKKKJKJIUEDFZOMNMbY9$2./-(&$'#($$8$&&'$**,*+,,19P?N><<<=N/6;A>4(,hګ<=#kMKMMNN3 !,F Db|]JP`~e߮Ar֎QwƢ4_-bjnxx}gbtsapڟDNN8ݎW=D`H~Eݿxhh{M3>KIl ,[| 31/2/../,. Y|q}Mrrrrsqsrqrrstxxwqh`TM6>'\`dkfM?k#& {n*4IEEFHIKWJJJJIKJKJKMMMKKMNNNQQGN[WVYWWE'ްb߇¯ڤUyNڗ 蓘 vxh7PPPONNNOMMNMKMME=/ի}>7PPOOPPOOPPQQSSUC' ɍT$*D_\]][][[]\]\\____`]]\]]__]``TTHE>GMsvJ xxQPNNKKKKMKMJKU6DJZPNNJJId]<($2-.**';''#&'$!!3('*+*-3H>>U;;9=K#/99T=`&8߄/91rKJNMOP v =Ha]alί9|۴FкhKqy,fvmg{xYrtdvѼEAK6e8PgJ[YWM|n3F=;_k`w na 341///--,/}}}ݤ!asvrsrrsssstttgre]UJ (faefnh>MZ# _6HEGGGIIKKJJJKJKHIKMJKNJNNNQQT[ZZYWWVWD(aهߣѳ>}xtï}ބr '㍩ Z̃ .QPPNOPMNNMMKMKMOG6TΦh̃$S<;8<|ѹm wmן9_mm\~Verrhvm7Y䒎ޯР{fۓ߼!x[⾓- 6ޅ{ ۮ_ /QOPNNJMMNNNKKJOQ>2(}|d J;} 3x !//.-/-. *~}{~Tvttstvxxxxttrtqlh{w7`_tOHls}rk H9 3nIGFFGHNNNMJKKJMMKKMMMKMNQQQT\ZYZWVUUVWW-Gԉя~Zź 楥ìkM{̎.;ڊl bˏSPOONKMMNMNKMKNSTA+6f#>PPPPQQQQSTSTVVVK8#4¢m,7E``_`````````___`]_`````abdgkkm ?QNNNNNKKKJJDDFaNMNKKIHHHFEFFEFHkV=+7321/.-,**$3&*+-.6IAJ<776D>-.1D99;43#&'ߐ4?(psVmlnvsw}ZpmZ|rK9U3pY.MON1VbΈpm4Z/F7wݳ+ >.ݯ 2/../+ l}lȏȿ dttvtxx{xyxtrrrqml1jxZMqd]q4y 7G' g!6FFEFHKNNNNMKJKNJKJMMZOOPPTH$\YWWVVUUUVWW&g̃Їh՘ɔvYxԘ NȃG $I̯C>PPNKMONNNMMJKOQQS?(SڮV(GOPQPQOPTUTUSUVUYD+&ۨ_'*;Oaab```aa``____`_]]`_`abehhVG DOMNNNKMKJJ[EDJONKMNJJGGFEGEFFDEEF[kC;*662<,*7*&$&**.1M=?84427H (*-2J632?34CaCANeK=KO ftr`ڟrPԸ,#;OP9lځGmm`dkהQpnWwvsb.U9Tx&CNNO!qհN}{=Gn([a[\ K}23-/.;1 +}|m|];xwvvxxy{yywtsrtsp8|ψm[A]6F ;HGGFJMKNMKJKKMJJKNKNNOPPSI#[[WYWVUWVVUVK#Ϯsø׭ƓϮ|pxߢ f껓+*2Ȭe-?PMOKMMMMJKKKNPSTT8#d޴F (FSSSPQQ`SQSTTVVWWF2+S帘J$9Hbbbba`aa``````___`__aafgm  PNNNKKMMKJJE6KZNOKJKIGHTFFGFFDCFFEHQTU>94#//-+*(*',*/;=?;7A#6E*-/2HE73127+dݺM3wٖO_mmbm߸_`m`[Gۈ/?=8Յ,;KKN3Dg`6HqhrӉ7;EJY '& M !-+,. >{yxjĸϻʸQwvxxxy{|yxvtttxg}4xvs`WVM 'QC MZ$FGFHGJKYMNMKMKJJKMMMMQQQUV.NZWWZVWUVVWWVA#ϓx薪٫xłߢ| ~멜+2/ny=PNOKKMKMJKJKOQQSSH,-ɜH &7TQQPTUQSSTSVUWW[N8&9̶S!.JQdddabb```_``_`_```adS 9QNNMNIKKK[EDKOONNKJIHHHGHHDEDDEDFEEEDCTHF44--*(+++.8O?=44#3I+*,.27844666 Ϊ31OnPJKA ( /x NYs˻a!ENOS?>r׶N[lmf}a\j]UM۠6>F3*+1$'x?C wwȎ>4'| n q.;+ lĤ{ygyξù_vxyx{{|yyxxxxwy\Tx~wbxxa2d 7E p2HGGIHHMN`NNKKKKKNMNNNSUTG\ZWWWVWVUWUUVUFهSbނ̻ƒs /+?+gd -DPONMKNNKJKJPQSQSSG$$mĘT 9TSSVSQQQTTVUVWYYZH1(AںyA!8Hebdbaa``_`___`_``Nl ONNMNIJKJVEEJNNMJJJHHIGGIHGFEDDEEFFED????>NG92/--.,.2Q>=6634A-+',-2$I89946#$ȗ7.3_MKO ] Tdм>b-Ons=QSTEOѺ[Jnpr|nhTh[[W=;?1vKCTS[KAƅF?DSJY„P#H[|n+98_?~ $.< 2}yxk|μĥȞ&mxxx{y{y{xy{{yx|?Ьstda`vvq3 FC ;IGGHGJKNNNMKMJKMMMNOQSUY$ZZYYYWVUVUUVWVV<&&p_ |ˤ j_哚wx##=QQ[Z~~+GPONNNKJKJKMN]SSSSTI!$jk ;HTUQQSUTVWTVYWZZ[]K7+Dٺ`3*+DPebb`a``_```_aTE SMNNMMKJMJF6[NKMNMHIHHHFGGHGEDEDFFEAAC?>A=A?JHKJ64.9I<&247G/*(,12&8;(b667&6m7=,_NN6 }EG Nbh ?QUZ_SgUmndynJheGpkֶP8H2qϊyӢϫٓꍄx֘\x|dĻ߼ ]q `px{{~ʹ˜U>xxx{y{y|{}}{xxk'U~rhbs~`YEq C3 j?(HGFGIHIKNNNKMMMJKNOPSTUK$![ZWZVVWVVVUTVVUU=(dM{KIυ !//KA몏VPK8TPh!G9I8 Sڣd 'PNNONIKJJKKO]QTTSTT>$#yx$1ITTSQTUTVUYWWZYZ\_QS6'K˵׊Q+/2GJYaaa`__```9&  OONMMNKJJFDHVMKMKIGGFGFFFbEDFFFFEA??DAAA>>CA??=OGFM2#;M3234?,+-<7Z;+M,'66'EQ1;;lMC 6 d>U4~N1 #ACCA?>>>>=96M93222G-((,-6HvA9=KA>67,dI?(MeN- `1Z#v3?8yݴM; 7ԯ3=\`dglhݒQanpgtJTdN[|VЇ/??F`öx *n pKyɠl|m`MT E?  4ɟ{xgx˿¿Կа&exxxxy{~}||}}=d赅|trUl_aAq #/ kIHGHJGHJJKMJMJKKKONQTVY&![YZWWVVYWVUWVVTUUW6&AھjA??AAMCCCA?>><<>GQQ412.1,*,-/67<;=<&?664,-jёD>.e_; F 1 V84f6Fqxk|* (6-?4;`ehv`dxyۣI`mpf}vWKbUWF44<4ڣ-ŚHٲlIbv`8x{W|`hQ1 !7' f×yxxyȬnxxx||~}}~SahOlbmlkpW2j  j.JHHHHHHJJKJJKJJJNOPSUY!!ZZZWWVWVVVVUUUUUTUU<&_ЭDԼȏqV[Y~wrkafrmnx}8QQD(3x8 .OONKNJKJINSTSQQQSPNN<(_ɤ߄/ $?UVUUTUVWYY[[\_]```aaUG=7Eӟɒ_>! E bPNNMMKKKZ4A*6A>A=A>>CACA?AA=>==!O>&.1/--.,2798;J=?<'767('|/8&~U l h4ŢPQZG>>.MÖ4GCWHwvŁxqDN$_ƒs9MNNKKJIJMQQSQQSQQNMO;/CۻZ,HUVUVVVYZZ[[\_`_``abedYK?=Y QNMKJJKJJDC92/6>VPGDGFFEEFDDACCA?M??>>*JI3/,--.+,.1699??1pݞa-AMNP(vp29#=}ګ8 kDJ\;  #Đx|{~˶ɹɿȼоƬ qx{~~~}~~4hӅjr`~U~qst7 7HKJIJJJHIJKJM`ONPSTU([[YYVVVUVUUVUUTTUTTUUV77餤wп+ĥxmIa]֝ ,72TSOP<,`ӓm, 4CNNJJMJKaSQPQTSQNMKOPO>#(qĄ|d &DWYYWYY[[\__```aabdefgghjTICIShԵx S NNKKKKKJGDU6/2-,.#4=UOVEECFEFECC>?CCAN>C>AACCC=>AA=>H4//,A+(+,/137;OHGGC1aC 88<+>b3,.d 1G6_NI_7e{&8MNKNOOQPGIM=lwhy*>>[g*CMMA.`m//'+8 bl G6d Iȶ|l}ůîӹ˾λ¦e||~}}~~~}}~v?OԘghxVG_xwKò h =IIHHHJHJJKKJNPQTPSI#MYWWYVWUUVVVTTTSSTSUTUU76|dگxh`Ȼ{Jt xHDPPPA--y ,ONNMKJM\QPQSPTQONMNMNPD*NɝyY &>YZZZZ[]]```aabdefghghjkkk]SOGCJbϾ ;NNKJKMJHDD=&1///-.#';PVTECDFCC>ACCCADAA>v AyZ q~|mb{}ï̿˻ƫPhq|}~~}}{}OHsfygyr]QE~x kA7JHIHHHHIKJJMSUfQSU(![YWYYWVVUUUUTSSUUUTTTTTT;+s꯾̏pwګd~ _Ѳrq>QQOO>#=մsv ;MNKJIKQPQSPSSQOMMNNMNPE,!$yѿW (A[[[\]_``b`dbdgghhghjkkkllnm`ZSGMHH[v9 aPNMKKJJIGCK;624231//#&$>/A?CA??H1,,./*'--276+ hW~ſݰH+CPPQQUVY[bZb\Knmmlmbx`~Nam]dG?HCebє3=4MwԄ(CKNP?CCCCDC/ACDCAC>DMM1--A8'*-27;MWGFGHHHS4/ET(78-.WT4 t~D3M #,*7?$`UkxȠވ-*TTUWY]`adgkbѶYQmmnlmpy]ّN`j_aC6JDW`ߖ2>4N֓+4MOO=9ХD+.[ | 6 eݮ}wrTw~ŴòȾɾȻEr}}{y|EJgrpj`>AfZk>8x /'JKKIIIHIJKMPNPOQU1([YWWVWUVVVUTTTTSTS`QSTSPSV9#ɬwn诰Y㲿sﭩnE I#6SPPPOE7}ϑnG'?PKKKPSPPQQTSPOMMNNMONPPP6'-TȠ]/#CO]`aabddgffghhjkkkjlmmmmpqmnl_I9 -NNKKKJJJFDCDEEA<;72///--2#67H?QCNDDDEACDDAACCCA>AM;!/,-*,/238=DFFHIJIKHG2Eb?99;$&[P9 E#yyrZONOKMMNN;[fW߸]xƪ.DHYZ]`bpfgjYeȵWUnmpnmbxdחI\hh`qF=VHQfԫ967>{ե87ONP<2验Q$$qy ⺉ M 9r֙|tdbxѾλѼɨIr~~~|{|||xs?_ԑӮZYpmwh`MAPjsf- KIIJGIIJKMNJMONSV!ZZVWWVVUVUVTTUTTTUSTTUSQTST9*ūynଭ`­nZ Hэ .QQQNPPD!D|$ ,CMJK[QNOQQTPQMMKNKMNMPNPO<1$?l2#8OUabdfehhjjjjhmmlllnmpnqqqpn?ٚ Q NNJJJJJJIDED\MIE==73..-/,//1&68IQSCDC?CDDAACAA??CP(2/,>*(,/17=AEEFGI\WHIHF1_N<9;7+=`H9 #(Z [EPPPPPONC/ʉV{yn#G_bbnfghjghP_ʵdQlnnmn`xwvףTTh\M|߾b6JCJnڮM278nٲG-E_QF'֗I  [` meHG .ƼyeHt|̯õ̫K[~|~|{}|}}}_2\̒a\ZgedndgVY`M* KIIHIJJHKKKKKMPQH! [ZYWWVVVUVTUUTSTTTTSSTTPSQST=#ɫЄeԭÑlԮepy +ړ/!FNNQOQD7Tݰx# +CKKNQPNQPQPPMMMNNMNONONQPQA, J׹ʇJ$ -?Qfeefghjllllllmlmpqqpqqr[j =NKKKKKJHDEEbpQJQ?<722./..2144&7 ;>?CMACCAC?CM?ND?41./,',-146?DDFFGFIIJHITG((Y?96827p=8 ?V9 DITUSSTTSHww=>gerhhhjhkg\Vgϴ[Unnmnpbj}ѲQVg[Ma1J>Jm۾Q/=?Ԧ( $#hƞdC3/Mwpm鸗h2 WmxYWvÔƥ˿4`q~}|}|y|}{||mI]lwxUedefhT=HM\7Hf1+'>KJHIJHKJJJMMNOSH!'[YYZVVVUVUUTT`VUUSSUTSQQQTQQT3*ÊĬޓ_ɓј{v߬dpĬݦSDPPOPNNP6jߠh' 7ANOPOPPOPSQOKKNNNMONONQPQQT?&FѵsH#$>FZghhkjklmlmnpnpqrrssrFM KQNMMJMJUIEGKM]DDMCA-ND?7331*,236=ADEGFGHGIHJGHIG*Zt-+;9*+xC-(7y KbKWVVYVMHJȶd2`]vjvjjkjghkWrɳ`Tmmnnq`aqлVMeYFq2K>AgU/29l̠pb׸lvq# ѵ{v`e{ιƺ=k|~}|}|{y{||y|p?rg{qkMagUtT4S(KIIJJJIJJIJMMOPSH,[ZZWVVUVVVUTUUUTTSSTTQTQSSQQTSȀٖdω¯ߎ\孾h˫l٭* ִ|q?PPNNMKOC(!Мx *8N\QPPQP]QPNMMMNMOONPPNOOPTU?+$?ЯnE168O]klkmmmmpmppqprts[ PPNJKNJHHEEFKl[HD>;763443?4244664679+;;<>>>=ޝ٢pQ3*8KTbnqqpnqstssseM /NNKKMKJIIEDFWMGC=;;87D6434666668897;9;<,;',?CCC<./CI]gtrrsvvvH h OMMNMKJIGJEEFHCA-<988878787898999;;98;><97>AAD>=H8/,3;=4/ nGFHHIHJHII=/ 4 D,789=*CtH> ypjjPYm/q/|Wlgjjjj_Z٫T\mkkhg_Tqv?TJ]]t4K?OѓKQn$46JHJJHHIIJMMKNOQPG&[ZVVVVVSVTSSTUTSTTTQQTSSQQQSSQSTS>ߗƴhޑ„j㻬n|өnO =~-FQPNNNMMMC*V应| VQPPQQSPNMNNMNKOONNOOPPPQQQSSUUH6 PϰbE6.?=UYgj_ 8NNKJJJIJ9P!/FDA>=>=899988;;9<9<=<;???P<9=<>CA/>;6. ,' .HHHJJJKA, D (747<<3Sv=8 WF|qVCn G `m]kjvhl]bږQVkjjgfZYrw?OI>hИ.?G;ā.61yv<ӂ [p\I>GGmyTVTӅ9&Iނl MŤWp㢈q{w|¦Ż̭к˺m2&;h}}|||}|||{ywtsrsqC.DQ6]仑TPDmGHHIHHIIIHJNMNOPTT&'YZWVWWWUUUUUTTUSSTSSTSSQPQQSPQSQQQAf𓜿ùn暚ʓ{xӫd~ڊq 䚜W6PPPPOMKMN?,_, 8TQQSTQQKKKMMNMNNNOPNOQQPQSTTTUUV<.(1Qݺk}쳑hJA11H ?PMKKKKHH4 GECC?A>><=<<<<===<=<>>AA>?>>ACCA>MPF$ 2\ HIIJK*  $84698=$Ax.7 hIS` D.T]r{f`kkhkj_gߐHTjhhffWQ{΃6NE;[݊8;A;nԂ./.~x;Ԅ2!jVT?,na19FHIJJIKKJJIKONOSU&'[YYWWVYVVTVTQTUTTTSTSSQSSPSSQQQTQSSF,>祝ȭs޹īt`魼Zʞ髏n/ 䲄4OONNNKJNMND+Sիx[1FPSQSPMKMNNMNONOPPPPPSSQSTSTTTTUVHD-!$Plά T>KMMKKJ,7 ,EEEFEDDC?>>>><?CDEDT>>]>  FU ?J4! jh-=('68<>FFx{4. [YD8 TxKHWgkkhj_xxE]hfeedVMxw8MG;ysٓ.??=hJ̄//.<و2. ?IUYgggFMffnZ/HJIJJJJIJMMONOPSH* YZWWVVVUVVTUVUTTSTSTTSPSQQPSSPQQQQQST,/Ђyłylிgל{rv Pr/OPOOMKNNJNN>3UƗxx /HTTQQONOMNNNNNNONOOPPPQSSSSSTSUUTUVM><&+<`ξ 8MKMKMII? [p8EEEFHHGFFEECCAAAACCA>AADDCCE?>>(E#  D  ;K >+,<=*4+=/>qq6D'I_ AjS1_ash]Ykt=gdedbbFPՄ7FC6_ߌ,?</6>WZ\_NVedfsgexT2HIIKIHIKNMMMOSSU([ZWYVUVVTVVVTUTTTSSUSTTTSSQSOPQQQSQQST+-ŬЍsڈ}nⲬm諙xㅏw.y#QONNMJKMKKKM4-Sի|( CUSSPNONONPNNOONNNQQQQSSTSSSTUTVVVWWZ\IE.18Mxôt { NNMMKJJ< MIEECEFT`fKKHGDDDCEACAAACDDCEC?<;81C D ' q &;2Vf44HT1Ud6A$46 |l(ۓTM?`hV=llmgGYda```S=ׅ.F;8֜6?IAeM݈,,&2ښ4AOPNE*7Ƒp?nt9 ۩] w}f~lxv__sy~{rʪŮGsFbwe];}}|||{{yyxxxwsrnr_UNKG67MSU>>Hadffhhgev-9JIKHIKKKNNNNQQH(ZZWYUVUUTUUUTTUTQSTVVSSSQSSPSQSQSSSQQTT9'̤rߙČy{íWשׁsvx\ ςN >>4 d (U -;t` &!Hb*(6=?9Uf;A$տ`nses#8?7bM ]Mbb``_`HEӅ4FA9˝91F8\N֜-(+=ڍ>4POM8 ;و2$ xݠ1 ѹm f{vvr\Wrxy~ήöēȳ¯ļ,2y -I}}|{x{|{yxxvqqnkd[WV_?;NUZYVY`dfgjhherY3HIJJGJKJJNNMPSV(([ZYYWWVUUVVUSTUTTSTVUTTUSTSTQ_TPQSSQQSSUAڅm諑lwگZÞ}w9S$?OMNMMNKIMJJK<' +迟? 3HPPNPPNOONPPNOPQNQQQSQSTUSUSUUUVYYWZ[]``be8`H*Ger[ .NONNKMJJIKIHIHFFDDDFGGJIGFEPECEEEC8#[b &CDCCE Ej | ANhTK( *p(U| 47+4Dp;=. xp]qf}ՏW>yxGd;AI`]]]\\AKv-CFIUrʈ39=CN_ч-$!9Չ.AOMM.,<}-x .˜yѥh ehw~`[ps~x¹̸´̸P¤Iʬ &W}}||{||{xvtsqpmhb`__kVUY_]_]adggjjhgftQ2GJJKJKNNKNQQSV($[YYWWUVUVUUTTSTTTSTTUTTSTTQTQSQTTSQQSSSSSGU뗚pȃ~m꯸vs靘s`bEy1QONNMKMJKJIJKIJ1nڼ}1(9EPPPNNPNPNOOOPQNPPSSQQSTTTTTTTVVUWZ[_``JZсW=\=p  POOKMKKIJJIGHIHFEDECDDDCDDFDDCFF3!'Y CCDDF* m 6' /KJH' JН~wUG.+646961s=K7 _}~N=ЇWTj/Q]h[ZZZDC1EAED\ʇ,4?=Obч(.(<׊3==NK8$4|* x 3ߣg {qxv~`[mtx}wŸĦɻż˹f8s߅ Ъ-s~}~~~|yxwsrqqplgeffb__``ba`pdfgjjjhhpw7GHKIKJNMMNOOQW1x1YWWVYWUVTUUUUUUTSSTTTUUSTTUSTTSSQTSQSQTTTQH,DéyˉÓjyì`sPt`sM9ONNNMMJKIJHHJIJ6!TΤaZVӇ,/*9Ί73NZ=.,ƞ<~̭ =γV ~gwtp]qw{~yκŻ¦óź\{ȎQ S²tF||{xvstrqplhkjhedefrddehfgjhjjfhtZ/HJJIKKKNOPQTV-/YYYYYVUUVUUUUTQTTUTSTUTTUTTSTSQTSQPQQQSSTSUT-6y唓jwڭSkCgkkx $OMMMKKJKIJJJIIJMA(7ٴJ =EQSPPNPPPOOOOOQPQOQTSSTSU`SVYVWZ]_(껴FdfqeK2 kNONNKJKJHJHGHGGGIGHGGGGEQEE' /2 HG4 J? 8JKH hMKUddbdsyD v#7(77;3MrQ(]l\T~Sq= !C[ZZZWVYEbtqԂ,A&,ˠ3~+ 3|+ 2Uj ~xvt_pqx|sɼκøʵʴóƺƾ\Ua(Ю/Z|}xwwwssrnllklgfhjhgffgjhkkjkhght91HKMKJKPNPQUV6x,ZYWVWVVTTTUTTUTTTTTUTTTTSTTSSQSSSQPQQ_QSTSSST3 ·lꪈ~tٰ\ۜxyOv}}w! 7NKMMMJKIJJIIHHHI;.e׸G ;EPPOOPQQOPPOPQQPQSQSTQSTTVWUY[[<ȳ_}[nK EPPMKKIKJJIHIGGUGGHFFEDEFFF  Y  3j !=< >H1Ma`aa`````vU1!j9;7(>-.3f`|]#6'OZWYYWVWNemNn'<4YTŁ*37>}Pˇ.*9Eב6MNKNKKKHIHGIIIJIJI7 զf& +7SSQQPOOOQPQSQQPSSQSQQTSWUWYF9έerNkYb &PNKNMJIKJJIGIHIHHHFFEFEFGG ' } 8JJ |N+CS__\\_]\]]_SWCg a\<8978!YֻskMV9 SJx 2EЅ qe|ΫS Y~yxrn`w{v}ĹεIJʺÓ̾ģ>t}}}y{xxxxwwvrrnmmjlllxllljkmxmkjjhwZ4HHKMMOPQQUV.l.YWVWVUTWTUUTTUSUTTSSTTTQSQTTTQSTQQQSQQQQPQQQTQSF#Hv|y֫aƓevlmrN$ONMJKJJJIGIIIIIHHHH<6 *жڅA 2EEOQQNQOSQQSTQQQQTTSUWVVM֯jEf\FW 8 PNNNKJKJKJKHJHGHGGGHGGHGEF < =  +( 3MJ6 HwJ79P]\\[_\][][]]`K6 6G<*;#$Gyd~xb{2 =y K˩> |kxxqbrt~xζ¹̶ʖźȼõ­ɺ\V~}~|yyx{yxxxtsqpnlmnmlllkllljk|kjhgtQ3IIMMNOOSUUU3g-YWWWUVVUTUTTSTTUSTTTUSTSSQQQSSTQSSQSSQOQQQQPSSQSSS8אĴqʁyx_h`w<`-NMJJJKIIIHHGHJHHGIGGHJ;.+DΦ_/ #9>SSSSSSTTSTTUUVW7`kW~?bVI WPNOKNJMMMKJHIHGIHHHHHHIII6 ~ ,3 2NO1 x`7;MZ\\[[[ZZ[[\Z\\_UD3ÅK;JK.f`xlΏj$ A]*WVVVVUCQOgװ>19,Q2Q(=.kt[b+J‚F{-1MJ3`fY px[x 8ʖ! f~xhwafy~vxƸлʺʺœƴĺĺʦ>w}|}|||{{xxtsqppnpqlpmlvfaMxmjPVx7MN[NQQTUW3a}-[YVVUUVTUTUTTSSSQQSQSTSSSSTSTQQQSQPQQSQQQSQQSQQQTSQ>멒|qƝl|bчhw~¤nk?MMKHIIJIHJIIGGHGHGGHHG73<(Oڹq6 $8JESUUUTTWTUD,לdr=``2b QONMMNMNJJKKKJIHJHHIHJIK<' js .>?* ar48F[ZZZZ[\ZZ[[[\[[\TA&{ٿDC[V DEm'7M;&A1UUUH?`G <+(2Y!?'4,{pP]&&\Gx(6KI'EtN gh_ >ȁ r~fgwstx{xɣô´ù¶öƵ¹´`P~}}}}|{{yxwtsqqqpmmmkMC{qkx}DQOOQQQTUn7_y-YWYUVUUTTTSUTSQTTSQQTSTTTTSSTSTPSQCH?GFESQSQSSQQSSQQ?#F⠙~{~xxq_vQ1NKJIJKJIJHIHGGGHGHGGFHI;J8< 3mټnG  +3HVVVVW!ƶȄmA]_E{ 1PPOKMNNKMJJKIJJIJIJKJ6 t 8?3 6x?2F[ZY[ZZZY[[YZZ[Y[\_H6fƞQ9KNE |CjY6=.IUI9s\ ߅#./OʩM2/98pCA$ttS[&AI=&/Gڜ1 SE A׾} /Ój`txvvgy}}x̰¶ȶȮ7`~}~~}|}{{xxxtsrqpnmkx7 jbYFQONSQQSTG3_}2VWWWVWUVTTTTQSSQQUSTTSTQTQSSTQSQQCCP<.-(.+;AEDTTSSQSTG3sj}hфjqtĩs|ڟ'/CNNJJJIHKHHIIGHHGHHGGHHGHJOO=#!A̻̓`> *4r׎e|p?[N6 h QPNOKMMNKMKMKKKMMNA( F= -C7 *ٓ >[ZZYZYZYZZ[[[[Y[ZZPK ھ[8A+/GѺӫrVAv1Kj'F?r TPPNNNONMNMOMMMN8$ #~ $D=- 1Ȱ{ HYZYYYZWZYZYYYZZY\aE6ڿH;KD s裩A!2CKQyaQ!+a,J- t'$.4,~v (34\g8/!+fOA-;I1kM} >EŎ bVߠJ w{vvvwvvy|vÝIJ<~}~~~~}{yyxwZJmaGTQOPOPPNQQQSTUJHIs+VVUUUWUTSTUSTQTSUSSQQSTTSSSQTTSS;aк`H8*+*,--+ھé|ďgˤs~|ntgj۠nn՘- DNNMJIIIJIHGGGHFH6EGFHFGGIKKJKKOF9*/Zɺ&*\+C?+C SONONNNNMONMO- CH 6D. dѢ]>~>4ZYZWWYYWYYZYYYJTD,~գW993 jȤ, -9Gr/WVVVVUTUTTUSQSSQTQSTTSSTTTSQQSSSxtexfvytxĸ´ŴïùóƴįƲ$k}y{}~~YMp}fGUSPJIJKNMNQOPQQUbYDIn+WWVUUUVUVTTSSSTTSPSQSSTSSSQTTSTT3mΌӴrb®ɨŎnqjvx|`|v˭}t 9NJJHJJHGGHHHHFEFHEFFGGHJKIJKNNOPPAA2$#7`ӼԒK# 8QOOPOO=& [# --,Sʺxjvsrnn_CCHYYZYWVWWYJIC.жl- !m# 4;;777<>AFHO IEC;-_Q3j; p6+A|(\sНUjx*/H9<Ѻ_dA s`ۭ[ Hs1qn{wdvxwvswy~{¶İŴijó˴-snx}|yHYsvSQ[TOKMKIIJKKPPPQPTVWW9Jq1YWUUVUUUUTQSTSQSSTTTSQSSSTSSSTQU4n9*=7Y̟̰ɓū{k{\_ebh[Ѝ겏{J +PKJIJHIGGGGFGGFFGGGFDFFIJHIJMNNNNNNNOEE6 9OvļeĦ隵 fTPQQ8 AP *-&1Sϸsssssrrprpp7ws.\\[[ZYYON>A۹p* ;뭍NT}ũVlp 1;878;<P`y|sn| & 4>, v $/.(Iÿb`nlkmnnnnnnpnJa`__POM=Gڶq nکlx`IE><9;989<>/ vNIG?&8[ќQ EQI3pe#ަ-7E9#JG+*y\{ YEﺎ bIޓSYytfvwwxjİȶį˻ĭ-fxqbhvHbfSAkYTNIHHGHHJKNNNPPQQSUVW[9?d3YYUVUUUTTSSUUTUGAGSTTTSQQPSPTSSS4xFZ;{MG7Fkh#,P+_೮ѓxmy`JTg[M 8MJHHGGGHFFFEDFFFDFFHHGFHIKMNMNOMNMNMOPQPQPPDC;8*ĘUd?hy6? sG( ;[ */1=x_]Yggjjggkkkjjkjk]?FTdbNK;Kնn +¦nn6GP8/1=-88;<*˵M]DDC34 FjW7xà'N>/&J8+p_t -v h\΁Jnjvex{w`y|vy¬ɴƲƼĶ81}hbjOEYU`PKGGFGHIIKKNNPPQSSUUWY[DEf2VWVWVWTTTSTQU8*D8#,ETTQQTSSQSSTS&=ASVY~ZAsۃ9[*d3чfگxxn~CExEZbp3 .>IIHGFGHFFFEFEDFFEGHGJIIJNMNMMMNMNNNNNNPNNPOQ.NԟeW7?-*  *1YVUUUUSNJF2+?.} CA??=>AADAC[Gs|; a +E`-<+ ߈Zˊ FC`Ȕ4 JIWUUVTOHIUHFFJHKKJMNNPPSPSSUVY[C3p3ZVVUVTUTTUSG\+TTSSSSQSPST&bfj3d&1\ MZYYYWWVVK_T7> 6{>A>>=<;(GTUQSQQOQSS'²խQp>d GWsD;]__IC̯˯ֻtks婣x====;OPE$= +?IjvZJFVTUTVUUVVUVVWUWZYZZ\\PJE739M`ЫUYݴɹyJkɜU 2&<;;;9<===;;21C 82>̅/.3#ۙmSԏ 9TUݫE (`bոs`}yepr{yxy{ndùθɶѩÿȳɹĵʺŴKaSKYV`]M6&W]HHHFGFHJHJIIKNNOMSQSQSTUTWW[E.`7YUUUUTTTUTT#p*TTQQQQPPSQ$ԟxYtA6גg׾ٙ\qT閚{ANwmyyh{I .3GFGHGFGGHGHFFHJKKMJMڎYTSSSSUTSTSTTUVVVTUVVGEMYWYYYWYYI?ZllΔ&ख़ *7;9;8889;><>CA2Ep# U+1#'p?pΫ. 8bDQ {Heyt[`xxtvxahòӺùùŻøʯ¶k8ZbUN9HUJIHIGGGJIIJKIJMNONNNQOQQQQSUTWZYI&V6WWUTUTSTSTT7D*SSTPSSPPQQ*̵²lƝnSE`{ЌF[~sJ?j AԹ|qh, *3HIIHHHJJKKYNMMNO7A\.QPNE֞Z$4FQQSQTQSTTUUTTIJDC6;6=;J`¶źw-AéF+?êm.8MWWWWWWWVWFJrbà d񭼸 ';869679799>>AAD<ʢ NJ/+My{Dƅ EGއ WOeԦdvnxr`qwsvxkpɺõ¶êµƵɳóòŬDCVVSOMKIHHHGFGIIJJJIINMMOOOMPPQSSQTSVWZ\I Z9VVVUUUPTTTTI*d2SSSQSQQPQQ*ʯϺʻŰųa`KKKPNNO;դ,EONO${x -DPPQSQQQTTHG98;77>D=NV`y߸׼7(ѯź[*Uɼò|88IVWVWWVVUUDAlntЬV 6[4<989677899==>C*7 CG7$x\4S #t1rr JљUxrpsvtvelr˹̵Şðª»2VUVTNKJIJHGGHJHHJIJJMKNNONQPQSQTQQUVUW[ZK _?VUTUTTTSUQTT3V4AUSSPQQQQQE ޿ʾ˩*VlmjµӦژIp7|wAK]r  ?p_sʚrO3  ( Ƣ/1>6,!->=6=/1.+24(66;KN]bgvȶѭC h£ƭr* &hޮȬC4HUVVUTTUTTJ;QwgÄ,6j ;Q91;77988887;CFF/lӇ t xlQaѲ8 18|`xvqm`stvwhZŵ²̴òŲЩe=FUUQK {ðJ +eœ\82HSTSQSTSSSS4=n|ˆ/ 9̺ʉjPQI?<9868(77<>PHCd V] 2`'ԍ r=\qllmpqttt`l©Ŷ³Ʈ{EKYTTOIIJIGGHIIIHIIIIIMJMMJNOOOOPQPQQSSTTTTWZZOK=UUUSTTQQQTUSQQSSQSTQPQPSQQQPQPPQ*޺ijeykȼy6gjĶμ2x׹{axüéDS2rxKAg_ NF,gѳ ( Ŋ}'D 1I`Ypxr`jnnqsddm´°˲ɺnVd[TQNJHJGHHHHIGIJJKJJKKMKMNNOQPPQQQQQSTTTTUVWZOPS#'=SKH?D6.-!$ (376CN?9&eįêv3 M躶ɸb1+FQQQQOQQOOPS7,Tɻt `Ϻ( 4Hyʬj Џ*=FA<9<979;?H6; ;$VH GNGIW{p_\lmmmqnr_϶ȵĶõȶ®ĹĵaxYC=aJHGGHIIIIJHIKJMKMNNMOPNP]OQQQQQQQTTTTTUUWYP F >wг SFWGC><;888>?>?AA>ACA>A>3Ţb$FDDFDFFGHIHIJJJJNON8!?аïq= .kꩄ{ *DCQONON[OMOQA36[|ѵ$ UƘS ,~tڼ2 ]eݬx;OMJDA=<;79?GU4T  U+x`Z`~m]Zjkjkklnqhɭ´ĩôäʹ¹JgnE9UUUQSQSQSPSPPPQPPQQPPPPPPPPOQOQF'ӻ̩Gyߚ=x~WU~Jy¶³/`κ>3|ųqK_ޓ??AA??=>??2 ;fsP$DECDEACFFFGFIIJI<16$<տ̰M'Oթȴ -ONMJNOMNON;4.`˿/ V` ڗvV ;x漌s/ _=NJF>><98;?Y4* tĉ?(xds+8g}hPeggtghgkalòƵȴի˹ݹ˵ƺqN_VE?A>>>>>>>?{fv֠+AA?CAAAACDDEG;( ,mþjgW뺩̯K ANKMMMNN<,1qƚ= Pѻj ڮgx ̥֘J 1-CMHEA><88>CG$`x GΥ6xas`qgqepefdVlfmðĶŴ˲žȩɹïZQVQNIGTHEFGHHHHHHIJJJKJKKNJKNPNPPPNPOSQQQQSPSQTTSUUYW[P QKVUQTQQSPQPQQQPPPPPOPNPPOPPPPPOPS/ڶӅf}Pk[smİЖ Ujſx[GZ{Oa[l~ީ{8 '674ACADA?>>>>?2 쐈?>>>>?ACA62 NѫyˬyJ,#1W/>D**//+Dt< \yʬv ٩`Ϊ|ԥ}Բd q{ OKHDA==69=CD8< 7٩t `׼Y/ATnaq`_`bdkgÙ궸ƿɹ¹E?QNIGFFEEGHGHTGJGIJJJJJKJJNJKNNONPNOQOQQQSSSPPSSSUUUVU[] `TWUTQSQSPQQPPPPQPPOONNMONOOOOPPPP2klgvyȾĺȯN_j`'baMUpmma;`jxݥwP+ *&34ACC7N< ->>???>>1/.# OճԹŤK* 2AMK=ʲYmM(kƴ~(|]İn yy#ݩ|Դt [k]  -4+6*#+&,  ?ڴٻQ4#/>JJKJJHJ9Ωl[ƿq(rNݼ` $Ԗv忩~+Ь~ֶx Tx׾r(4HFDE><;66;A*/] h .,!#(=JNOQT_eq¨ĩƯɺÞàʴyt>N x #424134?HJNQYevũߨ{ºȺĻĸ¬ėh8ENNJFFGEEEEHGFHHGGHIIK;KIJKJKJMKNNNMOONQPNPQPQSQQPQTUTTTUVY[ \++',84Yp[xӟw[˰椯`P1ʅZp丹b ɔJq˟Ž̫óövE*'2JHGHHIIJIIIHJKI6$ byqƮ׵P9϶U ;˅k̸3w4 ~{hʮp '+IGFC>>92C89+Ne 1/14//.2(?FJOYežȹźȶOD?MMHFFEFEFHGHHHTHGGIKIKJJIJKMMNMMMNMOPMPPPPSQQPPSQQQTUVTTVWY[ ӿn>,+-+,.4;8PONNOOMONNOONNNNNNOMNOPA47''&+4=Kbq{{dxearCPMl`{yھwUSȍnyb~>!K|se92((#277FEEEFFGFHHIIHHH-&-\x~ζnpwPѾOfľxʥr(+~é1 jq{!6HFE?=8222478ޔ /122/21-2/18CGNUfȥʟó˹μʺùé˜-!7IGFFFGFDGGGGGIHGHHIIIHJJJKKKKKKKNNNMPPPOOOOPOPQQSSSTTUSUUUWY_ ȭ]8+($'.428?ONNPONMNMNMMMMMNNNNOCA2;.(! ,=Kg~ː[2KS`V`QN~ftx 2}ɩ⓲fZՓ[HhrnPU޻>Fє1/21/1/12249CHSexіvmò̺ŵưMFSEFFFFCEFGGHGIHGIHGHIIHJJIJJKMNJMMMNMPOQPNOPPP]PQPPSQQSSQUUVYNĢ|E6.*&-1<9CAONMMNMNNNNNMNKMMOMN?C2.$#+6HQxy`\ZGWD`=Ss(<>;! 9xfʺxZ~sH{ߜ8v+vũʿM1 *1><>>=>?>>?A>CA>AAACF2*OwƮl]}gΩZxg;mS=}ьv־q >qî\QtU# HHFC>772./4J$/3211243312>/22#7>DSdxਪlnqٸõô}-GSFEFECDDGFGGEGIGIHHIIJIIJKKJKMKKNMNONNOOQQPOPOSQQQQTQSTTTUVWWY[ij~f41-&$18;CN?MMMKMMKJKJKKMNKKNMA921$*$(3FPwð|h\#=IIH96HyߓvѩteP{H\.4Etɵ `  +?=>;<9;<;<8998;;<>=<>?A?38m“pgگga[hnOk軚a,hn϶_ Wp`eqZ1w&GFEA=73-/.6E89E4/3213/31212122268?=><;89G89;<;;;;<88<-< .YѾnrֻ}gxƔڴxSWmΝxM O~Zj{ݺT= 8FFC>;72,/122642.22./2222/2124246<7`~xìĮ®ųĚȴįy2$9HSFFGGDAEFEFEGGHHGHHIHHJHIHGJJMNJNKKNKNNPNKNOQOOQPOQSPPSTQSSUUVWVWYˣ|n3(++.78=>JJJIMJKJJJKJKJ=M?873*#'&3HZs|#HGFGFFFFFI9# SïtkԇUJ`.eȣ˗Z 1<;=;=<;9<;;9;99;;<;!& Ag|̹~vtqtڸ{|trvjqSPyeʘw`ȌNtK7񳄯׭xMSs ;6/.-.-14>../,.223221232!43#=4}4$JJHEDDCCDFEEEFFGFFGHFGGHHHIJHIIKMHHMKJMKMNNNNMOOPPPPNPPPQQQQ]QQQUUTUUYZ!کmF(.'#43<3IIIIHIIHGGHIHII;?/.2!$*.ANax|ө*GGDFFFFEEEEFEEFEH* -xڼx¶쏇I1r³æp 'A<9<;<<-<>1/ ,Hpƾ¨rf]hxȴ~xԨrp­~w˼`H>wJӢyh΁pjKxиgY{v1FD=-./,++./.2=22333364*#Nxж̲h+4MHFEFFEADDFFFFFEHGFHHZHIJIIJJJJHHJKMIKMNKMNNKNNPOOPPQSQSQQSSQNSSTUTSUVY[æ~f2.+$/43>IGIIHFHIJIJJJKH<;71/*!*3.7\p`-EEEEFEFEEEDCDEFCEDCCF& Cxx9O< '  /Djs®Żvxqq̶p{sԹ`Yt۩|[\8n޴axnΩ]6[ϯl,MDA=<933-,/C---.-('8*+-A4.  'K{Ťxȶ´üƹƿqjpƣjh`n߾tsxѴpfwԸà|W`Ϧչ|\wv߶jTee2'4$4<=I=;;821,-*,*.-**&$!$9&$*'+-<262_ũƶ¤ôq~YKWNIFEEDDDCEFEFDFEEFEGHHHHIGIHIHUHJIIIJJJMKMNNKNNOPPNONOPPONQPOPQQQQQQTTUTVVWZ.nѬnE7/$/+(/76F3EDCEDCCACCCCCDCA??>?AAA>CA>>A??AA>?D. 4Y}̜ʶϴݾ˴²xad`l sdjjkӵyrq]xťpxЭʠ~alйü|fkڥfP[ƾx?$72413347;A=?>>=<<>?=>?2# ߸¹øn`UTexȟr[HGQ|Ƥwhãv~ȵ{hfxşnryg\xe9&442//12/.24;<;84/./.,&$;#7!/ $&!!'(N}˼Ÿq]7FDFCDCCEEEFEDFGDEFSFGEHGHHIGHIHHKHJVJJKMMMOOONNMNOPOPNPNQPPPPOPOPQTQQSSTUUVYZ+WڳxQ1-+('+E64ACA?>>>A?==><;9<>;<<>===<=>?=>>C4Iհȯſ©|~ʶyq_OFTeyƣxnxξy~Ùwj|nkk{llxF!84321312-1.//2!66877422-,+*'('$&'! ! $!# Y~ʸʫ²­ĺ³­~Zvt;2ECDDCCDECFFFDEGFEFGHGGGGFHGHHHHHKJIHIIIKMKNMOOO[NNNPOMQPPQNNONQSQQSQSQSTTUUVUW3V̯n2- (!3!2>>><=<;;<<<>/ þΰp, 2CTn~̾{rddhk||}ε~lbbvr`hrywl|nI+44332323/2/1///21/237C34//.*('$'$&&#!!!  . & Dtwlõϵĭ}QWA69DCCDC?CDDCDEEPFFFGHFGGFIGGIHIGHHIHJHHJIKJNMMNNNNNPPOPOPPPQPOQPNPSQQSQSSSTTUVUVY2U۾jM/'#+3$'&.<;<99;;;;<9<;8<=>ѻj# -'&# ;d|}xĶmdhgtƯhW_Sbjȩr`]akʫypm|b? 64313/3222/-.2.///-//1/34242>/-(&&'#$/!3, ,! 'MΚT F`N;ũ­ŵӶdWO12442/CDDCDDCEFEFFDFGGGFHGGGGGHGGGGJIHHUHHIJMMMNNNOMONPQQPPPQQQOQPQQOQQQQQSSSSSTVYC8ɪ{l4+, *(#,&<<<+<<<;8877687669;867E8776989$$ .?[r~~w}wx׾|pvhs}TNJIHTxԿ{f`h~|aJ+,66421.2./22./22//.21/-1./.-/.1.///?34/1.+,&'&!6 .* hp~`Oy_a1>8FE?CDCAAACDACACDFEDFFGEFFGFGHGHHFFGGGHHJGGHHJJKMNKJNNNNNOPOPOQNQQPPSSTTTQPSPSTTSUTSVWAݹ|[/$#+(7774487978863&7&766664667*9- .Ys}~xwwvqx|neY[WZfmvƬvmh`lxòj`J&!'464232E/11/2.///2/.///=2-,///./.-.///13/E//.8'''#=!!!/1,!';xQh[ `òkI4HFECCD?>>DCCDECDDDCFEDGFFFGGGGHHGIGGGGTGJHIGJHHHJIMONNNONNOPNPPPPSSQPOPQSQSSSQQQSSSUTUVWF*ݬpI. #!$(7$64444726444446474346477#/Fj}~~q}nhfpnqmmmnnqn~kttjjgtysxxƿpf`gk~h_?$!,64663/2/3/.2-../2/1211/..2=.///,//-.1.///-.//..21///2/1-///.,/11///.,-&('!!!, !.#!',lwGqdh8 Y-GFDAACAA>ACCAACDDECCDCFEFFEFGFFGFHGFFHIFGHGIIIJIKIKWJKKNNNPNNPPPPQPOQPPQQQQQSPPQTQQQQSTTSUYHƪxh.,4&42232331234368('$+9Y`xn~ssttnnwóxhaJ6' $+(3332222/.=.////././AA>C?C>?DDCCCEEFEEDFFGGIFGFGFGHHHDHHHIJJHIJJIJKNNONONNMNPNPPQPQPQTQSSQSSPSQTQQQQSSTVG|Q('321242/2324436&##  .AAACDAC?CCDFEDCDEDDFGGFHHGHHHFHGGGEHHIHJIIJJIIJJMJNKNPOPMNOOPPSPQQQOQQSPSQQTPQTSQTSUYF׵v7' #13221122244&!$ $/9CHVYWZ\[f]hjj```][WVH>8, &!*'&331/32/..2/2//.,,<1.-/--.-././/-,-.,//,.-;,?CA?DEAC?NCCDEDDEEFFFGGGEHGHTGGGHFGGGIHIIHKKJJJIKJKNMNPQPPOONNOQNQPPPOPQSPSSQQSSSUTTUVF Ĵwe&& #12#2322142463'78'( !$ #(&$&&64#32/2232111/2//.1.//..,-....,/.--/../-.-./.--,-./-+--///<;-..1///..1..-///./<1/,.->AK>C??ACACCCDDDEDFGEGGFFEGFFGFGHGGHHHFGGHHIJIKIKIMJWJKMKOPNPNNOPOOOOPQPQNQSSPQSPTQSUSUUW[ Ӥe?$#&&!22/22142/?3/23323222142332223122111////2/-../,<.,.-/-.....,/-,--.-/9,.-../-,,/<.//.-/--,,;./--,.,//--,-/1/.//./211--.-/..///-/D1.1.////./1/21#M}|eD2/C?>?A?A>>A?>AA?AACCDDFDEECFDFGFGEFFFFFFFFHHGGHIIHHIIHHJIKJKJKJMMKMNNNNONPNONPQQOOPPSQQSQQSTSTTQUVN ɳrF $!!///--.1/2//././1/1/.././/...1-.//..+-+,----/-.,*,+--+,++++++-,,+,-,--.-/+..-9,..,.-.,-/-/.--.-,/.,//..//////......1././/<---/2.//21.6#U|P19CA>A>A>>>?AA???CCC>DCCDCDADDEFEFFEFFEEFFGGFHHGHHIGHHHIHHJJJJKKKMKMMNNONNKMONNPOOPQPPOPQTQQTSQSSSUVWZ⼤eQ! 1////1./2,-.//1/.-,/1./---.-+-*-+-,--+-*--,++,-9--,-,,-.-+--+*,.,,+.*-,,-+-/-.-//.,-.--A/./-./1/..<21///...////---///1///2//.' Zx|gHNHDA>>?><>>>?CODAM?ADCCCCCCEDDCDFFFFFFFGFGEFGGHGIHIIIHGHJGIKKJJKKIMKNMNKMKMMMOONPNQQNNOOQQQQSTQQQSTVUVI עnD 1/-,--./+*,-,,-+,-.-.-+,-,,*+*,+-,+,,,*+,.*..--+*8+-,8-9,++,+-.,-*.-,,.,/1//++-,+././..,-,.,////,,/.1/,-/,//.,/./1./-./&9k}l|n`>MFA?==>?>>?A?>1OY?A?AACADCCDCCEEFEFFDEFFGFFHGFHGTHGHHGIHIJKHIJJHMJKMNNKOKONPNOOPOOPQQNNPQSQSSQQQQQSTVUVY ɤ\! -+,,+-.,--,9.-**+,,+-+***++(,,--.+++,,,++,,*--,-,,8,++.9-,,-//1.,,.9.---../-.--.-...-----/./..--,/...1.,,//1P{jy|kOEKF?><<>==;>AA>??AD??>CDA?AECCDCDEFEDEEEEFGGGGFGFFFFHHHHHIHWIIJHJJKKMKNONNKNNPOOPOOOPOPONQPPQQQPQPSSQUTUWK ྫྷsP ---+*,,+*+,-+,8****+'((+,-,(**+,-*-,-***++,-+*,.---*--..-.-+,.,,,,.,-../..+-+-/.--..-,,./,,9-//-./// WxseMQI3==;<==;<>?>>A>??>>A>CA?CCDCDCCDEFDCFFFDFEEGGFHDFFHFIHIHJKJJIVKKMNMKNMMNONNNNOPOSPNQPPOPNPQPQQSSTSSSSSVYK㸠sH /+,*+-++,+,,'+(+-**((,*+*(+,*-,-,,*,-...+,*8,..9,,++-+,,+,,+*-.,+*-.+-/..,,,--.-*+-+/,-+./-3]}}wdj]PF-=<=><>=>>>>??A>=K>AAA??AACEACEEEEEDEFEEFEEEFFFGGGFEGHJIHHKJJIHKIJNMKKKNNMNNPP\PPQQQC=FQNNOPPPOSPSSQTS`VWJڸt!  ,+*+++(,*(+,,++8+,*--*++,+,-.,.-+-*-++(+**,+***7+**,-++++-*9---**+-,--.-,,-.---,-//8n~hj}CE=;<<=<;<<>>=?=AAAA??AC>ACDAAACADFECADCDEFFGFGFFEGHFIHHHHHGJIJIJJKKMKMMMKOONNNNNSPQ=(?4EPOQPQSQQTTQTTVWWůsS ,,*--,+*7-,,+---,+,-+,,,-(,-(*7*7*-,+,+'*,+,++*++(,,+7,-8-,+,,+8+,+++,*,+-#St||vpa8F>;<9;9=<=><>>>??=AA>??AAA?ACD?CDADFCDEEEDDDEEFFGFGGGHGGHHGHJKJJHIJJJKKNNKMNNNNPPQQ8#yAI>EQQPQQQSTTQSUYYⰒe>   ,**,,,*(-.-,,,*(,--+*,++**-+7++(+,,+8(*,--,*+-+',',(**+,,,++-/#jxlx}jq~F(6?===<9;=<=<;=?A?>>?A>>>?C??CCA?CDDCADFEEDFFEFDFGGFGGHGHGIHHJIIIJJIIJKIJMNMZNPNOPQQG(}8PQSSQQQSSTTVVW$ˤ]#  .,+,+****+-,+,+-++(+-8+'+,+(+'77+*+,**(**+',,(6'*'+*>-**8+++-,-`~nn[P/-A>=<==;;<==<=;9?>>?=>???A??A?DCAA?ACEAFACDEFFDDGDFFFFGHGIHHHHJHIJKKKJJJKNNMONNKNQSQQ3S]6QQSPSQQSTSTVWI$xN +,*++*++(**+'++++'**(*',*',((**+(+*,'$4**8+,,+,*+,.+>w|srZP.C?<9<=<;=<;;=<=>===<<==>>K?A?A???C?>CCDCDFECCCECFGDFFFEEGFHGHFIHJIIIIIKIKKMNJNKNNNNOQSS;fTTQTTSQQSeUTVUW,y崘j* .-++**'7**++(6+**'(+*,*6**++,*('''*,*,(&(',+-2Uv~|vaF9D>><<=;999;9<<<<<>=>==<>=???=>>>????A?CCDCDDDDDEECCDFFEGFFGGHGGFIIJHIIHJJMKJIMJN=MONNOPST7`k;<==<><==>???K?A>?>?AM>ACEA?CDCDEDCFDEFGFHGGIHFGHHIIIJJJJKMJJKKNMMNOMNOQQH[FSQQQSTQSTSUUU1Z๤YN *(**('6(6*,'(*'*'6+(++*++'**+Fv}kx~w`;8E?><<9;;<=<;<<;==<=<,;J>>===K?=/AACCC?AAACDACDCCDDEDEECFFGHGHHHGGHUHJJIHIKKJKKJKNNKMPNNMPQPT 7>STQT|QSTTTTVV8Q٤\* *,(*,*(4((&**'+(+*'*+',*- >x~~txwZ-HD><9;<+;;9;<<8=;=>=<>=>>>>?CCCCADEACACFDDDDDEFFEHGIGHGHIIKIJJJMKJKMMMNONNO[NQQTp4TTUSTVTQTTSSUU=9ݴ{P   *((*(&''('+',+U|t{~xwlD=F>=;;<<<=;=<=>;<;==<=>====>>??=>=>>??>AACC?CACODECDEDDEEEFEEQFHHHHIFHGGIKGIIKKJMKMMKNMMNNNNPOQQ(x>TTSPSQSTSUTUTWE1ѭWF  *+***'*+!dxwxy\>HF>99;9<9>=<>><<>>><>==9==?>=?=?>?>>A?AAA>DA???ADDAECCFFDDFDGEHFGGHFHHIHHIIIIHIJMKJKKKNKNNOONNNNQ8QΨU.SSSSQPQQSTTTTUUD$ѝK,  *, r~vyfYKFC=<999;<<=<==>><>===<<==<===>=?>ACAAA>AC?CCCCCACCDDCDDEEEGFGEHGHHHHIIHHIIJIIJKKMJNKMNNPOOPNNNQQ3sdv+.HPSPPPSQQSSQTSTVJ ϼpWCf}wqk`VJ*.9989;=<=<=>?=>==>==?>===>=>>>?=AAC>?A>CDCDCCCACDDDDCEFDGGFGHGFHHHHHIKKIKHKJJMIKMMMNNOPONOPOPQF>><<>=><<>=>>??===?>AAAA??AAACDDACEECDDDEEDFFGFFEHGHHIHHJIIKJJJHIKIJKKNMMKPONNNPOPPQQ?99GHTTSUSSQQQPSSQSUUTTWI_~}xys`}`VI+.8689;;;<;<<>=>>J?>>=??==?<=?=>>?AC??AACACDAC?CECDCEEFFEEEFFFFHHGHGFJHIJHJJKKMKKKKNNKMKONNMNQPPPQSSPQSQSSSTQSSSPQQQQSQUQTVK lw|rs{xqd>(,9;988;<;;<=>>?>>K=>?>>==>A?><<=>>=><>>>>?CCCCCDCC?CACACDDDEDECCEFGFEFFGHHHHVJHJJHJJJMKJKMNMMKNNNOONOPQPQNOOOQSQQQQPSSSPQSPQQTTTTUW qy}|ysqh`8*+;;<99;;<;<==?>>>>A>>==>=AA>>>>==>A>>?==?>CCACACDDDDCADACEDDDEEFDFDGFGGHGIHHHJIIJHJJJJJKJMMMKNNKKNNNNNOPOQPQPQOPPQPSPSQPSQQSSQTTUTVW ~ytp~vqmhQ$  (#1===??Q>=??>>>?>>?AA?=J=>>>=><==>>CDCACCC?ACCCDCDECCDEEFDFFFGFHHGGHIIIIJHJHJJJJKJIKMKMMNMKNNOPONOQPOOQPPPQQSPQPPQQQSTSTUTUVJ xvy~vpkjÿ|G2  $,4AA??>CCAA>=A>>A?>AADCA?ADCAACCCAEEECDEEGEFFHEFGFHHJIIHGIHJHJIIKIIJKKKKKKMMMMNMOOOPNONPPQPSSQSQQQQTSTQSUTUVUVY x~v|~wrnlx̸r\!,-+C2C?????>CCA???AAEDCACDFFDFEDEEFDGFFFFGGGGGGIGHJHUHIIKIIJJKKMMJMKNMNNMNNMNPPPNNOQPQPQTSPSQSSTSSTSTVUVY tqvy{gpmqӶyh-$#4DCCAACDDDEFECDEDECEFEEEEDFGGGGFGHGGHFGHGHIIHIIJIIJKKKIKJMMKMNNONONNNOONOPPQQQSQQQ_SSSSQTQUTUUW y}x|{spl߯lWI'/;64FDDGGEEF6FFFFGGTHHGHFHHHHHHIJJIIJHJJJKJMJKKKNNNNNNNMMNOOPQQNPPSTQSQPQQTTUSSTSTUWVW6vx}|vtqѳPS((+8HHGE7GGHGHGHHHJIIIGIIIHHIJJWKINKKKMMMNOONMPNONNNNOPOOQOQQPPOQQQSTTQSQVUUVK9y{}}}xtqÔgSD (&349INtWV/84=F>DTSSSQSSTUTTTbVZ=/ӲPW4*('29AGIWW> ˘fNA endstream endobj 9 0 obj << /FL 1 /Type/ExtGState >> endobj 10 0 obj << /Width 466 /ColorSpace/DeviceGray /Height 525 /Subtype/Image /Type/XObject /Length 244650 /BitsPerComponent 8 >> stream ޟ_1/,$),9@OHZ^qC>Xp||runghfZkWOMHD76;),.12!.6IDWjg~r3Q_tvsvtoodmdXhRLWG??;?3/7)'.13@Xj},Wu~~~~}spppqkdh_]WYP@G;?,#'  *7CPjxXV}v~~~~~}~~|~~~}}~~}|~~}||~{{}|{||{}|}}p}~~~}rrhikoUV[VJ>L6'/  #';B@VX{gN}~|~|~}~~}}~~|}{}y|y{|}yy{{}|{}}||}}}|y}|{|}~{|}{{|}~{}||}quopocwYZPQHW=1,,),  #6BGdlu3~~~~~}}~}~~~~}}}|~}|xyyy|y{yyy{~}{y|{y}|yy|x{y||}|}|{}|||}}}{~~}}}}||}~~n~|rssmrhfhaZ]QXBD>7:.,.'$ !#:^5`gI~~~~~~}~~~}~}|~}{|}|y{yy{y{y}}~||{{|}|}x{}yy{{{{}||y|~}y~}{||{}||~}{~~{|y}~}|~|||y|||}|{}}~~}|~}}~~sspursao`[dUMDB6'$ :Gh[kc~~~~~|~}|}}~}}}}~}~~}~}|||}||y{y{yyxy{}|{}}~y|{|{y{|y{wx{{|{|{{{y{|{y||}}}|~||y{|ny}|{}||{}|y{x|{y}|y{y||y}|}||~}|{||y|{||}|}~||||{|}}}}~{}}o~odnoYZYH;1 2DYfUm~}~~}}}{|~{|~~~~~}}|}|{yy{yxxx{yy{{}y||{yyxx{{}||{{yy{{{{|x{yxxy}|}|{y}{|{||||||||~}y{{|x{|y{{yy|yyy{{|}y|}{{yy{yyy}y|y}{{yy{}x{y{|y|{xyy{y{{|~|{x{y|}|||{}yy{popg^dYTO>,/)'#  ,69GRO^l|Dr~~}~|}{|~}}|}}~{~}}}}}{{{|{yy{yy{{{|}y}}|{{{{{y{{y{|y|}y|}x{yyxx}||}||||yy}{y}{}{|}{yyyyyx{xyw|w{|x{yyxx||yy|yx{xxy|}{|{}||{}y{xyvyvx{xxxxx{wy|{yyxyx{xyxyxyxwxy{y{~{||y{}|}y}{yyprroikenjcZLTL>;;?5/ /B:57N]`r:}~~}|}|{}}}~~~~~~}}{{|{|{yx{x}y{{|||y}{|{y}{yyxy}y|y}}}|y{{|y|{|}}}|y{{y{{{|}|{yyyyxyxx{yyxx{x{y{||{{yyyy{wxwx{y{y{{y||{{ywyywwxy{yywwxx{xyyywxyyyxyyxxxwxwyyy{wxxxy{{{xyxw{xwxxwxy{xyy{ww{{{yy{yxxx{o|rtnggh]gRUWUDL7>2., #)5,J^[|2~~~{~~{|~}|}~}~ZYNBTaa}|{|{yyx{|{|y{}{|}|{{}|}|{{|}y|{}{y{{}|~}{||{{{~|}|y|{|{}{{y|{|y{yxwyx{xy{{{y{|{my|||ywxwxwxwy|{y{ywy}{xxyxw{xxwwwyywwwxxxyxxwxvywvxxxywyxx{{xxyyy|xy|yxxxxxwwxvvwxvyvvwyxxxxxwxyxwwxxwxyy{|{yy{xyx{yy|{|{o|oqpnjhiYc[POB;5)#!# '5BN]dn9}~}||||{|}}~}~{ȢRn}{}|wwxx{}||}|~}}||||{{|yy{{yy||{{y|{}{||}}||~|}||||{y{{|{{{y||wy{wxxyxxy{{xyyyy{xy{yvxywwwyyyyy{vxyy||xyxxxxwyywwwvxwxxxyywwxxwuvwwxwyxww{wxvyxxxxwwx{vxxwxwwxuuvxuvwuwyxwwxwuxxyxuwwwwwww{wwxuwxxyvxxwwyxwyxwvwuvvvvvtuwwjuvuststwwwxopjkafVUPXQD>>:;917,1/$3*/25BJPao{7w~~}}~~|~|{~}~|||}nV|}{{yy{y|~}~|}}|{|y{||{{|yy{|{yy{{{}|y}}{||{~{y|{}}xy{wyyxyywy{y{xxyyyyx{xyxxxyxxx{xwwwxxywwxyw}|xywxxwxxwwyxvwwwyvvxyywwwwvwuwvw{xy{xwxwuxyxxyxxxwxxvwwutuvwuvvwvwvxwvwvvvxwwxvwwxyuwxvvvxvvxywwwtvwvxvuwvvvttussssurhuuvussstwuuxwvvwwvwywwxy{{oylyyllmmmhfgcZ]^P`H@;55$ 1~~~|}}|}}}}~|}~}~}{}~RB|{x{yx{}}}}}||}|{y{{|}yyyx{{||}{y{}{|}|{|||{|}}}{{}y{{xx{ywyyxxxy{{wxy|y{y|{wyxyw{yxxxwyxxyxxyyx|{x{yvvvxwvwxywwwvxwwxwwyxwxwvxy{xxxywxwxwxxxxvvwyxwyvxywvvvuvvvwwwxxvxywvwwwyvwvwxwwwvxvxvwxvwwtvwvwwwuvvvvtsstttsstttutuustuvwwvwxwwwxuwxxyxyxlwwwxvvuwwwuwtuwtvuvvvxvmyogyejoZD W,~~~}~{|~~~~}}|~|~|G6|}|}{|{{|}}}{}}||}||{||}y|{yy{{|{x|}|}{}}y|}~}{{}~}}}{y|yyyyyyxyyy{x{yx|{y{xxyxxx|{wwwyyxwxxxxxyyy{{yywxvvvwwxwwwxwwxwwvxxxyxwxxyxwxyvwyxxyxwxxwvwwwxvywvxvvxvvxwvwxvwywwvxwywuyxwxwxuwwwwuwxwvvvvuvuxvuuwutusturtrrrtsutrsrsusuuutwvuuvwwvxyxwvxywvyyxxxwwvwvsutsstsrvusutuuwvvxuuywwo: ^~~~|{||}|}~y}}~}{{=G}|}{yyy}{}}~~}|||}{|}{{||y{yywy{{|}y{|y}||{}||y|}y|{}{|{wyxxxyxyy{x{{yy{wwyxyywyx{yxxxx{yxy{yxywyxyxxywwwxxwxxwvwxwxwxwxwwxuyvwxyywwwwywwxyxvwxxvvwvvxvvwvvuwuuxvwyxxyxyxxxxwywvwwvxxywxwwvwuuuxuuutuvuvtsvttsuttttstrstttrrqsstutuvwuxvwxwwwvuuuvvvuvvuwvuuttttttttuvvsstwvtwwwvwxwvxwxe/ ~~~~{||}}}|}|{}}}}~M@}|{}yy|||~}|~}~y|}{|||}|yy{|yyyy{{{}|}{|{y}}|{|}|}||{{y{y|yxyxywx{|yxy{xvy{ywxxwyyxyxxywxxyxyyvxwyxxyw{wxwwvwwvuwvwyuvxvvwxwywvwvwwykvvxxvyxww{wxvwwwwwxvwyxwvvwwwvwxyxwxwwxxwxxxxyxvxvtxwwvvvwwtvwsuxwvututusrsutrtttrsssssrrsstutuvtvxwwwuvtsvstvvvuwtwuvvvuvutuuussqtsssstvsutuvvuvvvvvuu; )|~~~}~~~~}}~}y|}}||}{{{}|jCcc}||{yy{}}o}y|}|{{|x|}}yy{{{y{{y{{{{y{||yyy{{|y}|y}}{|y{{{x{xwyw{{xyxvxywxyyxxwxxy{{ywxyyyxyxx{wxxwywyyyvxxwwwvuwwxxwyywwvwwvxvwuwyxwxxvwyyw{yxuvxxwxuxwvwxwxuvvvxxwyxyyyvvwwwuwyxvxxvwxvuwvutwvtvuwuuxuuswwuttsusqttqsusqsrrtsststvuswtwxwvvvutssstuwuutvsttwtwutsvtttsstssrusttsuvtuvvvwuutv~^ 1|~~~~~}}}}{}{}|}}|y|}}~ZXPLQ``[p}|{{}}{{~}}~}||{y|}{{||{wy|{x{|{|{{{}}yxy{{{y|y{|}y{|y{{|yxwxxw|yy{yxwwxxxxxvxxxyxxwwyyyxxxxwxwvxwwwyxyywxwwvxvwwyxwwywxwwvvwwwxvxvuuuwwxxyyxwvuwwxvvwwwvuvwwvwvxxxxyxyxwxwwuuvwwywvvvwxvvvvvwvvvwtvvuuttvvsttuutttqsttuststssttttrsvuvvwvvsvsssstuwutuuuuutvwsuwuvussvtrssqtvuwwtttuswwssttsZ ~~~|}~|{~{}}~~|}y{{}}{|~smko{y{x}y}}~}}}~||{~}|y|{y{{y{{{{yyy}|{xywx|yy{y{{||{yx{{y{xyy{yywwywwx{yyyyxywwwwwwxxwxwyyxxwyxyyyyxxxwxwwwwxyywwvwvvwxyvvvwxuwwwvwwyxywxxwvvvyxyvwywvwvwwvxvxvvuwwvwxyyyvwxyxwwxwvvxxxxwxuwvwvvwwuwwvwvvwuuttrsrttsststustuusttsrvtustsusuvvuvvvttststuvttvuttuvwuvtsuvstuvuttstrsuutsttutuvvttuu{Q y~~~|}~~~~~~{}{~}{{}{}}|}}{~~}{y|{{||}}~||}{}||{{{{yy{{{{y{yyww{yy{{x{{xx{}{{y{|yyyxyyy{xwwxvvw{xwx{xxvwwwxwxxxvxyxyyyvwwvwwwxwxwwxxxxywxxvwuvxuwvwxxyxwxwwwwvwwvvwxwyxxuwwwxwxwvxuxvvwwwwuvuxwyy{yxwyx{xxwyxvxvwwxyxwvwvvxwvwwwvvuvtvvsuustssuttsstuvtuuvvvtttwssstuututtvtutuutttsstvvvtttsstruvtuuwvsuuvsutrsttsssttrtutuuttuuut Z~{y~~|}~~~|}}|y{}{{y}|}{|}~}{|{y{}}y}}|||{~}|~|}|||}|x|{{{y|{y{yyyx{yyxy{yyy{|{{{{xxyy{wy{{yyxwyxyxxxyyxwxx{xxyxwvwywxwxywyxxyxwxxxxwxxuxxwwwvxxwwxvwwwwxwww{yywvyvvwxwwxwwywwtuvwwvxwuxxwwxyxxuxxyxywywvuvyxywvwwwvxywxxwwxwuttwuvtusutstutttsutvwyg[PO]^gfutvssssuuuusrvvtttsrstrtusssstutttuvtuttuuruussstsrrsusuussutssuusT11~|f}yx|{yy{y{~}y{y{{yy{||y}||{{{y{||}~|~}|~~~}}|}}}{{{yy{xy{{wy{|}{y{{{y{y{{{{||{{ywwxxxyx{vxxvwy{yxxwwyxyyyynyxxxxwyxuwwyx{{xwxwxxxxwwxxwxwvwxxwwvvwwwvwvyyxxxwvywywwxwxwxwwwxvwuvwwwwwwwvwwwxx{xwy{yyywyywywxxywxxwwxwxwwwxxxwwvuuuuuttutsruuussuuvvyj:xjH]ytruuusstIotvusrtrrquttutssqutruvvuuturtssrsrusstsvusutvstuusutvto$Z39!':G>DLBVBLUM[tvuuuwwuxwuwyyywwwwwwuxyx{{y{{yx|~~}~}~~}}}}}{{{{}||}|yy{|{k|xxxy{yyy||{{yxxyxwxxxxxwyywxx{xxw{ywxywxx{xxy{xxwxxxvyxwyy{vvwwwwywx{yywwvwwwwwwvxvxvwywxw{xxwwvxxwwwwvxxxwvwvwvwuwvvwvwvxxxvyywywxywywwyywxxuwvvx{wwvxuwxywuwwvusrsttussutuusuuwn:TUvttsvtstZqttvurrrprrsstsurtuusssuswuuvustqrssuuwuttuttsttuvwx)/BV6ojkq~trrqrsuwtuvwvvtutsthgqhssistvvtvuvkvvlvsraYruwy{l{}{}}y{{{y||{}||{{y|{yvvxyx{yywyxx{wxxwxwwxxwxxxyyyxyyywyxxyyyyxy{yyxxxy{xywyyxwxxxwxxxxvxxtvvwwwwyxyvwvwwwwxyxxwwxxvvwwvvwxxwvvvwuvwvvwuwxyxwvywxvwwwxyyywywxwvywwwyxxwvxvvxvwxxvtuussstuuuvtvvvtxwi=Gwtusvttsstrrturt~rrtrssssqsstrrttutvwvtuvrsrtstusuuvuswvtuutuxxvuRC2}ro}ywwyx{xxyyyxwwwwvuvutrrrsvtvuuuuvvvvvvhtqomHR`Yj_hYjNvwvlwxwxvuwvxxxyyy{y{xywy{{wxxxxxvxw{xxyywwwyyxxxwywxywyxyw{yx{yy{yy{x|yxw{y{xxyyyxyvwwwwyxxwxvwwwxxxyxxxwywwywywwwvxxwwwvuwutwvtuuxwxvxwwxxvvvuxywyxxxxvxwxwxwvyvxxxvuwwwwvwutuvvtutttttutuwlg.xttutvttssrrtsttrstsrrqrprtssususrusuuuvsut~trtuutvwvvuwwvvvvuywvwva!7~wxyyw{{xy{{{{{xy{|yyxyxxvwvuvwuusuvuwvwvvxvwvxvy{y{uT{y{xxyyyxuuusheee]t`sfijukwuvuvrcmZruuvw{yx{wwvwwxy{yvwv{xxvwwxyy{wwywyyxxyx|x{*?xxyx{{xwy|y{yxywxuxwvvxy{vxxxvxyxwxxxwxxywvwxxvvxuvvvwuvvuutuwwwvvwyww{wwxwxxwyy{yy{|xxwyxwvxwvvxwwvvvuvutututuvtustsstutvxumoRhtsuvtsutrsrrqrsssrssprqprsstsssstvvvtuutsrrrsssstuvvwvwvwvuvuxxuwvxB~~|{||{}y{x{{{y||yy|y{xyvwxvwtxvvhvwwvvvxxwyyxyyw{y|{xky~}|{}y}{ywvtuwwwvvuvvvvvvsrqn/Zoocgruw{xywuvuwxwxyvvwy{xwxxxvxyyywwxwyyx{yyxtVnyy{{{|yxwyxyxxwwvwvvwxwxx{xxxyxwwwyxyxxyyxwxwxwwxvwxvvuvwvwywwvxw{yyw{yyywyxxwx{y{yy{xxwxyxwvxvxwyxwxtttsuvtvutvtuttuutvuxvxrZBhwuvutqstrssrtsrttrstpqqortsrtssrtttvuwuurrtsrptsrtvuuvuutttvwwxvvf 1}~~~||~|x}|{yyx{||||yxyyyvvuuwwuxwwwvstwvxvwxywxyvwx{w{{|}{{|y}~~~|~|{}}y{{{xwwvyyxxxxwxwxwwwvus|yprtvvvuxwxxwxuwvvvyxxy{yxx{xwwyyxxuxxyxxoyywwvxxxwvwvwwwwyyyw{yxvyyyy{wyxwvyxuvwwvvvwvwvutvww{{xuuwx{{wxxxywyyxxyy|yxwyx{yvvxvtwywwxwvuwvuvvtutrtuwuutwuvwxxl=Byyxtrttstrsrrssssrrrrrqsprsst~rutuuvvvvurssrusruutuxxuvuuuuvuwvxo?=~~|~o|{vwx{||x|{yyyy{{xxwvvwvwuvvuwwwwvxyxyy{yyxyy{||||}y|}~~}~{||}}xyuxywyyyxwxxxwxvwvvtuuuvvxww{xxxywvwywxyv{yywyywyww|njkhXYXJQMXo}nlvwvxwxxxxxvyxy{yxxy{wxvxyxywxwuwvwuwwwwuyywvvtvwxyxwxy{xlxyyyxyywyxxvvvwxvwvvuvvvwuutvvwutsuuuuvvxxvxywva/fY}xxwutrtssstsqprtqsrrsssstrqrqtrtusuvssusutrsstttutuwvwwtutwsvvtvjL?y~~~~y{~~xvxy{yx{wyxxxyxwwvvwuxuwuwvvwvwxxxxxxx{x{{{yx|y|}|~~~}~|}y|||{yxvyyxwxyxwwxyywxx{xxwwwwxuwxv{|{y{xwxxywvwxwxwwv{jYOD76:?9IRQUUaavfggkj[Q=B235):=HYYsuvwxyxyy{{y{yy|y{{yxyxwxyvvvwwuwuvvuwywvwvwvtvvwwwxxxxyxxvwwtvvwvvuwvvuuuvtuuuuvuvtsuuwwvwxvwjN=1#$Pc~vtststsssstsssrtrrtssuttttsrttsttvuuuutssvvtstsd]fvuvvxxwvrsvvsuvuaLBy~~||y{{|}}www{yyxx{xywxxxvxyuvxwvtwvxwwx{wxy{{ywyy{||wy~~~}~~}}~|}}|{||{wywxwwwyw{{yxyyxw{wvvwwwwvxyxxy{{ywyxxxxyx{gUJ??BGIH^^j_^__ccVdecdecXeWYeehu}qdaHB/;7;DQinw~uwwyxyyyxwy{wxx{yxxxwwwxvwwvuwxvwwvsrqopppquuvuromo|uuuurttsutvvsttuustttuutwvwwtvwwuwwvtxwvvvxlw{x}xwsttsstrstttvtssqssstttvvtttuuvvutuusuututssuthuvuutuvvusuutuw`LX~~{|wy}~|{{x{xxy{wxxwwwwwvvxxyvwkxwtxywxxy{xyy{y||{y}|}jw}~~}~}}~{|~|yxw{{ywxwvwwxyyyxxvxxwwwuwyx|y{y{xywyxmiPJH>GD[^`k`dac`Uaeeeeqfvfvnrvwxu{l]YXNVYfw}xaT?CLDDPgu}wyxywxywxxwxxxwxyyxwvxuwvuwwwxvwqaoepeaefdq]aWDL:Xp]cfqgrrqpsrssssqrsqpqr|qs}ttuttuvtvvutvwvvtuuuttsssuustsstusstuttuvjvtvvxwuuuvvutuvrtvvuutusvw`evvuvwwvssuttwvwwYLiYfmlkhtfrsssix|~}{{|yyy{{vwvywvwyvvtvwwvwvwwwxywyyxxx{{|{|x|{{~~}{~}~~|~|{{|~y|{y||{xywxxwyw{wwyyuxxwiuywyx}{wwxyxxvtu~~mZMB>?H[]oltnjoaugoegphiigZjjYccNTOB>Zlyt}tmlnwnkTDQVpyeU??JCNQi|vyxy{yxywyxww{{xxwywwvvwxxwusquuuuu|rtrsursqpqrqqgfoaoYZWWYYZ``eeeccfoeoqpqq}rsss}|`ooopqppq{{rq|qo{s}uvvtvuutvvwvvwwttuutvutstvlwvvuvutuvtttvvtvvtgR [|yyxwtr_dW^_{}}|yyy{yyywxxxwvwywvvuvwwwvvxxwxvvvxwx{||}|}{|}|}||}}~~y}}|{}y||y}|yx{yw{{xxxwywwvvyo{jjwyxx|ywyxifVG^]_^ijk`H;DGLQMocfepvjy{mmlYfh[jlyyy[XPT^vonxwkQ?CYdPBLIRCVi{x{wwwyxxwyywyxyyywwxwvwvsruwwwvuuvwvwxuvtuwuvuuvwust}qssqs}rss}qpppoc`oapp`OncmnnWmcn_aYXOaom[VVZRV^lno|}}s}rqsst~~uts}}stttsrrtwvuuvvtvwuxtrssuvtuadBu}}|ux|~|}||xwyw{vwwvvxyuvvvwwvwxyxxwwvwwwxyx{x{|{{}}}}{~||}~|~{|||||}||{|{y{{{wxxxxxy{xvwvw{{xwwyy|vv{YDH?HZZZ^j^_dcmtytnv}feddYPYRkmmwkZwyomkkjmwmVMIDmoqoyo|mQ@DY|dLBPJH:Qkwwxyx{xwvywwxxxvxwwvvsexx{wxvwuxxvuxwvywvuwuvvwwwwwwwtuutuuuusvurrutssrq|oss}s|rr|r|q{qqpypoopoonmklkjYVZ_Y_c__camWnYn_ooqoomoosuvtvvtvuxwuvuuusuwutaTOu}{|~}}||m{~}{||{xyxvvxxwwxwvvxwuvvuvvywvxxwwyxx{||{{y{}|||~|~~}}|{|{}|}~{}|~|{yyxy|xw{wxwwwxyxwvvwyxxvwv{viM?DZ[gllghx]]kaaaeeeRYXOTTIWYYeamonmhWI3NPno{~ljknvnWLMVoookQHOq|oWI``@7Bjxywxyxwxwywxxwxwxus3y{{xwvwwxxvyuvxwvvtwwvyvwuuwxwuvvwwuttuttrsuttsqsrpatttd~ttsrrsprsppqqrrn{{{p~}oooooqqoonpo]l`mnm_UPM3615T>}suvuvtttuwtvtusututtcOPl}~~|~}n|{{y}y|xy{yywyvuwwwvuvwvvtvwwwvvwyyyywx{|x|||{|}|~}~~|y||~}}{||}}}{y|yxxyxyyvwuwxywuuuwwolZNT]^NJOMZOLNZP[Q_`cfgqrx~iRR][lnon^G1$ 6dmmm}[:/5Y{ywVB@jxTJ^^>,@hxxwwwwxwwxwwwwvtuwyyyxvw{wxxyyxwwxyyuxwwxvwwxwuwuuwtwtuttrtrtsrrsrtrsdvuuststuurursttrstrrppqqrrrpsqpprq}qrrrrqrqqoqrpxnmk{e^N qvvwvusstuuututuutuv`oYo~~~}}{y||{yyyywyvwxwvxvxwvvwuuwwwwvwwwvwywxyy{{{{{|}|||}~~}~|y}|{|{}|}|}y|{{yxyyywwyxvxxvwjWXQOPYMZZ_`~c`VVI@ONDT^[_T^[`QXG@?==/=oVBUŸyoc`m}fUB 3om`rO=ip}ZBHseBR_[:'Ivxxxxywxxyxywvvwvxxyyvxy{xyxxxxwwywuwxwyxwvvwxxvuvuvuttvttttrssrstsrtusrusuuuutrssssusqrqosrsrrrrqqrrrtsst~ssss}qrsroo{oovRu|_Q_uvxvuuutttvtuutusvuZQHs~}~~xxy{{xyyyyyywwxwxywxuvvwvvwxxwwyvwwyx{|x{{}||}}}~}}~|}~|||}||}{{|{~|{{y|n|{yy{uwywxwv{lYeT]]]YYZZZ^jsssqqr[ZYMLYlutiWM77 'apam|`R, avkYM BymUBXyeU^hN'cvvwyxxvwvyvsvxv{xuxxwwxxvxyywwwyxwwwwwvvvxwwxvvvutuvvttrrssrsusvuustttsrsstsussrttsr}qqrsssrsrrrtstusqrsrpsrsqrqqorqpok=kl]dtuwttsturstutrsututZqHn~~}}}wvy{yy{{{vxwxwvxuw{wuuwvwtvwwwvvwyxx{xxy{||}{||}}~~}}|}~}||}{{|||{{||y{{{moy{yvvxld``[JIHMZZ]^]^^_^TaRMCUGRkrqtݤsWJLV[k{ufX5 Holm|s_]5 B~|ooxW! /}|jLPgpVOm[/Gwwyywwwxuuw{ywyvjw{xwwuyy|y{{{w{{wwvywwwwwuvwwstutvtr~srstttuurtrttsttsrtrtstqrrrsrporsqsrtursrssrsutrssrrpqptqppprq|xwnoeetvvvstsusrruusstvuudPHk~~|~}wtwyx{yxxwxxwxuxyxwvxxuwxvvwwxxxxwwy|{xx{x|{~|||~~~}|}}|}{}|{}||{{|{xy{oo{{ywvwhYTOLIWWYdZn]l^^^]]][_`__acNMLXVWY`ULN?31O?,3xǿkgfuysYYG Ro]msda:'fyoxwe_ 2w}{YPGwdQ_lB #cvvxxyxxxyyywy^vyxy{wyyyy{yyyxxywwwxwvvwvuwuutvvtussssvttqftuurrustrsrstssttrrroqtrqssssqrtstusssrtsrrrpZoop}rqrsqsqppqrqettvtuuuuutttststuwhWPe~~}~{u]wywwwywxxywxvyyxwyywvxuwwwyxxwwywyyy{{|}{}|||{~}}~|}|||}{{||{|||{}y{y{yyojYUQ[[[YeJB?MJLLG[M[[QQ]R`adoy|~qC?BQRhkgWV> !vvifqs^[G;@61!>rukmxn`H5,9lk{/ aojPDgfNavL Rxxwwv{xv{xg|{yyyyw{{yyxyy{xyvxwxxvvwuuurvtuwtvtssswvt^gusqrsutsrustgurrtrsrrttsrstrtprssttsssqrqqrpqpprsppsqrsssqpr]~svttsvuttstsstsuuv`O^j}}}~wuvxuwyxyxxwwxwxxwxwvxwxwwxywy|{wyxx{{{{}}~}|{|{|~~}~}|~}||y{{{}}||}{y{xpmhOURHM=BPP]^kokaccdcdaaseddfddhjihGHiJo|hwq`YJQgiuugO 5ii|mp{H'*BRvy~hf_'Jju`$P~jP=gjN`}Z Uxjvyy{xywuyyyxyyy|{ywywy{{xxwyxvvvxvuuutsutuuuuttwvutussutvtsrttutuurssssustuusrqssrsrtsssssssssrrrqpssrqsrq}rtsrs`stvtttvutrtutttttvd`tc~}}~vwwgyxyw{xxyyyywwywwwwvx{xyyy{{{y{{{{xy{{}{{{}~}{~||}~}}}|}|{||{}y{y~lZPOIL_cdseggY[UiiYhkl}}~oogYZ^aB[T[`lZY]nqo]Xfyp>  tjjmwn_V ! iyu|io?jywwo#qyY>HuRax]/.Tsxxxyxxxxy{{yyywyyyxywwyywxywwywvvwuuuutuuvttrsuvuuuvvuutuuvwuuuususvtttstrrsutsusrsssstussrqrqtsppoqssrrugqarqoptftvtusrutsttrututuvviOn`~}~}}~|yuuvy{xvyywywvxwyxyxvvxyyyxx{|y|{{{{|yy{|||}}|{{{~}~}~}{{~~}{|y|{{y{wo]PCMWgj[W^Pfgpihmo~sϦsWRQXil`O7$/9jiTYwyn*  M~j{uX #|}jk  auye ,uV@L|PWZ '@dtvyxyywxy|{{y{yy{yxxx{wxwxywxwwvwwvuwuuvtvttututtuutuuvvxwvvwttrsvsuvutsststtvuvsvttsssrsssqsrrrrsrrqqqtprv~qqpppteqttsrpssuuvsvvttuvvcWui~~}}|vwxyyyw^xywyxxwwvwwvwwxwyywy{{x|{{||x|{{y{~}{|~}~~~}|{{|~}|}{{y~^PWOUfYMoto  ^:phgjrX= ?iPdxZ ! xj}~@ 2~}d 2x|O  u~`7LwJc67Jwyxyxxxyyy|wyyw{yy{wwwxwxxuvsuuxuvwwvuvtwuvuttuvvvuvvwwvuuttutuuuutuvuuttsvtustuustsssrssrrrrqqrqrqsqruuhtsqqqptqrsrsstsuuuuswtuttuu_Vu`}~~~}~xuwwwyxvwwwvxvxxwywwwyyyyy{{{{{}||y{{{}}y|||}|}|}}{~|y||{{|{vlQMGNTTdurnc[2 #)).!!1 W7o`! ^qllxcQ) !fYvx]  #irr  sxl }U!X7WoHf~ :qwwyxy{x{xyyxwwxyyywwyvvvvwvwvwxuuwutvxwuvvvvvuvvuuustuvtutustuuvtuusuuvttvvtrussspsrsrrsrrrrrsqsrssstrrrqrsZrrssstustwuuvutstuvgaja~|}|}{vtuwxyvwwywvwwwxwxwxwxyxyyyy{||{|||{{{}y{x||{{}~}{||{{{{||mgG73@krnJGV?TJR[ntuwxqovvowrphg_@.ojelis ! IskpM Bsf}|xY ! Njy/ ! ^o  G!!pX,XlHxy# :{xy{||{yyxx{|{y{wxwxywwwvtvvywxywuvvwvwwuwuvvwvxvuvutsuvuuuvtusuuttvusuwvwtvtttturssrqrrpqssprsrsrrttgttssrqvp|rttttuvvwxuuvvttuvjja~~~~~wvteuxxwwuvwxwxyvxvyxwxyy||{}|}~|y{{|{{yx{y{{{|||{{||{xyyhN=.5lwMTGRQJJG>,BLPg]IBYYffYgfHOL@MTcTH]xrUT@)#  irk~j2 rkxH ||^ ! H}p }B !!}O;okB~d Jw{{x}{{{yyy{yyxy{{xxywvwvvxxwyyywxwvvxxwywvwxwuwwvusuuvuvvrvuutuvuvututuuusttssurtpsqrqrrrts~ssstsststqqrt}dptturrtvwutvutvum{lV~}~~}~yvexvwuwywvxxywwwxyyxy{y{{|||~~{||}y{{y||{{|{{{||{|{vZ:25l}[HO?95,,2Wh{QmB5=?XuweH, $!! .~ln|wpB !ii{k  LrlyW  5|h 9o  N~o;BRVG jxy{|}}||{wyw{{xxxyyywxvuvwx{yyxuwuvvxwyyvuuvwwwxvvuvsutuuuuustvvtvvtstusstsuturtsttrrrrqsprsrqsuttuvtttssrsoWorstusrtvvwvtttvvue}sV~}}}xttvvwwxtxxwwxyxywy{y{yy|}}{||~}}|{{yy{y{y{{{|||{y{{xyk?/:[P>.117OkgQ  :v>goYTHffxqYI/*$$3323# omuo? Cm[|2 {myU! xtN LR `P=Oy;s ,}{yx{}{yyyyxxwwyxwxxwwvwyxy{ywvvwxxyxyyvuwxkxxvuwvtvvwuvvvutstuvssssttsttqstvssqqrrqqssrrssqrrssvvttusrq]ewvq|sr~stvvttssttnvU}}~{wvuxywwvuwyvwyy{{{{{|{{|}{~||}|~|}{}{{{y|{|{|{||{y{}[>9PP;.,IohN;?DOZcnwsowwtmsdVYX?GHJ`xYB; 3fwgGHLisi`P;GCCGBD73#fonyv) _mO svxI ! !{~  Y|9 *WCq]=X N{|}|{y{|yxyyyyxxywwwxwx|{{xyyyyxyw{xxywyyxyuvvtuwtuvwtuutuutstttstttrqtusqrqrrqqqqrrqqor}stttsuvtrrG__afhqy~wypq~ur|X}~~}}|vxwxxwxxw{{xxyyx|w{}||{|~~{{}}}}{{|{yy{}{x{|{{|xy}O2BgqC1'6rteXVHCGN6??55;26@7?=G6@;RQXhliuqgI@'pڸthB9VogG5>Umy_gmWTQORUTGD6':iqrra dmlq2 {}tM)3 Hryx  {a  =e:D?a6 #`y|}{y|{{yyyxwwvvwwxwxxy{yxxxw{xx{y{xxwxxxwwwvvuvvwxvvuuuuuursrstststuvtr~tsrsrrqsqrppdpnoppqrgtvvttqrB=R>3.6BWThYiggiHfioi]R~~~~~}~|wwvwxxwwxxxxyx{xy{{|xw|~}}}}|~}}}|}{y{{{yy}yyR9:seI.QyaUI.**/,@Wev}lVNM1>XYwugXRp{qgJ5Hw֚i=3;]vddk]NB*  /xlYhnrg@Oooh9$woywQHBVB/,ot[$* .O rD?Vc/o G{|}|}{{xyyxywyxxxwx{xyx|{yyyyxywyxyxwxwvwwvwwwvvvwuttusvtstsutusttsesqrqrssqsrq|qamrssuuwwrsqhfuhggggffWWNPODTOPlCJ}~xhvuwwuxxxw{{wwyyyyyyyy}}~~||{|yy|y|{xy}Z.Cv~`65HwdR@,/1Gh|gQM5) uf{x3 6DumJ,>ّlQT_|kiwsP;.YYB_qmxD*,wnWT|aYIDIr}yp,,BC9,2}xV;N?.tvl?DHJvqJ96a5 j{{{yxyxxywyxxw{ywxx{yyy{yw{{|{ywy{xwvuvvvvwvuvvtutsvwutvuvutstuusqZqroqsqsqrrqpqponpoqrtuwqs^Yoopyowmmwnm{umu~}YHJBD~~~}~~|tvwwwvwyxxxxxyxy{{yy||{||~}~|}}}||{{yyyxxZ1@oyP:LhwaB,Lh|; a /Ți@'*>WlW2 DavmH7ajJJvHc~qoqDVsa, gfkwY)CXI=Iqa>UG=BnpZ=DG9uWTY_/i =xyyxy|y{xxwvVwvyvwywxy{yx{yyyyyyxyywxxwvwvxwvuvvvtutuuuvutuvstttsrqqrrrsqssqtssrqqorsrrtvtutqlY~srrrs|rq|ppp|srs|]J=P~~~~~|uvvwwx{xxxxx{{{|y{|{}{|||~}~{|}|{{wwk;,ttD9Yr^^6B;iili9J !..@3B3B23,?: H̏O* $Bs}nQuɳtwp96oY3celxoeCm~}lα}yG]w. 35Y{yq`__ceosXMZOVoygeB,ry xy{}|{|yxgxvxxvx{{y{xxyyxy{{xxxxvwxvwxvwwvtvvtvtwuvttusvttttuvrtssssrrsqrqsqqrpqprrsqsttuur[RsrrssqstrsssttvrrpoV;I}~~}~{uuyxyww{wvx{x|{{y|{|{{}|}||~~|}}}|x{{yB)al;=[]L;.e| )cBPQP[fowvvviqppmnoourI* $I rcޑM 26awJH]Y_L`OB., 2guO3RtZ@s_uZn{Jl~nЌ ;/3BxQ;WMITrmMgeZqoyNCtRCR [y|y{y{{yxh{wxxyyxxyyw{|ywwwwxyxx{xwwwvvxvxvvuuwvuuvtwvuwuvuuuttssrssqsqqrsrsqrqp}rssqswutus`[{ttttsttutttusvvvttsR6=~}}|~yuvwxxw{{w{xy{{y{||}y}{}|||~~}~}}}|y{Y)QaH[gZ^5XlnJBRZ[QOD;G_=JQ_JTdegiYI9:).7/36!5NjrpD5=~q2'Wd; U?)Bki{̿׉!U`Jk3Mh]]OmeMhtrn> :! Gxyn|uCj~_DMmoUVD$m /{||y|yvxywywwwxxxx{xy{ywvyywyw{xvyyvwwuvxwwvwwwwvvvuwvxwtvvsvtttstsssrrsqrrqroprrrssuwwvtvo`svtwususvtttxwwxwvsY@@}}~~~|uwxxvxyxyy{{||}}|}{||{}|~|{}~~~}{{}6CuiOm^N2V]RYeVN9McftnX{ʯQ >[fY? C}9!7__U'3dM1y|,Zsm_PV{gJ! /BNUx]9:;3sv6,3/|n wZgI7>j/ k{y|{yxyyxxxxwywyw{{yywyyvwwwyy{yxyy{ywtvxwxvxvwwwuvvvxwwwwuwvvsttsstsqoqrsqqprsrsqsuxyxtuq_rstwxwvusutuvwwwxutQB=}~~}~~{kvy{vw|{yx{{{}~|}}{{|{}~}|}~}~~~|{yxW,^m[hO3BvxfeRTXYRjmjB ZD pߺiB'$/'?Z`L ;|,5?iL Lp//_U,`k>q}gxYrXȹux~=#:,)#J}wf7BPG;pqj̻ƙYOOxǩ]BU Yxy}|yxxxxxxxyvwyxxxwwwxwwxywxxyyy|y{xwxywwxwwvtwwwuwwvvwtvtvwutuuttuurrqrrsprpqrsssuuxwtsooruwxxuvsvuwxwuvwvvuH9=}~~svxxyy{y{y{y{{~~|{{{}}}~{~~~|~|yxu:DtglB)_veW@9:Wk{wf96'/NNILLIJI:3.B; Y{M3$5MeuB P!5Yc91#9^^.irmY# jnxd s^$?BC*6~lIB6 GMqui~HLGy3k 2|{{{yxy{{{xyxyvxutvyxvxvwwx{x{w|wxywwvwxxusxuwuvuwvvuvtvvtuuutsrsssqsppsqpsqsrstuvussx:mdsvwxwvvwwtsutuwvQB3~~}]^sutky{yxy{y}}||}~~||~~|{|}ywpg5jm]17oeC9?V{YDUCBPQ[][fZZfZZ[i``jqgQ' 2e 'jۏB)HfM~1$WnN/?iX,v|Lx$ ||{Zk Iv51HLM?2qm{MZYsUM7 HfROQ, /x{yxyxyxx{|ywxwytuuwxxxxyyyyy|{x{yyxxwuwxwuwvwwwvwwuvxvvvuvvttttussrrpssrqsqrrsstqsstsrq=xo~ww{xyxvuvwvtwwwttHP?x~~~|~yuvwxww{{yy|{}~{|}}|~|||}}~~|oo}{G`uo@JpoH5?csfUYZOQNMQa=Raakrw{{|nZ=#)2,D2/Tsp[9OnM'XeT Z$>jJ,x=rQ, =s}m Voxx1.'*|u^;TUTD@P}aJ.rl݈=@oLGMj7 ]x{{w{{yvwxwxwxvwxxvyyyxyx{y{|{xyxxxvvxyvuwwwuxvwwvvxvwuvuuwuuuuttsutsrrsqrtrrsstrtqqqIimwxyxwxwvuuwtxuuwttGT9}}~~~}wvxyywyxyx{|{{~{y|}}}}|~}scgY?|u65^~_@=_geVdXdggfhwiv}tomndP'ê~rq>CWVN' .|J,RoG Bh3]Y:|w PmL2 9D NuC y^ *,[{eBLWUVCVh};$kT*{$UmJPJ Xyyy{{lwwwyywxxyxywwxy|{yy{yyyxyvwujwwtvxvwwxvwvuwvvvvvwvsvuuuuhtttttsr~srrqsrrsrtsq>h^otwyyyxxvwuvvwxxvuuZM*w~~~}}~}xxxxwxyy{{yy{|{}y}|{}}} [aavB6[mQJa}}fgYYghgjjjryf^] cPD^B1DXY>O,>ko=?3UQ/dp)ZrG? D3D!! {^ Gow=*6*7nRLZXZN{IYP7]|ZjI`2Wc{>{ 9xyxy|{yxwy{yxwwxx{wxy{yy||ywxwvwxvwwuuvvwxvwwxwwwuvwvwvwuuvtvtusttssstrsrrutrsrrstrCogopsxwxwtwyxwuvvvvteUc9|}~||~~|xwyyy|{|{wwx{}}|}}|~~}~~~Z{Z]{^L]_^_mrfdYefjkks{dgW9aG2NWBY^c`iaQNN, ؙ`)! 6WjY# `*,OaO*s!Bf`3x@$je7 D/># >m; ,{G.962|mRJ[Q#57OkXP?}oQ]`9IX,p 6yyyyywxyyxx{yxyw{ww{yyy{ywxwvuvvvxwwwuvxxwuwvvuvvwuwvvutvwvvutuvusrtssrususrstsrq|ItZk{rwwvxxuxwxtvxutwukUڿ~M?U,}}}}~~~~yw{w|w{xxxx{{|}~{}}|~}~BsaqG]__cdndedoouiqigVN9LU^^[]^^nm^i`asdd|sh[/ U9nt[) BdY3 Of39WY1_$@oQ3Dwfo9 ?U !r^ m{{`3=B?au]GVg2xv9|.~2y:C9Q3 r{y{{{yyyyxyx{{yyyyyyxxyyuywvvwvxvuwvvxwwvwwwvwwtvuwvtuuwwvvtuwuutrstvvsutstsrrssrIoQ{pqvwwvvxuxwwvutvwn^˿ì6 ;@L]|#~|}|{~}}xyy{yy{{|{xy{|{{}|}|}|~}}oirO^__dddceosocWpfUMefgfenaTPaoo~ux~y{qZB ':BJ:VQND?kG#$aY7 Y?:O]2B.JoT:u`n =)3)Ux|12op5:C=Trh]))w!2d*i=! mxyy|wy{{x{{{xxwxywxxwywvywuwwtuuvtxwxwvvyxuwwwvwtvututvtvuuuuustuutuvttstqrss}RtYlpptuxxxwywuuvtwwjlTƿǹN#;GUTXGRO>IB:>)JO^w,~~~}}wy|x|y{}{{xw{|{}~{{{}|}ohaQ[`ccffgsdVRUcggttgffgpwu~qiiaaU`[C,иuefVcICdeN 3X):dY2#B#N[3DoXwCT9,5!,,269:*kL#nm?=BBJY~P r5 qa[?! [wyyx{|{|xy|y{{xyyvxwxyuxwvwuvvvwvxwwywwvwuvuvvuvtuvwuvvtustrsuuttuussrrrsoYqXjorqtuvwywyxwvvvvuwy]ȽİW Y9IDYUMRWmrq]RPJr '~}~~}yxy{xy{y|y{yyy}{}yx|||{oePRk`TdgtoWdWfnnfigeef|crqGYg }i9~x? =JYN )c,QaDOf9Xe.:Y*YcLL7u]//::;99=#kx~d)!a}H>DD mT[ujj#^>!k>,nVoĶNc: Vwxyy{yy{{}}||yxyyyyvxxyxxwwwtwvvvwxwvywuxwvvttvwxvsuwvsuuvwttuvutuutuuuttsqsrsxV{Yunqrsuwwy{vxywuwwvw{Z¹Ȼȫ{2Y/7BPHMMG=BBLCo #~|xxx{{|xxxy{yy{|}}}{x{yvUJ`acerscWaaofgncdy} `xMLpMXm $);# 5lq |ؔW. #TaM@#GY]@['Qc@B39}`3,~q|=.;=7;>1#9~n{.$!GsY'PR~H/]Z!`?.},Qo̵MV: U}y{{}{y|}|}|xx{{xvyvyxyxwvwvvxwwvwwvywvvuwuwtwvvtuvutvtsuvttuuwxittvvtrsssstoTYvyettwwwvywwvwvwwwuyqĦ@.IcPWWUR?1VOH^g.wvmosyxy||x|xy{yyy{|}|{|{Z@a`_deecceooff{ a 3gD#[I9J,,3351!'/5 O BgR 2'La:1W)O^$J QiY; 2mZ !;*;=??,,k6';:d]o2wB@[dv@YQ'~},LlUGC Dy{|||{||}||xxy|xy{vvwwwvvxwvvwwwvxwwwwvwuxtvxvvuuvtuusutsuuusvyxuttvuttssstXVjqrsvyyywwxyvxvxvwvwvaƿظM*@BRPPQ#::,uP]g{yyy{{y{{{||y{|}||iDc^]amaUcdytscp_^.?>[[g__omml{nZGBe2hH,CeW V,2[@'g^/[L3Ul#piMc !2^{p|./>=?BB._mX* ^=sOl*oMZIQU~Gn,?eŶc=V @xy|x|{|}}{y{y|yy{vvwwywwwwxvwmywywyuuvvxwvuvwwxusvutuutuuuvvuvw{wvuwttruruUYmprsvyy{xxwwwwxxxww{Z >dĊ 2P^  '9xfRYq{{x|y{yx{y}}{}y|{xQU^_`aaacpsaNCC:CO__topq`aaa___^[YZ[^_JM@B6**3BJPPO:2OGWQ>#$QiL Qp,)]R1N'JU6l'1oe6 ?/2@mC #9/1Bs^T3$iPr=s7wZORT7g},GUf/W ?y|||{{|y|yxyx{yywvwwwwvxwxw~ro{wvuvwvvtwxyvvuuwuvuustvvvvvvv{|uvxutstutuqZrTmsvxyyxvxwwx{w{xwxl̻[U /Xo !! $dq||{{y{|{y|{{y{xYN^Nakaass`QHQ^^aorprgqkaso]op`l~d_fiir~yWogB!#  IfJPX?WP91RI6Wsh$ 9,[R#^CBVH2ahU_ 9DG3.e|kmv raBJn^hW3qG]mRf:Vx3X *{}{||}|{|{wxxw{wuwwvvwwyplxvvwitwvyxwwvwwvwuvuuvvwvwuy|vwvstuvtpQfZwtwyxw{{xuvyxx{yxyfu2ɫc x cp}y}{{{{{{|||xQ_Hn__`_N^OI]^cyoetk^ge@[ ~[Zo,  #t{tc9*GYdV1 ,i)3UkC |12^P9u1>dN@3BtuT :DGH76,n qGZ??1_R!=pLW|J_t;Tk2X O||}}{y{yw{y{xxxuxvxvwopwvtvvvxxxuwuvxtuvuxvwuwvxutx}xwuututtWgYo~vwx{{{xwvw{x{ywlxH! >j~}}{yyy}{y{{mdD^_^]]O_J``~w_odl Q{6h x]ZrB /257?# W{NJc )Vqc7 $N$9WL Y2'WT,x|$ZaMU^|.=GGJ, h`ZW|/2Cel ,uIimUcsIHj'Y 3y|}}{x|{yxx{{|xxyvvuxw}xwvssvwxwvxuvwwtwvvvwxwxwwutwy|jsttrvw_mZortxyxyxxwx{yyvyyom#x6}}}}|x|{{{{wjCRnOZQ^`otutiWW,.J#7V v lrdkI .126=, g# |U :lrV h7@QY B:6gP?R3p[95Ij,1HJ. =B9BD}R/hBra 1{:mkWgnMRd.Y 6{{}y|xx{xyxy|yuywvwx{~~tsvuvuwwyvxwvvvvxuvvvxwwwutyyxtvuvuuxp}mprvwyyxwwwxyxwwvxy{#u.q}~|x{x{|yjRk^_P_d{iiW P#5QY ~ /{]MY7//36; 5BHU Yqi,q*,]^1J.^JD/Bnc9q:,:1 ^*Q'M e?ro ;rBW,pYUC`;W ,yy|{|{yyy{|y{{wvxxvmOOCcn~tvwxxwwwwuuvvvuwutvwvvswwy{xuvtstvxooapsvxyxywvvuvvtwvvvg x2j~}}y{yyOd_PIdtpd,y_]QyIQ }a i1~@a> .256:1 M)nm3 Ir^) C*I_'71Ie?Gx$gaJs2{U!$ eG$TC $H]J[vMZ6V 'y|||||{xyyyxxyvxy~i:x ttuxxvvwwvwwwvvttuwvvvvtuuvvvwuurvvtWnnoswx{yxvuuuvvtwvvy$*7~}{{{|wleaUMoygXgo{ ~Vd o` 5u$B 76:,1 N d`, ^L?B,W[3YQ.]PDq2Bqk2 puk ^kr )faBeUP Jg=W?R =x{{||y{|||y{yvstw{{L^ylI otyywxvuxvwwwwtvwuxuvvsutuvvuuttuwuUkmptvyvxwwwvxwvtxv]#'H5~}}{|{[U:LuuGgi.Pwu jx9Q Io']Ld#2*$31:>D>~w* ,vd7$B6XV7dB2dV3xlkR 9r{ HI7 #3hQ HiQH5PrCWHR >{{}|{{yyyyyxq^NO^vyu 3]H wyxxxwwvwvuusutwsvtsuuvwtuwutwvuZjXrsfwxywwxvvxtvvuwug{_UMr||{ypT=DjggDjDDwx [wwN 5X='#2?:PR]diortvx{{hY= :dH}v NnPt71^Y2s*I]YB,Bim6 91yo|~)?]Y)uR_]*#J:¥P7P ?yyy||y{yyyuon]jswyV|:C{2 /ywwxwwvwvsvvvvvuutuvutvutvustuv|RUrsvvxwxxxuvvwvuuvvvc{sPhq}{x[6Qjk~6hY$s)In_c]CRY]_]lmupt|~wdeNQQX`lmk_YWT79 ,YC ZU*Y.DqCMU!jcJp'rB TR6_nwC ,*~YXd!dnPu$@,àLg: @{{{}||{}vrrponovv}} V?n xwwwwwkxuwuwvvtwwxuvuuuuttututjmhvvyxyxxwywwwwwxj wnV^Za|{`7G~]n{q#qu!odLO_V`ckxy~y|pxohikfkLGugPD2'CX`gmkhfL) 7v Jc7X/Bg=G1@oc>;Unk TQQ2Bc$ *!QHt:W:}#)oQ6ҏBi, Ry{{|}|}wrepoqsY}aC [ yvuwxwxwuuwsvwvuuwwuvutttuvtsstqRluxvvwywxxyxwtwwwwv 7s}xpB=_mpquy qnRIJa`cuslc`/;pMth sVaNM32?Wdo[M3 Pc.Yp,UdVYoioQ;7v3 RPRQ;uQ{? 6|!,]OwvR= Yg.}1 Y{|}~|~h[wyZvhN owwyuuwvuuuuwvuuvuxvxtusvvtwvuutiiouxwwwwxy{ywvwuvvvux 2q~W>l^Uph wg {qLBDWhyaRgr jW uZk ,᪀B=3;XqrJ 5 Yg/^R/ZTBQnjBw= RRQPO/B)hO$3x* |kOaf${1>DC{!p f{}}~}{k`~Bl7*x ox{xwuwuxvvtuvwwtuvxwtwuvvvvsuvsu@Zotuyyxw{xxywwwtvwwuwx /y~~~}o9TtVXpsrygUDRTTrkLfc a /u 1r/XR[iimsysheG$ *Dcoۑg3;Bdom7  df.j,GdYGk1o{9 ^q =QPNO,'#Y~]*kO}t*.qj,Nr h5`:Qff m||fnq劄lOM 3i{}}{wxywwvwvuwuwvuwuuuvvxuvtsuwutuxOinqu{xwxyxyvtvvvxxv ?o~}U3iMlrtpw;jmgOLVes=WR 1OZ__^^``aeennefhlc]MPRJ[YaZ[c^]QMMD2e]1,NpmC _^*u'fRM^nti:=L6BOQQ' R:GLZf [3$!X^cm*|Q _ y{mhUq_ t~ oohpxyxxxkxvxxwwuwvuwxwvvvrttvvwv~Rgotxwv{|{xx{wxyxxwwx{{ Yt~}}q5Pk[H~cp{Q9`JOf^RwD ~u3 hcVWRdgikdreg[NR7D25/7:@N;NMUQ7 o3Mhh;  ,iT)=?pdGR;w.u5e>;TT3 cHdQ2# M )?>Md[ L |~oXpa=q^wUt|xyvxwyxvwwwvwtvuwtwuwvtuuwutu~OWyvyxyyyy{{x{xyyx{| Zg~n.gZYwaogQPM~kTZ vrkgWdU[l|qXR uW|dTB.$Q[_iMf,*Ong2 fe ]k@R*leX#x@u;LG,  iPlP  5 }9m',p7ȓQ2wI *}}n^tqs_n~w|wVhxxuwwxwyxvvuvwvuuuwvwwvutvuxwuu~Riovwxyxy{{}yyx{wyxx}}| hj;LihYjndkkC=dYhO N`VLZklYPD?d]N$.13'Z aT۱̓d776cmo= 7*5RqM 1* `_/:HliD[ly,326# yBl^ !p' QmIQ=ۂ>`w* 6yylwI1{tTeYoyywvyvvywxxxwxxvwwvuvvutvuwuuvGgnuyy{x|{|{{{wyx{}}|~ odt,uZhfy^`gC>g|Y7Ot~mYNTYtjHBRedwtUn )*13#UR H)ғT).COmP v^Lsg /oO;*wdRNG)aJ 9jG .i3#~?/#w ;,n$~,y G}w}rmcDe[t9qO}o|xxxywuxwxxwywxxxwuwxwvvtvutu]Z`u{y{x}{}{}{{{|~ZoPf;mhjfwUkkQ:ixBv2k_@ILvN:WfqsC6X|rG )'),/39>V ;!م;/YxX #1hs9Z mh5TvtW 5 Yq, CX` ;LY aGyq Y7fQVv ;vxlc~owQffktYZyq{yyvxwwvwxyxyvw{xxwxxvvwwtutuwuuwZkntw||xy{|}}}}y{}{}}ucRUVjkkfpLD=hgYQ} fTINmmZMZn~ x cg] *),,13Y R .@!Bm}O'O'ipC 7oY3cDv9nM ?Wqn 'DZY U9iMlL =fx wH~ 3duttfo=Yg|_U_]e|{{yyxyvxyxxwxxvxwwyvywwxxusswwwuvZjlcwyy{}}|}||{{mu_^~In^kig|@{g:WOwi6TTL^UBshd f kC~ )*).,/YY ' BP=y]'fyMfiq9oU#`k YM>xn/g v2oR!fd 1o GC>XRV9svtttm|Raejyy{xxxyxxxyyxxyxxxwxwywwwxwvuvwuwutq[hl}{{{{~}}{}}}}}}}dVMW{gggT_BHX` }ah>Ynj Qk s32?)CfD $'*,..> U 5 ~*$k~RRc,eq> 3o^aUd9Og JXLGpo!tT@#OTc g NXY ?;93ej9 XsxxxvgheUs~[{|{wvxvy{xw{yw{wyxwy{{{vxxwvvwuvxv}mnlqwx{y}}}~y}{}}~}}qsu?pX~gYouI@V}l'Wog?H|rY;#| ah | Yoj ,  ; I 1 v`Ne,)c3ky7!Zrr)i>t,s6$ XTTXGyY 6x*rg3;>qB 6 #'~ **fG[  $vud[vQxyx{ywwxx{yxxywywwxynofwxyxwxwvvvvvvww}nnoowvm{y|}{}}~lho{elXixU7i[I{^ vPLpMso }T s l3s =B_[gglvso^G2 #,Mm/!/rj77U$kt76 YQ{?$ DWCUX,oN $#T|}ml g d BCq#{ P T  Xrtss^JQ_xByywyywxxwy{wyxxyyww{Y>Xyyyxwyxtuwwtwwus`vnsxBj|y}{{|{||}}sjt]nXgqHI{YUleGVWxDq uo{ y,3J9at^YRhh_RVWBHLMJZIW?/.9/1D6>CP@LGPOaVoG1Z{I$P=e^/=rsM _j BWVTTV.^ 6yRZ} $O) :VM G@ 9O u,inBxyyw{{{|xyyww{xxv{xlXx|y{yyvxvwvwvrTjnt[r~~|{y|y}}sw}]chgYJWj~iYgTnMm_ Tl eg {pCB/'7C[nvpkl][HD9:,DVWYdeQ,r9$lx>71[X#` u/,^|w ^$LWUVU*J , ' , C2s? G,:  DV_oBPs/f9 awn_?y{yy{{yyy{|yyxxxywwyyrGdwy{|{xyvvwwwwxw|Wilrsoy{|||}{qj}UoYiRkoTlP~k@lj i[?#y,> ~dR>$!Ba|c5J / ŪW_|V91Jcla? lO,nx:;~'yw2I m=P?> {GCVUU? ' |s v,lN JH)V {! =vGjYC}y{{{x{yy{|xyxy{wyyxyojnx{xyyxyyxvvxyyvw~amoqt#yxw~}|}}mr}cpihPwX_^TiUU]pgIjpx yu nBMLwc7 1!Y ްl7!2?mtg1 >B'se9OLMl* YY){2BYX!>  u VH] /o n cc̚oLNdT U@ r NU|n~|{{{|yy{{{|xy{{xyxxy{{wyxyxxxyxwxy{vwvsq`r*yx{}~|||qd~Y_jYUyYV|uYLmo?` `u qi>':V{Ys_ ,,,,Z#a ψ=!/VauB C37w^7 mX;@i|5ʼn@BY$B a$B2!l Q@ vc` r;J c>=X ,cglj~~||{|{y||y{|y{ymyyxywxxyxw{yyxywvwwyxwvwt`poynyxy{|{|me ]^lJllNjm~MWk_l1gY~>yND^.,hfL_h #''*)?# e U*?srL NPwT2RLf#e6 ,>}IO!B  )GOy B@ rtiMV^؏ D,*v,tH2v r}}|yy{yyx|||xy|{yywyy{ywy{|{yyx{ywvw{wwwwvtdopw~yyy{y{|}q^ fYlNoQ'~~YjBoriM|qp {{65Opcr .r1#'*7)'ZZ Mt6)Rq77kfyPguLVv/ 3 m}L ? j U= It p >hIG#M, 9[ x6 |}}y|yxxxyy||{yyxw{yyxww{yxx{yyxxxxwxxywtwuqpquxyyyyyyxymm rgY~mMVhYOQUgOX wm h'hxe3a^X $'***Ld# Pk@YO Ir).chD `35kD=ODo6 {$!? Ru~7Bl!#Y5~ j ?t5!n X ,s u~I6) Q{{|||~~ywyyyx|{x{{xx{yyxxxyxxwyxxvwyxxxy{yxvuupppu,{y|yy{{|ih penm^fR$h6j}Vh {iOUkt,Yi$5{]uB{ jMp'*)$,*RX' ).]rx5UoocgP':H$7v[$CWjPWs|;~ |mV GH`ZW'g:9@QG G^UŅ qBf@Q{ ] p2:1 _Yo {y{{~}}{xyxy{{x|yx{{y{ywyyxwvvxywwvwwwy{wwwvsrpuuB||{y}|~{RNksY}aYU9!lC`s_ oV ^=17R ~ f]J7)*),L a$ Heoqx]oqrtshT5[3)mc,?V3|Q?._l= u$7pV YJXs2;JYW.u [$O7.5 >QLs :]Hn BJN= ,y{yy|{{y|}|x{xy{y{{xyyywxyxxxwyyxy{wwywwxxurprtQ~yy{y|}~pWGBvYn[aH5BkLJaZ>tmll9'N Xh GUrl**,,,, H Uow~xof]porsstsmM?'[f95*phTYo!, k.TgQ XUBDtV;~r{C#h N) 1urC7BuX5  Uy{yxyy|}|{{y|{{xy{ywy{yxwywwyyxxy{xxvxyxxurftxxv6|{{y{{|~pOXjVnQCu D]vZQi Rky|,lsnx i ~ efH )). G 7OZ`kjsltnR? ;NRVVj]}`opsrqrqts`3}C[a:BROfHs9 kNiZy YUR@Dw qy B B.nn $Z ` c#Px ϨBd̜Vcy  ty{ywyy|}{{|{yy{{y}ywxxxy{xxyywyyxyyyxvwwwuu]uw{tMx||{|{{|~~q. ~YkUnUo]Z1olO9^7ZV} nO j^~ d ke.R{m *DYndhd_WJYZZOQUdWMHCBBHXYmvmtsjXTsWcpq{||psqrY7o;i`?d)~{T ^`| {MgQ WWPPGBd 9 } 26q!g } GY*MJ dOP Z3}= #yy{y{|}xy}}|x|{y|yyxxkwywwxw{xyxxw{xxvyxyyw_sxy|{|}|{y{{}t: cjIpRxB t^eDmqo vX{Do$Ia^vd*wfw n ^. /Ykh_XBCYkpm[NWPo~mQ_coqqqq`@^73nU>{/a~NU=o@ fefCXRR>Dj  U MԢ | =Xg ,# ]fMJ6MJ! Bxxxx|||~~||{x{}ywyyxwyy{yy{y|yy~{wyyy{vyfuw|{xy{}y}|}y{}|5#hq_MoYs{#noJ/_tJ,@,~uHn h iTJ`^V^RBD^oJ5 . kTV^^^moovYQRno]^nopqpvNk#Y|UCX1Bw.3 u :wet,XWTTQ,| y 9.} M ;Ȋ :o [КBvP )h~ _دJjl  owyy|||y}}{{{|{||{wyyxyxy|{yxw{yy|wxw{wyve{{||{{|}{|{x{{{}q?dBvmNpZaI$}W|WD`v.siwNi gJ#yU w)`B5B`_ !!V# CBjxjihjjjnnrtso`onlcprcNh{g?]|X/ MnGMXWURa'p Z,q ,)lH6Hށ }$9hNI_ d, `9q6xwyx}|{|}}y}yy{yw{yxxxvyyyyy|{|yyx{|yxxytofvyy}{|}{~}||xy|~~s2 |YUo`Ior/yUYT;]tUQpv_5t j id$oR.TgP  *P)YUZhgjjkjijkl_Oofsrrs|oNVxnmpxL26m: il |6 7ZRDVWG^3TC1mG M Yp 3o57 ,R2 UB,  Tvxw{}y}|{||{{y{xxwxyyyy{yxyy{x|xx{yyywxpmdwy|}|||{~~~}yx}}}}p, oWoaX|M7]:`?_lBue12_ wB6wU*}R3@hq/ Z@?kegggfhhghijkmjaaZtrsrqpqoPUnoeNG ZQB9Nfv3 } dHYXV$WL, c 1 ` /qQPy |ƛ@ v ;@mY wtvw{}}{{}}yx|{{yxyx{yxyyy|||x{yxyyx{{wjtlU~y}~}}y}|~x}}|})3asX`]rZo1j@e|^:|_ ^/jpV)Ot o iGf{Y **,@$ Vlrfgfghihhijlkkklid~rpqspoooPcXhY$|=v7#wB s'MTMI Nr R ,O >)H>Lv QBf 5Cẽ >? J,̀, $ww|{||||}{|{y{{y|xy{xy{{yy{xxxxyx|wukGUv{}{}}~}|}|{|{}{}}t9yaIe}O)mC@_?_mD^cRs t>?se1N3Z7o,W !),,.] Hm^dgiijijhjjhjkjjld[posppprropsqqraVlU)B lgR 6/tM _M=ةIMM)NG k r T 6  h/I gO 1Hy $Xwx|{|||y~{||{{yywyy{yy{}}yyy{{vy{{yyoYn{}~}~~~|}}|}|~}q7 f2`oo?opOlml;_ C:[mY `{ m|@9hoc, `B ,,,/.B) _s]_cghhsijijjjiihiVjQoooppqsqroqruuvstYoa.5T3~2 BL[U~ BZgީGTQ: ?*f eã n 3R]̋ ^ j [?jV{wy|{}{|}~}{{{x{{{{xwy{xx{y||{xywyx{y{oloy}~~~{|}|{~~3*qr2iuY#pB1OH{`t'T?Diq }p?)P1Qr * $>DI2C>/T `o]`_cfhhjiijkikjijjQPmlooqrrrprqssuwxwxvwili.,uT Je[R@' jL o c 7 ~ h I 1D=Z  )j>] eD.., :y{||}~}|~|y{{{|y{{yy|y{xy{{{wu{{w{{xoL`y}|}}~~~}~~~~},x*vsV}=YeI_)wciq tk ]x~ YpTeD=.@M=Wu{O//13I eo]_`ccurskjjjjsjjhjrDPklwooqqppstssuvw{yx}|k9Wc/C2GmB oRYOTWw Osu,1Q| /oB O  y g d ^Gq_  oxx{|{{}}}||}{}|{{{}|y{{y{{{yxxxy{y{woLns}}~}~|}}}}~~s. :YojOtaXH6vNPya$|_a>ep ouH.BBkG=@B[sw{qf, )/Y mt[hn`a`nfphfoooohwgpZ6^mlolmmnorsstuvxx{yyq]Oh>/*5;ZiP[sDy T:sIcR P a f =G6r B` C;̈/vw{{}~|~}~}{{y|yy|{yxwxyy{wxwx{yxxyvq]ouy}}|}}}}|~~|}}q6,oUsXuLOgj@T_qX3dh pg XC.{VOdsusyDW2 '!**,1V!kiY]MGN]O^^^^_^OPMJJCXIZwn}nollnpsrvvwxwy{nVI^^:T [3[YiNOo [[Ph o Q Oё U GU$i*G! TB; =Cy  Vwy{}}|}}{|{{|{{|{{yy{yyxxxx{{{yytqqovy|{~~}~}|~u:eX^dYYgaUV@h[iBBcqc'ux #B:L,VljiylP k}O#)),.T! 9UolcZNUVVccccWIB9:@@Lgvgsox]^gOklmnnoonpqtuvxyyy{|y_^P2ha7l3YtBN]j{QQ Y YYDNl D  a P2 Y ) ^܀$., fLW$ wxy}{}}}}|~|y}|{|{{y{myyxxx{|}}x{yeav{{~|}~~~n/ r;gQ{Y??BqOclD*?m7 *V_d;>WdP;e_wBY ~n XB*)),/5[ 7fliVLZ]cr}|vkPUM]oliUMjku|mpruvw|}y}{rX$7pW6e;CPhjl`@,y XXWZDgw R ~ M N pݗ > t>Y cG@$ 9~wy{~~~}~}|{{y|}y|y{x{vy{{{yyy|x|wurp}y~|~~~~}~}~n;oR.sarW3C:jo;aX)f^rc B@=I`njBg`X{ io;; ]R** $)GkcVZathhfYWQVQWZik_lmnnmo}w|ieGR^wZTYklyqsuwy|}{{~d;!lrJ[>RZY_q,U XWHX7BoN 2 v= µ Z  #WTHC U XCsj  lwy|}}~}~}{|{x}|}{{{{ywyy{|y{w{}yxsofx}}~~}}}}~u1 6pNe>f [ILZf6v X >Q_qssyd:|o[nG s ZH*,1 #VqWYPweNWQefWededcaedijjklnmwnnoo_}q~oJHYgY^oyrwyy{}|p:C.|j6pHaN^WO)2YUWWV/n*Ut /$_ @ ǃ !ZUG' M_ U6̔$yy|||}~}|~{|y{{y||xy|}yy{|y|}{wmow~~|}~}~|~}}~n9@fpPoUw6$XG9];oUZQqhsxgJDHg6ho lncBV1 BgWOam Lceoceffecodcddghgilklkmmnnoa_ooy~RHJx]Wmorvxy~}Q!mpZDokMYM' t@CMURRT#x O͕ V 9mڸ T;.l;3? V UҺDovt$ Zwxy~||{}{}|}{|{y{{}{||{||y{yxxrBo}|{}}}~~}~|}s):]pC]X ^:HJLi ?[o}|wT},6[ts ]lG,p f }f@ HfYcT  `sceddfefgfdfdecfeghiiilnlwona]Zpoqonoo^5imkaostv{cMa@n99YkLo?, ^YNXRTR yi C | ;6? ]IBN ԛ ]=Տ)xy}|}|~}}}}}{|{{yx}{||{||xy{{vrUny~~}~~~~~}~s; uQ/CB#DB$/oNQcr{g5h^{6vt qm `u} J)9,Pj]sj ![aeoddefeggegedfffpfjjjkmlmnokfZopropoorq~~]Uwoa`rtv{qPr{XcBWo@y2 X]gITUWs$j @ J O h P p R acOZ ŜNQ~ , Vx{||{|}~{}~|{y{{yx}|y}|y{{x{yyxtoouy}~~~}}|}|s) u`Q*} M5?oPhlTvxel$gx [qdun> Z[OJw9! *$$!Uujdccdcdeefgfhgghffgfiwjikmomnm]}ZooqrppqqpqqrpoWydatw{JH@x3c:` lmC`DVV}B@ B ~6 L 3wPjU. ZB̐B'{{{}}|}}~~|y|y{}y|}}}}|yx{wwxyoduy||~}}~}}~~, M_W[? $1 2reV? fi:tx o^ [ ykoNNi V$$!*}g`acedddfpghgigigeegfefgkikmmmkY`opprporssrqqqpr||`orgcayH> ]?D=UU uO .i 3f Jkp2ڢ =ZfX; Dx{}~~|}~{|}~}|||~}|{{{{yyxunouy}|}~~}~|v,} a`>oIU QoCHG{ojB m /adH?ssx=6o lmT![IDp !6J,)')xc]]_``dacofgggfhghegeffgqhijllljpioorqprostsrtsssrsrsfqs_=,dZ`> =:o:hYCJ x L] T$ CCGQUa U ^ BnNɎLqxy|}}}||}}~~~}~|~}|}|{||xywyutcavyy}~~}~{|s, }{U/rh/HQ@io9[/Or sYVsO _j6; ^U;uo ./H/$ lhXYZ]___`cegpgfgffgeofdgfhfjjkhkj]}dopqq~srtrrqsttuvussuZgwT7[Ov2 : |$>'7eN p1d m # iH o ] m^W_OJXI:]=!/{{|}~}|}{|}|~~}}|}~yy|{|{xyvllpwyy{~~}}}}}s3Z)oW?Tn! #9ff>k[fo#h T.WNpWnfsn ii9Cjw; ,,./3R2*,.lXYY[[][^_`a{fdnnecncc`ddamneothqlqWooosttstussqqrvuwwvvxv[^pB13 9e[Yx c1N {#6P _ ? 5eWu37W j:m55`HR' oyx|~~}y~|~~~}}}~~|||yyyxyxq`lpuyy}{}|~~~|~}s, aqOlaZ}B_Mxw.m N$`B IVBgR| [gf{jBIw/,,,.19:3, vaYYYYXY[]Z[Q_P^P`Q`U_``]]]QOGQJTMirqooqqsurusrsurswvuy|{|ywtR~w>X :{7*I. ?otQ `  TW B[_ ' BIN5Չ,hg?=`I ,6xy~y|~}~~}~~~}}}}{y|y|wx}Xlsxy{{{}~}}~o}3)|yTR:tpO,psV~,:e P}|g` o^ Y[,ohdVB)*,//3P;2/ DsYZYYYXYZZ[^MOGHIRXYeYXODJBLMQhhqgfZafX_m}~{qsttttvvuvw|}}}ywtff,uT9D2h BMG.je q # ́ ,`l  ? ^}7CI!=jVa) _w{|}|}}~~~~~{y{}}{y{v]k}wy|x{}}~}}~}~~|}s3XpTT]2/BsC:n_oL v [gG6oo nNO?L*,**/216X9!/ qe[[Y[[NB67Vgvm_TMn}miIT_oxrttstuvwxx||o{g osX9Xxps.NU#6x B,f޺ 2 J *k !ҭQ5Q9ov;/h>̛ #.{{||~~}~~~~~}}}{}{}y|yyvmXsvxxyy}}}||~~}{|. _^NTYTf]odUd >L> { wZ ogW6Nomx `63,/.22:@X5 Ct[^]@C>jvePGHQRZgZYZhQYUV[kmodOUk|kQRlotvswvxyy}}~|^ p}B BZ}wiUphԈL YJ,e_ D Y D#$ L3 BRiJRJ'D}UX ; hyw{~~}~~~|~{}|||wxwomqxxx|{}|}}|}{}sme/2wn w*weRcs {}CBops s_HJ5`i |Z>/',,./Y@$.k[72OlYL7DO^ZY^__cdaedgfeggiilm_~}oUW{jjDnstvky|||}}` C6#]vo .^|GQU h3i ZYGP~ ] mԮ Ά @ 9|OȀ6I9xsC/jB՜ ,.y|~~~~}~}~}~{{{y_mswyyyx}~~~|}|~s* [d]aq9x * G:Y v jXYoGNj {B/17,*),.29C*L]X>OjPGLPYXX[]ZXY[]`aadddgggfhjhjjU_oopxTNvnkY_p~y~}~~~~k 3J1$kU:DGHDD5$= Ż BeqL'Y!f,]YL7cߪ 9 5Y L nf  B ]pQ>@)Li=țC* oy|}~}~}}~~}}}|y{{Vltxw{y{|}}{}~~~o./fvxuC`9u #1siv6w.lQwUo2pl oe9ow=@ d}B2').2BOfGOmVHd``^[[YZ[YYYZYX]^__dddeeeghggiWVloopppopaoocZrv|||~~a =BB@6,CvX,163C5BBBB5#N{ϱX!)/$ nN /Qmq.1@G[YWI,fO C k* p ,Tˎ 6 UY 3h£Y,.C~=2yG֘.#}y|}~}}|~}~~py{}yVlty{}||y|{|}~|v*,_W9VW@ :hs:UkL$WB|v6Odwd,yY?qu` ho yY*1)*,#Z_VpaZfec``ak]_[[[[ZZYYWZ^^_aacfdfggfgh]w^lnmoooqroo{ppq`ptx|~|]s]G.## >qn?>?N?>.766* JoۮX$6HGHLMXN9lg *XČB﬇ ,YVXW;> T/Y ̔$ë I f?a{@,UrNͣQ. p{|}}~~~~~{}{{mn{|}y}{{||||}~o!gX,QNj|v dy 7ZnCtsB| qY gfBroD~Q*H7., HU;dljN[[fgffdcnca`j^^]YZYYZYYOo^_`mdedfghgfTxVlonmxmoppoprqreqdct{y~VήoIMI?',,7,=:B!Plԭ_,,;6776:1`mJ>PQVUUDJ5MwW `C?m@YYWWV*o ,5 3 e 3  OW?a͜)R=$;C@tC̍ P *y|~}~~~}{~}~}}y{YYv|}{}yx{y{{~}~}}v3fo==lNe$g cx rd9`yZRrd99eo k?GinL> ]15 ,_Ie[ 5leefggpgfcda`^_`_]ZZ[ZZZx__^``dcdddgpNxUmmlnomoooqoqtsu~[n{prsx}Z3fخscI?# ,PҦX;=CG;B='..Or#/==OOBRITP}xJYYXډT,L^XYXWTM=^3By Y = Q {ϗ5 Uo,`2eB2`_GG* _xxy}~}}~}~}}|~}}{yn_|}~}{{{|y|{{~~{l, q|mjp_ ^[7'xGD3w@M Z _PyX#Z _f iw th! ZWUk#alephrhghfgcaa_^`^][[[[YN[_[]__aacdedfVyQklvnmllomorqqtu~sTqqtimk;wJϽ?ԤHd^1)*,D`=CDDRBTL=dv^PZrnpkfZYYYVTVDX 9 /]X W  # VY 7nѤ:fB5LnpP^sY /9yy~||}|~~~~}}}~}|||y_o|~{{{{|||y|}|~}}~r,{I:JaoB51h a=s }9`5u ?g oUyIJ pR T ? 7TCr3 /@#oqgqgjiigiieedcca__^]^][[[[^^][_`^ccfdRwPlllljklonnpqqrusuuu}YscNtM/HVµpn.]BB55B@MJ/OsPUUyfng[XVXa`THMe.qn_ZI$ Q#! 7YN !,q d'ٕ/WWGm>q=cYM@!, nw{}|||{}|~}~~||}}~|{ycc}{}{{{y}|{~|}}~o, ZoT{W2OhM kuL_.P$ ieodD}{fvic#PR9ge3??,seghiiiihjiifccaaa`^^^][]PZLOGMHNO_`dcgZkklklknlnnpoqppsvuur^oL3/w[|XVkȜfYC* H~QLI^ІcgMURVUUTIP wGyqo}{kij]X_:7)* 2 )Mkۅ.~ #yNQ 9hҤ9YB5aDmhjj * :y{y}|~~~~}|~||xQd}{{y|{}||}~~v*Y{eoUB }a .5/}6MX5? ORf7{},Ypj,V l{GHX PG?>>/rffgijhhhhjgfm`q`^[]_eNcdXdcadosrda`^L:BhWgijkjvnmnmooonqptuuutuucyaC1Hyh]M̿YGٮTmotWTIs{IWRRTRVW_:Q$vootk|uhW6oihgohj]BWWB>.' 56O=`x ¹r5ޝ: _i/dMa;M/D*J y|}}~}~~~}~}}{Yo|}~|{{y|||}}}~~}o @@I6 iVj;n }L69 9m dZpBwy lVev vj l*[  o3@>@;|dfhikghgipfUT>9$.9=ZjssgQNHWfimjYY[hhkulklonnmoporrtttv{phBTmȿ.VvMC}Ⱦ'Ԑ*RWaf@P@QQB*R P`YYPUNeadiXs,ynlrhjk^MNxomltttmDOD #Hrl:B*Yq)P~ͱ:oLBN#`Qq > Dx}~~~}~}|Wpwy}}~|}}}{y{|}~~~$DcoXp@BG5 w ]NV,` iXp.Bpgy HM7D *@?BVB@>/NtehhijrirWCQNeglkjigffeuuoH3Bm{jQYYjlkmmnlxyooqqtsw|r5cj/*^lR;ƾf6)o]To>QMMO/o˰k1j^= 15sjssgpk]PYhoomlnnZ6kopkrwskkc.O# Ddaܭ1/ T'_]@nPѵ6@ $$ y|~}}|~~~|Nq{}}|}}}}{|}|~~~ NNlC_U?k $:,; |Bg* B JOGoRYI:no_,BN *QfUHCDB@5QqgfghihYilomYXTjihfXca`_TTQQI;BPT}nWnlXNZmmnkmoppqqsuw`g_>Gp]jV#غԣ9>`Ӹ#Z6i|;MJL5O`5ͰBJYn;NZ]^`R@}I|nnmkkopNUyZlikmnn[:vqnkjj?GX^ $]}k6[9ۍH_R iGl $ Tw|~~~~~}|Pnw{}|~}|}{||{{|~}~w.YeoJ}Gg #dya $l }' B_ de7yGR ZU M7^ $>HfJIGDBB.VwoooV3Noyyo]kjjkhfefgihgdd``a`[]__][Q>ӔxPh|~onPOmmmllnpqtstcoݖ3TDBogZ6ڕͻa,_@ؗyUQ,JJ$?ḴĸP6{ ;Y$LYqowROJM^^[`oW)mgomlnoos?apcnnoeHwmjheXC>o '[ =jHZGQ{5tpC,~ # y|~~~~Gow|}|~}}|~{|{{}~}po' NRGYMfd6 jad nlG1sa | dB `I nI57c 5BJYMLGDGC2cwd;2k|omliihjkhigqgfhghedccc]^``_^^$RWUQgkmssZV[lvmoqrpuadHR#YijJ,$=̘ǾcZNуl;L2Y¾v D ?Y ! , sP}pTuUpX]deaofZ*|_onnnWCq{[oksrjQN}ioIRf*! BI ;|jgB;i? t! [|~~~~}Pn||||}|~{}{{}}|~}t,v~loR'B.MCn 5BRY6 MPpw ^Upoim){'$/.6?_^LLIIG1?l>.qednlklijjjsihhhgffihfddcaa_____a/oQccdeggY_osd^`kloqpuYa51]mf^ݠRXPĿ#Y7ҿի:D݄Ykh/YOH^JjpI9*'@PT5|Lq ,;: N]] R]k_QP6HmiXedo_=r_dmjijpe߅`h`mxTkloUVg3>9' ]k9 3` nkB)]{hn we.w}|~}}~}|Cnty|}|~}}~}y{{}}}w Lj=_y'eYW! Qq g ;G iRhc5_n:Oc`3vIw!..:BNY/MLLNiOMvO`]nlllkiiijjjijhihfghhhhfddccaa`_a/yPacaddffgjkotoamnoprRa/x` 2hLeo7۟N.tȿ^ĩI|]jPR) =>2P9R`^^__OCQeWO3.?B pP|][ hT#vuiZHJ>$>wtTLW[WY>IYq[g^nokjlXjiriOW݅1MQJ]Xayww # # q|}}~~~~~~~~Yoy|~|}|}}|||~|}p$j|mP_,W:tk[V i: e ) >| XI pu5 cp1,1:CNx;LBXNGk]hhjkkmknlkjkikiijgigghghhhhghedaeccc5xPaaaa`deggfYkoofpdnosWoRaR ;jL_ _' ]_} k$##623/_{g?R[[[]]U9fMwNjfZ;._9_ >|jſǶynyudT;>16fNNGQvY`kdThj[lnr|koʝv`V;I7=y> Pu )9|~}~~~~}~|:ouy}}{}}{{}|}||}}~x! MkQvkJ |B){l# T e_$ iG mW=_ N$.,3=HPURBZIwyfgfgegjkknlklulkkmthjjiihiiijjhhgdcfcdc*gJacdcacdeetfggjrprRu_s,i nW Cnl6u)ߚaPΘ ?^P 7`mj]]NU/RoQ[]]]][VBRVrNlfl@ ]T{/x gHg.uйHU:.hsLRLI mGYc~yqo`P>Mi~onTke~; ), }{~|~~~|}}kt||{|}y}}|}}}~$HpP.>a_kBm B' ?, ~avYhv aB?33,,5[JTVZCe`B]cdeegjiillkmllvjkuiZkijjkjjjjjhfgdefda${Pccc`a`afddefgXjlpqt_Iuq1 .s k_G_Bj#rv sOdd[[[]^^@mPO^YZY[]T@]LmRQZ[[eI j ^#) JCRwYTJZlax^[M^`9tmyoaVh^Yih^Dff6s?ۥ_ : W}~}}}~}}|||Ulu{{}y{~~|{||}~}}w# PnuoZGY^RY1v'YD 1 GVNH]P>I O1,MB?k]Bjj.5Xocaeffiilnnnnmmmmnkksjqihpphhphgofdfea*kQedc`c`ccdeddfhiilmsfq2R,` 'T 6n])>n mf{HZZ[[Z^^N3V|I][ZZ]]Y*WdRZZ[^aDW_]ְ__[`HdosBf!.dqQHi ,=D'[qBfddIio2*pB ,{}~~~}|~{{|Yay|{{||}|}~{}~}~~s. Wh@Txy tMs Uw rvI{|^ ;B Y?GG;? iv/,*3VO[Z:=3U^_ccfhhijkmnmollkxwqheccaRVNUUUUPeenml3ȴmQecadcdcdaeedgfghijmpvkh36 įOË9Be ! Z}D .Zճ JȹjPNZZ[YZ^^B`]B][Z[^^_>eaH_Z[Z^Q#O.M`Q9Z V XW5 1lŻuoeB;|/=1B;'G3e.>* g||}}}~~{|}}Rnv{y}{{{}|||}}~}}~'oeyR:?>[ y,sM:YUP_tN 6uc= dG$ f N2,3'^J5?MJJRk_`ccghgihjllxigYBLUOGeVeYgiijrksYTBL gdcdcd`c`ddeffghgikjmrso>[.}3 v.$V^ etN TvO^M^nC[Y]Z]][a1csC]^Z[]`Q5[dT[]Z_U?QXoĭe^¿,eal/D`p?eovIoľƻBoR#]a,T :,|}~~~~}}}|ed{|{}}y|}{}}}~~~~r1 CmP}ukPZ]j,5j:{cU Q/,Zg w {_ H. ,TBg9@NMI;Oi[`acdfhhiqifWCCRZhrry}wmmon]hjlZMHPLVedacd`efdddfhegimnoqjddh}6LX Zdom RNMmkTI[YZZm][B[eMR[]^^]U=]mB]Z]_Rf,Mó$UVNȻ nT eݩ=eeR3;oY[fdmY. #{{|}~}~~|||qox||}}{}{}|~}~~}r3X~ogL29 w/^5avc,D L GRBM/ttt} 9.'TcYGTNONMINaY]`dgiffdUC[il}jiV[`^^l`oln}l`atZCOcdnddefeeggfgiuoppY3,7L/r :ho2UINBe{C[][[^[[R@avO]^]^_`W!fgM]]^_`9R]{ʵufLpg*,qHJ|YZP6v6;Io{2e :I{x{|}}~~|}~|yt]v|{|y}|m}|{{~}~3*UoRBfTd^ s;LH o yk; TJ IX;MYrTrf1 ] #ReBkX_OPOMJNeX]^e}gfPXhyl_Wk_nnmmwxoommmjl[l`Vwewx`conYIXdeeeeffhgihjnnpds,wa_*n 5 75lJGy`CO`poM]ZYZZ[_BY[OT][[]aaDTqv?]^Z]`Q$GǶôdX̳ I ltT g@pLo`GIYYmphT /){yy}~}}}{yZ{|}}|}|{}{|{~~|n2LkULxy#7N^fn ohW#J G[M{B G cN{@rx5>J |i 7H~i;]nLTOOMLL?VX[]cVDH{~VY]kklnnnoopnooplnmjljikiln_lprmQIPggfghhhjjvnp[@]9m2,2Ȍ #u|Ü BRGX=N?svQ]Y[ZY[^V1kxC^ZZZ^^G,yXJ][^^`;gU˖a˵7 oO ^;fVO[li=yؔdZN'*: n{}~~~~}~|Ww|~}y{||||~{|~~|~n7|pohM@, Cg2 gI/aux j)t ;Y`?pd?g @,7}_'X^nYVQPNLNMVW[`Nj[Xfggfhikmooooqqoponomllklk]y1ȿidl^kort`YZfggghjkkkng9$  l_ @ra ?][QBmjDOQifrJYZ[Y[^^>Q>_[^[^]`=XxJ_[^]`JZ#ik! G}sc oƶ:kkqk9jUPðBjBo[x ,1y}}}}~~}|y]w{}~|}||{||{||}}}qN @vXL~gh/ gy H Qf,oT Ttv2 O;_R a B>?BX_oZUQPOML?J]Ukngcaedggggimmooooqooonnnnlmmjlu3kUljhjlotoOihikkklloh/$2, ).u?}o3^B]^[[IWDU?@^]]ZZY[U6umG[[]^]_Q/_V^_[_c/ws` aLY7 c7UŰDwu,joY_P{WJ /* |~}~}lWv{}~}{{{{}x}y|}~sV,Vi[|=@1 / 6 6ivBQ_@3hsD Bd|i|,]j H,,w;'HNY_jYWRQOOQYQ}iXa``acffegikkoopppqooooommmlnkn,κsrolkjimmousvpW_klkmmop17:Ȅ f jXt;`][Z[a;Z|GOH_yxC[[[[[]]BI{GT]]]]aaBX~B``^^aI  7dX2Z[rȽȥrZTY~sBrïGy|w`2B * ]}~|{yWy}|{}~}}{{||}|~~gVfnfRd? BT,#f `[w6P=]v: x,L fY]jZI}u#VB~#3CIRZ^qYVQQRW]PfM^`_Q_`cdffghiklloooqoooooknllonuhgmommmjlmoqtwrYllmnopBHtT l.Oі ]aeUQh[[]HY=L?w;`Y]Y[[]R3nwV^^__^`I.RQ_^^VQ6g1Yl* mHo̾ýk'c{YYRhCǙgp{ :7~_~}~{lYvy}|}|{}~~}y{}{{~}lxY ImYDqyhw 99 j wgCa5y;H  >~ [7dD ? @BLT[_o[VUI]N{g>[YYZ]p^_`caeeggijlnlnpooonomknlnl,kfooyonmjmnnofsyyZ_mmnoDoh]Jg)M_^ 5Z BlR`][[]T5T|LG=qp?]YYZ[^aB_rCQ^_^^_c,f>UUTI?;k}qY ND#  { fPȷf`@hGx^T5 $; ~{xUty{~}y~}}|yy|{}|}~mw,ViglJ=pL} B DX C~RG;ml.o q m?~M^@2 :BHMTZ`aZXYJhh;CXYWWYZZZi_``edcehhkktt{utxwwww||mm;d[nonomlonxpoooYs{wVnopZ7WZLL/6 H=LevH_^^]]GULPCsBQZY]Z]^P.uwP^[]^_`B,M5D.D y}dJ  f~ $]_gÁgU^e[Ilp6?9 Z~~|{Ux{}{|||~|}}{}}|~}}euongjkCs! {M!quG] cC: V]C,qU_yQ ;CLPV[_x]_D}?'UXVUWVWYYY^___cdddeggffYQPOO@C=CGUVil[ʳwpnnnnnnonnnoppooev}_Upg9LlLw JVO^lQW`^]_U5Uw}BHGeJ][^]]_`C]qGQ_^`aMD^Zu;cyuoJi٪g  @~ 2Ovoio]LvyBȑ ;#'~o}oPx}}|~|y}~~~}|}|}}eĴy GkfIou[u s BX Y@|Da ~Tl;. ~}@[eaMwY ODLQU]cuWIj1;PQ_VWUVVXWY]___acacNOPIT]^UYYZ[juum|lV'DRn{mlonypnoqqp|popg{~=g2Be>H : BewL_^R?Vs~G``]^^N]9MJ|BM]^_^^_W2{vDNQNJCQZuD ,1!n ;|N1pe >J~c7 $) |~|yPy{}}{|}{~|~|}|{|}qhjWkYhJJYc2 ) fh76U  |19/`~kOIr~w6/u ,QHMTj_dMMUBDOMPTTVUWXWXXY[__`RP[Zmn{qposoMDNjuynpqnopooprrqpikJ.GeZ ,xQB`__`VUjUX_^][U2[?Q5je}J`^]^``c?[vr'B>?_貝n> .JT[];X~Mc֎=BoT GG g l ?jd}cmtD,!; ]{~~{w_{{}||~~}~~~|~|||qoıivpcghxwRcC l G|ZQBmOD6 RYk gY|C_H|t ,#NLNQYaHmBIUTNPPUTUVUWYYXY^VNYj}pq`on_c_ooqrnj`@B]nwypprqp}tqttsa}],UPn Bir ZJOW_^^_UBd|B`^]^_GXBPMnJTa^_`QH93r`CB'mHYfffjl e [PPvp)GU l !! ?isuts3ȇ :#1~}~}~}{{ihu||yy|{}}}|}|~}{~}h|UlgRove}$ # 6J`^ 5C@@|,^InoR} ,5ULOT[Gq9IVVRPPQRRUVVWL^^Ohnol[V]ijkjkjmmjmpnppjuk@Tn~qrrsortttsthik `7wZ [ 'dYYa^_^_V?}]TU^^]]V1Wq~IQCe}>aULJMBMqc 6HN,]Refgeg5x9WB>GZI~d{*PX UN 1Jj~h ,* w~vsvy{{{{y{||}{}|||~qgu PigJZPXs j = QWGa q 7Wj l2^| o?Jcm dk,9WMQMCv{JYXWWVQQQRRTVY[`N^}iWdefdgggiijkllkmoonnq?eadrtpGGnyrqrtttrusje~ tk #q#aN`a``_aJ]BR[[[`HWLPṀ/5.`}}e6 DU[gfgL:vJgdfdgW_ #@1 ln ^ dtЫW  W* =R,B l|t$auy{{x|||y|{}|}}|}|}nqWphj_jYQe7 a c.;ejIU Q '$BN !lL5f X,>UOWMg[^LYYWVRRRRDHY_HvgDUR__accefhghfghkloonnmoZspttqtvtP?or|rrttsvutudnv )v π TuTV`__]^W=|fVT[[^_X6wooLQ=mxVĺMBP}LgffdfeYUYegdhi) a. Vɾ# uCۦ[qn Z n ,=Ookgklx|xC{y{|{{{{}{{y{y|{}{}}n{semikdlQ@ jO .5eHP I~u l3Cf~|.^R?r G, MMV>euZ_YYXWVRRRTX^Mvo~PBNOZZ[Za`ccdfefhhiimlmwmm~ѿVrrqqqruvuxvZQpptrtttvuvvY^P :{/o >QVcLU_^]^_7X@`]`^_O_|GP>}9k^L>HJ*vD[ddddeVL_oZhgffhT5Y;o5I'5;:@]u^{~[ C ! gotwvvvjsoov|x{y{{y}~|{{||}}|}f1 M!PkiJVHV PhL3cN!~ ^ } N{}?`Iru^ ,,PR;crpxfkYXYYVUUJ]dl}wMNM@>:PYY]_a^`deffggjgkjmllmm5޺TgrrqsqsursuyBY}tvuutuvvujZJo9Ќ l # Q1ihINyW;_]]^_R:ueZP`__`QBU5YdgfNZYVdeeg?u|UXedddd_r[kiggil l P@5PrV/j{=vZRBD2oN^ ofuxyxy{yy{ww}{y|{{}}}|~~}{{}hpC;@@1#')5^9]kiLf^V [j BUMOD`^ 濁 >WʝD{}jRg_cC{Z . MOyYnmqg_ZZYYYWNUhw@CLXY7mCZYZ]i]`cddfhghghhkmllo*Rgrqqpqsssujj{x;guttuvuwnoVU,o Y͔ YfXYCoJs^_Z[]GT=U^^`cG_y~hGo;Mcc`dceX,nOgddfegh6psYiihijIt.$eoն' q lL3|܉ pxy|~~~~{ydx~}{y||~|}|~{{|}yĻ1=TUW[UX_ rlqkk^qDW5 262DUPJ^ NZ HjYd}Le7yG' . YiYlXmlga]ZYYNReoU1UUVVX1:NXX[Z^aaadfghhhjjjljm|.VqrpqqprtutuwvhZyYWsstusu`yVc=5@T ;VN^3QgfccYNeJ^_[Y[U/lgiP^__^Q?{^WccccccY5oTdeggjje!{QjriihY ^/'BȺ! _ O Y7|UBkY# @xx|~|xx~|{|{}}}{{|}|{x 3akĹi6DIMC_> ;_XnlhY2$I XNu~jtlRPeoC iBn >Z5Ouj$'D . OVcNfnpfc^YYZ`iBNUTTWWW,U;CYXeYY^`ccefhhgrgikkkmJoopppoqssuttvvuaj{9g~qtuxPLk5V O GJ:hcca`V/~f@V_`[_^6UD`^]]NHU> ]?n~HddadaddN;oWhhjjjk`/^`gfddf$u ds: LrGR}Zn@$VO'yG^C/:{||~}{yo~{{y|||}y||}yy  6VԺ_2@CGTc^Xs:T`jMX'!13M kTcUfM[Tokk; ,J] OHt,Bcg@ U ,O|~BUgno~ia`[]Wlf?JNL?ITUWC)w1OYXYY]j_accdffgqihillXdqppp{qqruvvvwvvtR|Z[sqtuvTlBd5s Yސ U@[dca^aNMcQa`^]^R7fYM^R_pWY9[O^٣ZYdcacadh5flgijjklYIsTgdccaGB7:UyQk5)r=*s}N}T)ұЉ yyx|~}~~~|{y}{|y}}|}||{|~}{ !! 6epTVrIUGvޛC`mkL7x6 hRBXBmLZXvmY) 9Ik$?j9!nXN oq B>M_ixriV^^UnCLXY,LJVUWY*3LXXYY[[]____``aeooupuLWoooomppqsuwwxwvwwucV|9suww|GRZ?9{ )o$Z>Xaa^_V5sJYaa`]^RX=Rd|1rYooJZDuLeaddeeiOOl[jjikjmo؇>Yaa`aX Ie Q' c U gźMYc^n. ȅ w}}~~}}|y{|{|}}{~|y|~|}kO !!! $WO v5gpjlGYhL suq9@`NZLW=  :C>B32uCN{skJe {` WoIJZelotida>ps7BYYM:LJTRU97j;ZXYZZOMRTQ`aacdNGM3>2ë^lnonmnpqqtwwxwxxwwxZÍDuw{RP?G,I>n YP``_aaO[oM`a_^[R#67c9xILhU^ҫLYeeehgio2WnulljjlBolLcdcad)w* eQZ|i:iHܪD@] |{}{}}|}~}||}oy||}}|~~}|kdʣ@ !!! !!'! J1yfcklO VO oB`pI?_NIH ;Z =Cs{`chTh 7,dof@Y^elotkg=rGXVWWJ$9?WUTC,P]PIHQMfuxiqiihYYl~^MJ9TsstmnoqpssvwxxwwwxYo?_|uUh6oY ,p B Wl,Waa`cW:iJU_^^]]@doףcH5tidNY@koXhhgihkkBgo^ljjjihV'{@cq`_d@,#@Bn@_P)L35jH}p |x|||}~~}~||{xoo}{{{}}}|}`ʈY: ! Uml`k CGn^t7o=GoOH^JLe GO ,}ifThfj=q 1=r@JZaejpsm/qjOMXVXWY?Bg=NWWM5HRBJf~xvrfpkB7Rj}oopqquvxwwywyxyfh]J}[nk OG^Hdaa`cPOvB`^_[[CBinYQPeRV|LYPoIkjjkjtk]6TlkgedcY$HW`_]`W >!oqq; { ^ rȵBomॿTOZ }y}|~~y|||{{f{y|||}}}}gHѱ~Q ,WllIq :,![fw^oeUZDR5 U $ȑ~6h]دr} >t6IJ[qfkp1skGYWWVYdML3LLY]T5{jsgNIHULLQVTeZYZNk`roh}lBHimo~xxx{{xy{kYpL{i=x Z Z/NBMc;Yaa`aV;w>M]`]RfWffTIVecV:|[`aGy`YkhkiklmGiVfgdacd=OxM`^[[^7i[ oRZr;#eԜX'ظ` ~ h||||~~~|{|{|y{y{yy}|~{}~mc_llII$!1 rOuncdL=a ]wL a|M Tdy xM BUjjagmp@tpkQOeWVWWXYM[cPGJMP!G][[Z]_]^^a__cefhgYxZvqD6lc):h}xyx{{{|{y|YƁ?ygU ? /c XhZIYNc_]^aBhlIaT_uID@JecegQagyRkPrPkhljtlk`>xMfdc_``Q }BP^YY[M >1O|@`Qע2BI#Jq`]/P J{|{}~~||}{x{{{xwyyy}{}~}v,lalnM YC9, r:[V`adMGNo /# }jolCxi *p XVX_cglwIreoI^]XXXVXYYQxQHXy>.OZ[^[_i]^]__ddgfg]kBZoqO*@B eury|xxxwyyYڃ:kLCσ y hfYIHy=X`]]_G:s?dfk;~LxNffeicRTma^Oamkjjkja9ULo`a`]`YJXXWYN 76~eoO l oŪNHW.ޝϱɑ ,y}}}}}{~||||y{ywvyy}|~}~~~v,WXcnoT X[L rXHJYRcNC*. Y j[Yqov^Bp ^VZ_efk_UcUQ]]ZXYXXX[QnHYdlLN))?YZZ[[^]^_^^_cdfhl{=mmnnoJ>`{dwl|wywvwxxPsBYY*T$M'R B/hedg=c?`_]^T>]i2]`np6;Dhgih^CcseYmMv{XkkkgggjP]Maa][][@76XWVYM1]o/ ktW5{M/rİMWofD ${{}}~}}~|{|~|y|y{y{|wy||~~~o'Umney; QU> f|]QNB`3Z ) Q *hoolmjjJ,C eX]aghj?mhU]]^[ZYXXY_WXo2H;IZP9Bc>YYY[[]^`_a`pceefY}Dkmlln^osBNgh{qiwxtvuivY؄)LC!_9 : Ve`_dGP2Ua^]_V9PtoMMV1jkYhgiiUYWaWiLmjgggehX ؑ:V]]oZYR 2LXWXYJ Pt~RlW״D=L/Hw*ȰX2 ϓ n{y{}}}~}|}|{y{{{{{{xxy{}~s19_`o^a JY x5^gNGI`:v2 Y |'1Bh=_lhWRmL fZ^ogk/}ce`]^^]ZYYZ`Nph>LZZ[LB#MYYY[^_____`addgNxCklllkkt@VsyW=I|vwxwtvvvvZe,`s ɐ Qi'e_``aZ@]I``_]J:m`3O[VamaLGBhirjmB]ocBeYifghggg:}gP[ZZWXYV>XXYY] H,sM p uޥI,aȅnj~Bd Px{|{~y{}}{||xx|}{||x{|y|~h=^[mmM @) ~33LJVQVNH ' VNQn.kse_MyNVY $_YafiLj`e_]]]^]ZPdJpBCYYY]7rDBZYZY[]^j]_```eeY@mvnmlmqMad]|?@ xwvuuutwx}QP'ki̥ 1T .QH_____WJYt*Xa_`eZ3}GVa__aW*lOZgfgiUPqZkPoDkffedc`M5.YYXWWX:!*MYZZN2YeԽ: PoމOQhǻY2ќ̅ 57vyw{{~{{|{||}x{{|{|{yx{{}}lCɄq]lnQ JL :HNUMUHOG nI=IRg7.^rf_UJwJ f[aeYcPtme`_^^^[_XYv|o2MYY]N>x)]YZY[^[]]___accHHmkmmlxd^an7.v{y wxvtsu{|oU5!!d g O_`a_`aX>dBdeiM_dlPW^XYhaBT?fefgX?ˑD_Z=N_ged`_^a!7MWWWUXD .^YYX[P Q DgOפMZZ 釪i=ԝgѩG 2vyy{}}}}{|{y{{}{{y{w{}{|}cro`moT B7gq IxGfTIe ; UZ}2ZqcRUn5 M`cfCesoed_^__`empNs{M2B[Z[Q$2Q[Yf[[[]]^]i`oaVHjkmmkvI^akL erě,Rswxttsuwwy|Tѹ>D =Y R2a_^^_`aJRxLk5{ImIW>U]W>geggiBiudXl@oqPda`^]][5do?IWVWWY.mYG[ZY]cO ֳT Bn f.9l/ M tvxw{~}{|}|y{y{|{}yy}|||n,=Zmkoy3 QP OQlTpUCpo  XWD)^ucTHt{mDWTdCxqsqnea__]cXnolOO{}fZ:[[Y]7ddD]YJCJLZPMIG==OXjhkkk~Tn^eO = OBYwxxvwy|}|{mM =  'ec`^^_`R6W5c?2rfTY gaBP~sOegghTIDlRe;d_[YYYY? Ȕ*XYXXZ[BCH]^_?RtN [|hHɤ}yiqr, 9_yyyy}}~}}~|y}|y{}{{{x||k$YXo`c YY. D 3RoPO [{ Z}J5OqaGoM{a c[Vp]sersnfal^cI~XrLRUo}|,3_YY]MHRNNONRRIPPThk|roDC,^Ughrl|rG[[nT.,] ZxQPx|{wyyy|{xW`} }2o | R2dca_aaX:[hO^nCgZPf|` c@^_V.ŒBghghk2Mm^2HWZ[WWXXW CCXYYZZ^ I[^`R Q2v ӤVprmj `Ѥ`MԱƭv7 ;#Hv{m{~}~|||}{}}~|}~|{}}|~u6alo_ Rd!Y I QmLV t YD Va~=njUR~o|h a3`orogc_aRpNiO[_Tp|Y6C[]^R6!QonyqoV?HgqP>ZZhpQ,5!,e]un?|yyy|{yuvPvM ) c,QddccdemJT fhihUCY WTd^a5gL]ghgjG_wn`iCo9ZWWURUU96BZJYXYY$g39J^^^eP V@᛿yBlHґDP I'2vy{||~~}y{||~|}}}|y{~r#XVllO [{. Y Um@w N 3 h2rLpjOYX m `_vfootoZcaXoGvOZZ[Xp|{qx2cWJMwy^WRLLLLUjmltmT3^3W]vB[r?M5sow Y}5}~{y|xvtwB) DIi=efgefghYwBjijilMXc Noe_`RDxCfggiYINgW/LWUTUUVO ȗ2ZXXWXY@Ɏ3_]^PR2c|[Lv ?Ǩ_..~, ;/wy||~~}}|~}~||}|}~||~|}n,wsYlnY c, |o RYBj,!NI oguVViD e / BgBjqllppjdgM[j_Z[[^do{yyW9Dd92:La`R^^^R`aUYlц~}d1C_woJfjmidiqu Gr}~}yxxtux{= )*Q B'*fggq6MXB`ighsOH@jgVTa_Q$~Jihgh^:YOU!J@WVTWaXY6H@YIXXXH ,`[][_Qga ln ˪бTGѤBeҡhY J2 {vy{|}}|~}~|~~~y|}}}~}||~o,o_koy sY' G JT@ ,rދyB@ YrVYiHB _. ;ceUZmqurlj9tW^]ZZ[To{wj5,la=9f:`___]`^]_`_d,J^rf9_o^MNafiik}Z ;~*||vtt{{[Pv f. Դ '[Jmf5@7[LljjgW/oB R^^n^[IJrfVggdfCW|?_7a)YVVVWYG5)>YYZY[]$sQN]^[]R T ;u蓽pp/Ԍ kjTɲP L2gw{y{|}}|}~{}~|}}~|}}}}||~s/YhalgHV7|ZD BJ@ ){No ZrZW`5 W. NhRpVrvo_Bqfa]ZZ[]anQvXPNMM@V`___^^`]__c1~YhYhjne5M]]RigklkX Yp2{{ywvyt7: ~ *`)BLq tYR]TVu,jjfdc@Lo=RonZJH@7MefaaL6,RN'ߺ3XWUUUWXO5[[Y[][C3Ȁ=^[]^^3oҪ`rɎvv``/}ҚO M2Ixy||~{}~}~{~{}|}}}}}~~s*3a[laM CpY@ X 9>^ 'hR [gYV`]PL^÷ T/ V}Teywo>ZjT^]^[Z]a|26J nQ`]`7hH>`__^^^^]``a@nNfho/cjoCJglokhlkwyV |h5xyvx{n: x׬ ,DI?/kUfef]HG]jqddY3>d^WWU]Y jRd`{^`DI])=BGUUUWXZ1rRI]Z[^ZQ ̡3a^]]]G)c ͱ lԤ~'/VD :B.1{v{|{{~~}~}{{{~~|{~~~u]Uld Wov9 1: ;9y 3pp Qf^Li) U d@}lNvpcZY~Xco^_^Y]U{w sQMha_`LLm`__^]^_]_^_=^ighn?`VYlxo7}iijiq{J X9Ya)Go sIHVHe Tcddffh?ZV5jhdac6YC5B?IZ} 6esJ[[Y]B?u;[3x,UUTYYYZC@^Z[^^`#6M^[Z]O DB o Оt2ȿI;3 12B1yxyy}|~|||}}{|}~}||~~~~|r#Y[kZ `aC V* /;s :Wl =uh=L U CpjghNv{yXVaa_^][]afkQOacY71W^^^^__^^^_=Y[dgrIjcaTWx:qcugjjvD G@of`^91..LP1I ]?$ hX$_VgdeedfeYPhceccR1@BjY[  }7YXYYQЎ1Y?:ͻWVkXYYYN ԙ1^^[[]^>3q@^YZj`7 hxo,xހ̆d 5>xyxx{}|~}|~~~||}~}||}~~~!CRgj` ^Z{D7 i B=T1 >NDu @ 9_j6[[ G _?kehGvPaZUaca^]][^U/oxNsiVcdIP]5^^__^]^__`,VfffrJjRlTaVlrX ^e|vd{l n޶'29:DI`N,2a /,  @lg9edadfgZ;6Hden`c6:Vh]Z  |d?HUVX])l?=Y.e*GXXXVXZ[/wNMZZZ[_U /_^^^QJR2ɂݙu uę$۬yxϑӇM` 6=^xyxy~~}~}~|~}}|}qo/TUfZl lNeBM 2D2/B 6o>h v_!Chw^:; C *djgfXfnOvGig`c`_][Z^cJ~~~~, NcdYT!`__^]^Z___9̰RUdfeTkTdm`ccRrmYnkYTQQJGq)DBBBDGCG pc$ GV w m;ZBPefeggjTV`.We`a^*TBB^CY= ,go;UTWXD;n5ZCqq6XXXYYYYL;Z]]ZZQ !c]]`TH>|u ޵ rܗÇ;L=xްJ 5?Gwwyy|~}~~{}||}}}}@q{ReWy jCQ5{ =O^ ;Pi =@,;ZwY$ ? ZThefWhv*a^X`a`__[QdL}~~}a1~|MadBN_[]Z]P]ND6ohacde_alcs`pgnZ|N3'* x#/BBBB1,# 9$GHIU5 !,M ZHB)]Hdefefg^C,Vc`^Z965aZ]C m?UUUVC2ZII YYYYYY[R 3^[ZZ][@fI@_^iR=qB ̿{lj 5).UD )>.;xy|{}~}~{}~}}}}~qm1ymLeO, hRL! l/Jns 5{rl $!.dTcg, 9 ~HmjhfcfvpjhHXW`_`^^dU|{~~p ZBiccc>)55C>MQNZitvkVQ9^als_okwifO6 sȆ# '6222! JR' '2C33HO5Pi:PM[MN)P{ >Co1aaHh3focdfdU/o:I`a][^,/V^Pc R:HTUXI2NZ1q#OXXYf[[^,CUY[Y[^;Ӎ>^Z_O,n ]ȅ፰~Ӏ@a?6 *B,!yw{}~~~}}|~~~~~hJvkXcY_f XfI [1;~ ?HW GB3[TDR. 1'jjqfdhv9gxMa`_^c@ij~}}H J$Mxqdewkd9G_dRL71$;97;aLJ)  =',@P, aoe^Y[PG I)LJGI5 ] OVcO1;Rccc_`aIM!aj[^^=T;D^^on GeiBRTUY=LT>XHkTIXZYZZ]PO9~H]YYYZR ʰ$^]]`*N؈ԫĂ5߄)VvsΗ}H g B?{{{}||~~}~~}~~|h6@YYcWBRrH R:Lv LC olg ky}IB, !PIhighffins?xMURacBPVf~g{G?,BgnO$TLPICBDHgR' #32132/ [͆ !QnhmgU._3WXLIGIMGw$:BDC7V/ @Ot `_`/cg=edaa`_O V^[][H:Q]t! ު^BUWVX?o:YC[5^YZ][[^V =PZYZZ[!M]^_Ğ{t6׻ 6؅ٌmZIн B>k|~~~~}~~~}||~}~|}lJ/ZeMOO'JO :@Lf W#= _G| jRsf:* 7Y>ohhfej=gxhgIXTsJjXo}~~}[P auo7!dakipwf.r o{X$ *,.** _i:gk`QNJI>TDQC@BB9 C3@>>* n N C L]_PT7Ycd_a`_6],;^N[ZZ/7GZ[! X6WWWWYs3ZZ@[[]]ZZ_^ߪ1RZ[ZY[=HL;^^a$gԥ B ֪g1]͹Iބ CB!Z||~~~~~~||}}|[B'JcRO $,IR rY>BWvQ wL, $5y !uDNk?3 Bt$sqgehle,x`_^OXg|Ufo}|eWiDR@>=JOhopV'* 5ı H_ $ jN/PMJGDB5)B2=J>./! Gs';69 ` dpN# G[[V6ILacc`^`O91]ZYYY'Y,J]^PUPJTTWJ=W2]ZCf.L[[[[Y[^5Y]D[YYY[I ޅ*_cd7 .Ȇ>U'6=l? /@,@{}~~}}~~|}}oP2QcRY 7Cv_ OO3LQrQ h2 $1 #la.]@: PZ13qhgXfNyahlJ.OUep~}@*sfcoqU /gB  R  ; MYT3kž7)IB@?@>, tx63:#Ld7 O #255 @.x GXY^;Rc2Vac``_U ]YZYXO5c:PR $^?VTVWB*THZIUj;YYZ[YZ[M3ZYYYZQ ʿ*aad ޽ ~Rɍ1Z)[B /B/.y{~{~}~~}}}o_HBJcBa >CfV ]'PBrU 1D Z~B $n{CY59 ^ BhfeiM#vlgdjYgvegQ_eoo[v5Xmp|qq^ $$$ _ $' OT !NTMBC3#m:#@>O976 , PBe N{/1/ jkI|j n 1GXYZR7;Xa`^]Z[BX#IYWXXM 1O`Vh ! G3WWVYL^:[I2Ȥ,N[YZZZYP ẨOZYYZ[)V_a.UȏivtťgC?= B@}|}~}~~}}}}mMB}L]?e B;^[ x 2RBW = {`^y TrdYC. X| 5vfhOx}|ukeccmQQQPT_eo{s*eLoppp{dXr)!## u )$$ r| !1Q79;# r!:66523 h; ]Uw} I 2PGa* )6 CwPV_WN#?G_^Z][ZQ/p)YYcWI)rYV eJZLBXXWYX{7]^7 QYYXZYYY'5JYYY[[@BOB_P}̨ӗЈ ȊۉИrƯ|͍R c @?y{}~||~}}}~~[Bj~H[Qp DBUN ~ P6i B T*| .DIqY=/ PYQ =ggh@=|{skddW@}umN_Vo{t)Qtgrqpnmnoc`I`!$ xu ,#)), = !B/26$]$*3311. rv5Q tv =ZNy{D./, Ny,PQW7We:^]][ZX3 BWWVU>,69~x {[_PMYXVX;I7P_?R/MYYXXYWX:9lBYfYYYR .aa3Oͷ;Ի e 􄪵C@ÐfؽO 3?_y~~~~~|}}~}}~f>[yGY?~ BUXJ v~ T=tg  I o B.oJ;, nH, 1qgYr)w|{~jeVgdGԩXPZq,Ywusomjiijago >$ W#$))** Ŕ *,, _ۨ, ,/,* @vHq3 . * BV`QO .)* pwV3Q#ULP5,*Q]YYXW?y OBVGV=! sr m? ۪LBXXVXDLT^N6k3YXXXXXWG 'Y[ZYXQ ֿ,dd' 9¡ёNG'`γC~ B?Zy|~~}|}~~u?owC[: B^NC W .U?rf ) C '6f o1wG@* Z 6hgXuvysjdeNsTWnYWqZxwxwtmkiiWYqJjN Q 2$'$)*)) wǔ$) j~$ **)P hPCw: ** D.k o *'' ?;D#HHL>}>L[ZC[l C@P7Bu^TRT}Uu ]V*MCWVWWNh@ZO5 ZVYWUVUX ![YYXYZ'Td'݆B,3B=1xO D?2H~}~}|}~~}~o?mdMY: =aMC ? #TBoW D B >oxc OrX@,*xhhZR,uxsZeYo)khnTpBIyxwx|kh.o[~Y~  Z5'#$$)$') pȅ $# T $) I5}I ))$* :jCV s, ,$'' =Y1BCH;/WW7YYD]m#1NLLP*Q'57D jUGRB?WVWVY5k)Z]=~ NYVVTVVX {5>ZXX[[BU,Xg!Njs|s͵ jgw>^ ,?1;}~}}}~~n3|cQI7a@ 7oO; > UIYQ c]YD a=^ UhLC,,PP!!.fY}9|wwx}mgVrUeZciH:|yxxynW}ptV p p)##)*)*$'' _v $ B6  Y]R )'$, a7*; / .P *) M`J@BBC/.NV7 _>#WH 3Y@ [/DMaUM xGLWYWYB5.H[3Q@VRVVUUW21o5[YZg]Op,d~ƛđ, ؛΍ڑ2VC 1B),~}{{|}}~~m9^TM=ad 2~J7 $ )VTWR i6P n c kIC*J9I9)}gOsqruxvrlVcjdccYnywWNyywv :tRlsV r##$>,''$$''$)$$!) q[ ! om f`I'}3 )* M6~dh/ 2. m ,*', >u@>/>?@:3>URO Y5U,;XDNU ޸,WZ|1aRT ˴P@VXYWDDBYG;p1VTUWVUUC ^ZY[[P X 2W 눩V_ζUL B2~}~|~~}|~o2UOI?[q 'I9,7 *RXVC w H  Z nB?.fC39sgO3euvvsmHnfaaaaY_5u{wvt? PGu` ';]'#$''$$'$'!## q6 ֹ*x@ ] WXYM 2/.2 _H .,,$ C;::>BTI5WR/IP)=a6R:G_? @Yw,OPT>=WXWVGh3XD WVVVTRUV Ы_YY[Z] Q 5ء_*JJ o B@'|~~}||~~}t9TOCDC 2U/.6v ,LgPG  @ O X  pCO,}_7)whposwsnN2{ddcacchX,||xwwws~s W~ynVwm c!$,.)$'$###$$!'#$' |3 XY X Hy Pp~ V $/13 Y 2.* vI)669?*).CPO=LQV޹RNMOUGM62Yw:ONT=GI>WURTV#lLY# YWgUUUVVx,TZYZZM, J ) ^,27~eɲv6 DBd~~~~}|{|~~iMN`C>) /h*9>p ?NwRD  B P R ) uB>,yL)=qhDmpsvtrc,eeacdccYas ~yxxvwZ rj^xy |t!!*)$###$#$'!##$#$' m ! '?: ,, =u]ZQw. 356 Z $.,,. Q`957971!.@PNQRRT:OPQRB*Z,Yo/PQRLeQJWVTR5BJW1X :XXVVUVW7?d=ZXXXX9L:B ޙB݋؜x޴GM:`ޢRo 7B`}||y{}~n7T^;R }T*:Lh 7D{RD o ? ? I B|#w:O5xu ='jZUloquu}LqcdcnccdUsnwjvywxsqtoZq 2x{ 3 #')$$$#'$$$$'###'$' $Q VTWY; *'* hd=Y]ZGtHG 7797 Pp;1/,* P 2333> Y;;PPQRQV6B/9QPQ_P Yi@QRQU Ѱ:IVUTTB7CW?6T,VWVVUUWD ͝3IXXWYGw) uD QY9?ΑV 9BY~~~}y{{}~i9I_.J ~gDZW NQWD T , caL Xf?ĉ;B9fr =!!oW*mortstNuWedeedhs5]}kvuxxq~=)/e~x !$'$$$?$$$!!!##$### g!1hYL ,). ) ko O :99 R .,'# C 11137;V5TQ[PPVI]2@M5! oZRPOQP B:WUQRC n'WJUVVXVWXX ƲNXWYeP 1uĴ .Ԑԩwد?Jo :BB|~~~|{}{}~pGrBj=O 5[LYV QMeC = # |Qd@ jOHȓ2N7` ?!Wo {lppsus{:fddedcdGrTgxwwXpy~jto~uvc #'''$'#$$$1$!'$$$$' f `Z ]o2  Gioe a= Uo9!:97= Y ,*)# XW, ,,12 :TNNNNQU ݨ2;B2$ ZR cYfNLPP,N;2VUQTRXX JWWWTVVV ?YYYYY , B qOÅܓ)MZ 'B51|}~~~}}||}}^PqB^9U :|i)GZR eDXB = 1$/@2B?ǔ,@6U ?7W#|mopr~WqldcedeeXf!q}^[v wx{}xw RU$'*G5#'$$)#$$!#'' =L? N `Bsik  C)769 O_/.,*$! oY ,,..# 3=NONPRU!)7> '} OBXW=LNNBY>TQRQR*M XW*t CaTWVRUV/TJ=YYYWY7 2Bюˠ7N7`=^H ,B3$}{}~}||}~~aCgHa=B 2XLiR kJuW? ? ;v 2B}/Hȣ/N9Vp*'2) Iq^{ooqsD}dcecdfM]nyojW, ~}rvuy, C!!!#$$$#)!56*$$!)#$!$ >QN:  pt 3 W!T 33$ Z 9675 M /,,# V ,@*,2 T>?@PPPUR2M29{ Q 'Mj=JNMO ;TQPO[7'BW,R=VWWUTTV>!,YYWVW2] ,u Un23?Q{? !BBx}}~~~~|~}|~kYqI`.O 2pgLkU IrcM 7 'UU 6Ri])P.@/TW,:/) Z?tmoqpqsa qccdddfU?i^}ymm q d1 Zā !$###!##)$$$)6=#) $1I@ N !' ÞCõR [hfq7 #355$ V_3#625 Z .)# wB /))*.,R6?OPQcQ5/D3$Y R~ph=MJMN N>OPLP9 Q,UB/d1WURWDWWY YWVUU1/3ȐBrڮ*{BR3pB ^ @>}{|~~}|}}kOyM_2M :rZDjB IgcB I YM *uLCe*>,PG O,9 _ymmoqqs$mddeddR ck~yxwv :#* LlT l,#$##$'#$#!'$##'$' cyiB3D>) Y#C qZP 63353 N7667 sU1.# ;O* $)$* ?GPQRYML;9DG|IGo uWLIGJJmB;MLJLP UH# VUWUVWWX IUQRTY}_; dȵx1}ޘi @@ qy{|~~~~|}}~dIaIa2H 5rs,LuP 3_dB Qr dN 9}'7Z6P2g7 a,' ywmnopqNagdc`ddcQoJd_}wwu)!)$ ! c'$$##$!'')#)$$'#$ ZjhdcyHJ ! #Wf| > e#2255 G 5556 ;U@ 5.# mW $$, P;QfaR?$ 375*W?=*M6GIDHHBB3>LLLM x UV XUXUVXXW =UUQRG *~ձ!:٘@dٙféo, B?^{{}~~|iZyB_2H ,qg$:~T 3[dB Vm !{@ V > e*B$j.~$. }mlooqP*tdnn_cWf!`dk{wvw $!!#'$$''$ 1.,)$$;#'*)'$'$!!# yymljioc^~ jQ r Rp/32315 L#565 a7IQ, װ_ ')6)n@3QXi5 t*BP^QVC3Z/7GGDDG1WD;IIHL!? GV,i JWWVVWVR6PM*W_TUU R Z,~_`XeP B@Yx|~~~~}}}~ZXwM_2H !qf)!yG ff? vUp 1pR e Bo?G)!3@ ~monopP yccaaaU jcj}|vtv` '$$$#'##$$'#)')! }q *)*)!'6#)$$'$$ r{mmolml`B>cB{ }Y  Q 33211 :g@3379 V ;M1 @ $)'/,9C>cY. P67QfRVlUՖ62GGGDC: a3LHHL7'';R$Y;WUTTRTQB!VUQUU,)2 _I>YtZ 5?,Yx|y}~}}{}}hJpM`2C ,eg9'G `f9ZWk DM Ow!nL;,$Qk1 w:mmnoow {a`aa`Op?`a^v{xu ''$$!!'###$!$##$ o ,$)!#''$)$$)$ NwxnwiiijeBq ` OޑBV5''/ M #/.,. V 125 |I1$# O:''$,)_Y)32#I:RQP^u 5>DDGDCC Y:IHGH> a.U:?N,UTRPPNPD VURUc7Xj Ypȳ'B3yOi׊ҟ. 6@'Gx|}~~~}}|~cTC`.H !uZ;= Ye6*1^a'rZR _u,wpW7')qT .*XWxlnon^$oa`__cNB_aaj|uv ,#$$)5)?$$#!!#!'# wM'##'$!$$''Pk}siiOBDl[D5 m !552. x1 .,*, [ 1225 BQ: .,'$ GO )##,J ܔl!*2:3 nGL[aay,GGCCBC sQ,HHHI:UJ TPOOOORU JTORT_6ޮ PL33_Ȝ#Gki 9?*;|}~}{{}NYC_BC !sY? @ ^o:;$U^2W}U Ȍ or7nep,/9) $9Bgkmmnmdn@pa``^Xo iadl}yuv ,#$#$'$$##$#$$#$$ ,$$!$'#'$')' :xr,1!:^rtp;i $wu 521? 1}C )*,. Q 1./ gY ,)6$ gX )$!'@ d$.6;? ɥ@ , =W5.GBBBCC[N.HGHJJ v TB RQQ[QTQQ ;VNMB[ n/j؞1tB6[ uRiq ,@/9}~~~~}}}kYL_.> wXB B Qt9@ Yi9,N xq6{Mv#'|: ;,umnnnkTMVd`a__R tackttV $'$'$$#$!!''#$$# ` !##!##$$$$' wOoow{vf.@rM:I/2// h ,*),, Nc9 ./. d .*'$ ǰ^ $)5!ij ,@:;> 9 '369'M26CBBBB#1PD6GDIJP GQ GQQRRPZO;cPo>MRo NC dڙoX> kZxY 1BCw|}~~~|~~}ZUM_LB uTJ L XuCI ^_@ka `5Ӊf@}MyoL `olmomm[7ed`^a_Bm`dVytt1 '$$''#5#'!$'!$'$$ }s!'!!!$#''$)' P /Ԫ}ufZY x/ ͵e ,,,, X ,),, wY ./, l /,## B #9I# 39;;: e/*::D7) k72BBBBB)YY2GHHI'H ;O u JRPRPNOL3CR:C::Wu .|ٕ, Tȱx/ gjuZ B$!|}~~~~~||~kQN^:7 tRR J ijDI ehX i^ qYc=t?Λ,U; 3 d vunomnW }ca_]^O_;n`ckyur $$)$##5$1$;#$!$)#' ####!#5#$$$ v !P'xtsu{{N # o ))* ah6 ***, c .225 vO!!)$$$ [L ]T 7;:;; >=2;669M ʜB,?@@>@/ vc*GCGD,=!N] :QNNaIHI: QLM[W2 e '>tȚu?'oqJ !$@?{~~||}WYʜP_65' uPQ pT ZjOH iaD Hh D|[cOxLȡ/LN W h smmonn_ |d_^]^M?Qo`dj{ts $$$5)#$###$$''#$$$$#)$$##$###$'''' eQ Ti,Npu Ӿg/ uo .,), ,[ .*,, X !566 6C7 .,)$ 73B t[=I=;>>O!99'; 9>?>=>@ gDBBC,O2?@/NLIIDDI6 OLG:=3sD [!fpōB7^yH{ J ?@}~~}~~}~~aYЋQaC.9 TX {]y `hTR cjJDj L.d@lP6@Y i i vnoomms c^^]_N]aaf^uwv} )$!$##''#$$'$$!#$#D######$!!$5'$) fX,jc!huk q *,@ H.., X /.,.2 W!57:$ Ql /.** IT e>>?=;' cT6669 y;:=:;=> }iCCBB9 ޮ P7' L7HIGCGM ?ICDH,Wh!R]BIUa;~ d ?> }{~}~}~~~^UWVC3Ol $LU rh1L#v[dO duH>?k R.q7}N!=X | ~noonct d^^]Ro^aad^vv *#$'##$$$)''$'#'###$$$!!!!##$'' )!*>ZDam|vg HP; e /... e2///2 ZV:569 s 112/ rc i@?;;9; Y 76`6 W:$;:;:>= kN)BBBB6r N@ HGGIHDG: ;HCBH656 O}>q΍ >@XnLp, @> q}~~~|~~~aTWWC,aY Nd pu26BmVdY Yl6J5` [6r5W9=P } umonn`w f``]Us haadju{xss ,$$!$!$$$###$$$$!#$#!!!!####$$) W rd7>xpprn= _ 6 _ 3/..1 U/113 ,hY 39:, ͞i6652' i kQ5.:999: D 6635 5C3=99:::J>?5CBBBf ;; LGDGCBBD~ /LDGMB9 ' ޳Y?pW{=?_@i؋ />{~~~~}}]XjVJwB Dd _7 l{ThR^1iHd *t9y]oQ!JB9[ | llxom` da_^H xc_cj~yuq $$$!$$$$$!$!##$#''!#!#!!## Cx7y{y~qprd k B' t 3313 Mk@3235 a 99;; n,;79: [6DQ26566: }G5563 HP,9:9::,>U3@B?DW /D ~ 7DB@BCBHY.JHGL.|,`^Z_^ )ߌ@*9p6{|:hԄ'' B>a}|}~~|}~~~}]RxlPY' >e ]7 kGuX:]/ltM Mu5|cT^ I,_ w `xnxl[ e^_aPpccWitwue $)'#'$$$$##$!!#$#!#!!##!!!#!!'! a~_onpp{rrr~#n` H eh6532 _'6667. ްi =?>> u[6.>;=> pa $ BR35767 i7$257 ^T ::::7CX*B?>N 3 *B w 1C@?B?@C.Bk MLLN2 X_^]`, a_[M?$, ,Y̠ҭ;LqCx.},ɓX 3y />#_~~~}}~}`I{tZP' w6o N$ P?~R>kY2 fx/mN{ U p Zvwnma e_^_IjacfjtxsR $'''!$)'$!$;##!#$!$!!!$!#)6IC,$$') ylyooV{@, O)D7997# j;7;:> Y?BBB VPG.BCCD!Y2>!!!$ Bm 79796Q3265359 ĀV77776,aj#@>?=!; 2 ] #B?=>?@B* OIL9@kgfed6 X`^hg`5d,@, `[sv[o2Xy)WPg >>]{~}~`YnP],{ # g5e O9 73pOMJP V l,|mJӖ ] r?vnnlf d__aCjdceku{vQ $)''$#$!##$5'!'#!##;B',N.)!>* TUytd _ y W ::;9, m>=.?3 U.DGGG#?D`7JJLM63$T!' eo 36966 73I$3166 N!67676,op,>?;;/ } @O B?>@_?C; PLI2hl 7INWiGt X`QZPP3GinmqeD5 [B}ӕs}Ch}R QD @@)[{|g}{|}XPfOa,y ? Y7e wW/ ,JT9J , _!nBɰ q BZ ,ylnmc g__`Naccdks{v^ )$$)$##$$!$!#!$#!#!!#!5#)_*1.?]*) , Ixo! ¿h u k >>@=? W!CYBGI ~N@=MJN3/G~7RORQ='5o $#!'1 r 39776 *9Y5532 D79979: a,==99/ ڤ ?*W B?@>C@BI OJL,r[{cUC[ PgVa_`;Ԥ[JXYYZN YVW>1h .WΚVشe})U QB 1;Z{xd~}|~UPaIc$j Z R:gMd, )@e,X . J~lH~ |D#wuwk[ d_]_@.c{deityuU $$#$$##$'#,#!$!##!#!!;6.75L'!n*$$$*)#!!  n 1X p BBDD7 R6@LNQV9[PaIRVWJ,R@WYcWV*7} .)$,/ ` 59966 B`232 oB17967:= `;=:9, 1' C@@@BBCI BLJDw>ZsV>:>,,_YZJV@7 ZYcYQj1CYC/1 1} >[ΔݩG _1 B=Y{|~||~}jWiDc,[ @=Y3)o3 =k:[ . Za mV B#jynm[ d^]^B7d`ddktyx` $'$$$!$#:!!#!#'#$##!$5$)#3D1LW$.*,,$'$$'$)$$$'e$$)!!) no 1I.tHJLNP*cQeIJI_VTLMiI]^]a7]G^g]ZXU 3.12 c 56997 kQ3253 c:,76C67; pc1=;69: ?B B@?BB@BH| :JL 2f$u 6/51GJ? PXWY9[DOhfedYM ?,/m gjݤ[ X f 1;I~~~~}}~~WdqDe.Y 2Ig: 1 :Jd O' |U {nO|6 |,~,^ooex c^]]B)caafjs{wr *$#$#$####$#$$#!$$))*!),$qwY:,//C'$#$';$$)')**'''** Os$1Bd2BRW[TGCO^Pj^Yw?P|YghhfByO][gZZ:q|1=255 jX'9::9# {V 3/35 P=G$76569 XB7=:979 q @. B@?B@>BIu .HJ'q'oޜuL3m .NO^B`W>OZYY]M:ndf^ǚ$6$ @@ *oq;G j ,;BL|~~~~~_ZJf3C *TiG 3.9 C{M rP G |lXWZ Mj5Xooox a^[]L?addgjt|w{ '$#1'$#!!$#$!'$!$!#!$$=$$*lo@6.,G1C$$#$'#'$)#''))*)' !wG H{i=MH[ov9Nm|{PRo|vkjONZYZYZ1rwQB62C9fDH'77776 V 3152 :CI)79656'N:I.976:a 1 B@@@??@R![':L7>tg脠^RdM?9Bc>]Z]][J'ghj_mp}cft$1 OTc p! ?>)G}~}~~kRNg37 eYH ==Zf.VyY .J |m_No G #G#@omod a_][@5ccefjt{w '$#)!##$!###'''$''#$*72#.2@'.,,:*,))'')$)#'$)*'$))) yt )d]XmtJ_R]_~{sjYMWWW``;hTC=6;= P>M*:9:9' B#2135#>Y*557673)L.:566 M B 6B@B==@C*DXJ=BCRօ]|Gro}2':2:,degXpovvn] 1#_ Jw ,,#;|~~~~|~}~~gRӥQi67, $}TY BD*3aj[s˱ՋQZ~Y tnkMϝV * DX**oooU yd]i[:OPcdejs{x ''5$#''#!,!1'`!'#!$#$$,,2Na1,*))7*#$!'$$$#')'))$)')) x ZaxY`vXiqvp~oIv?M]cY^1hCH,=>B*;9[;;776 ~@15223 NP667671'9N9959H > .@B>>>@B1?x M7Y9_ڙi×PyuLeȓvYx 1>IGMopqp{u[}pol9/ ,7Ą 1>.?|~}~~~~~XW[i=*Rw Od _N ԏPGgQ:^Phsjjk{jG>  ]r2|wooV ed_O[B|hLccfjsyw )#$!$!#!$!!#$'')6*,.3NN2.*,,'$'!'##!##$)'$))$)')$B,   NfqPywj2r7Q:6/ q ! B @@B/$s =:969 r9.#225# Wa$95996# 3`.:76:6,> o ,B@>?>@D2# M)oqsPoI[kpdB DMWQ]qqtwjecxmmPx ^Wą .=#?|||~~~}}}_Ho[G1? Be L Zs2;^;9V W:^tiC* Ƒ# y~ooO'ap_[[DY3adflt{wx '#$!)!!3!#')')$)*).212.;,,*#!!1)#''$$)$')'$))''',. ۂ  HT~}~Y}r` s #5$ o #! y Ά ,HC,.'~==:69 d2B$5566 YR'96777,Ck:67:'$U > l /B@>?>@GH OŐJ~sNZ|`xs{tMG#PW_]Jvsjp{:sBă .?#?{y~}}}}~}|}~}~~}U^tYP* ~3X q> I1Wr ?H oXBjI1'  mympQQ6o^ZYRG6acemq{x $$$)'!!!!#  **)'$.=/;,,,,)#5$$!$''*))$)$))')$, ̕ / /aunvZkŮxG=$, Ӆ !/, no1!! j 133?>;67 `*B7675' wR!:6976) We$:979.t /M@@>>?@BH Bܔ?m]euYov{uxgO=YdocIoo}nYBx '>)C|~~}|~~}{~}~|~~WVjRa, , g9e[Y, ; d[ BT €/|kL[M?ZJNeZooVwp_ZZP6$emflq{wTD *9*'$!!! *,)$!..,**)$#!,$)$)''*')#$)'))''*, Î , 6goH_JYXY ˉ 65!  /,*1kZ. !_ B ;>>;;: R1D'D655 V.9:G:7,if9799X BDC#B@@@@BGI B$n腡sϕ;d^dqYiqqyVcUR_OCWODLȄ 1;.>~}~}~}~~~|y}|{~{?]_Dc/o W N9g3!U ? fP vt 招 kV;k]B OI~op^ p^YZ^5ۦde!h{eDBejZ)  !!D!7*)')$)*)$#5))$)$''*$''$'*'))'* }  @kw=PVC) ̕ 1// Ƃ . OI^ BL@@=:= C,HY'57 ?#;:;::=iX:76;? ?1V DBBBBCIL,~ C)Y|jυIfokq_iosn~YwgJ[Gф ,:'Bx}~~~}~~~|y}|||}{MVkBf,Z =OZ: f *_ ,rkY s xk[=Ā ) L,,/xre x[[[R? Zxj 9:O_n[ax5`ML# !Qx}w!6*$$''!#1*)$$$$)'$#)'$)')')7,/ É  Bgo=#15 ͚ ,//, JYpBy  r 7 5B:;:B,L/9;97 7)BP@>^1 {Y$;;6;? @,,| RBBCCHJJ*n 7,Tx|i܅OgjojXpvn}ouJiNo ,:$=y{~|~}}}~y}~}|{}{_R?h79 ,TZP Lq `L{m{ ^ ^d tkg3ˬ ! [B1}ooul a]]]_: M LJj`ddcjNoW ;l')$'*''!1*)$$''#)$''$)')$'$',*, y , Bjh ,*) Ȅ ',,, „3_fHp^ ;B>>>9)M=::: 6$d[CBB@ X*::9I> ?1#ښ GGBCDGJL,yr /G>{sZ|߅Xiot`Rgj{gsNuBs /;$;w{|}||}}|}{{|y}}|}}WLþYkC2 ۂVW 6Q3ѵ2̙*])_DdnV mmg/d Ùx1wpwMc]]]_5q7: HmceffaqaMɀ{j uU ),)**,,6551:6='''#)'$))'*#)''))''), w , P[Q *))', ƀ **') ivZU# HVW@ d *;HB[aaNNB>$13N2=>>:t13_PL6GCY$;:7;? @* GDBBCGHL$ok )H·7mQv耟Tg~|hˇXnn~vkvJkBk ,:,;x{y~~}~|}}~}{y}{~}UQaXC,7 #IW [N k yG5 y H!mui:q@ '* h}rvB?D]]_^QD]#n pvdrcfffnddQH2 cݲo _W ,,,M)*)))**'*,*$$$'$')'#))'))$)$')** s * `mM )*#$ ʀ )))$  VPLM [I`J '#!$ Vm6Y' 6,$*N5?>=@ q/=OcZIGIL*:7:=B 3B GDBBBCII'tk p=Iuსgn{Y{ʉT`nqxkvJrp:j /=$9y~}{|{~}}||~|~|eR`I,Ȃ> !;e @ _2 my W ;RRtiBM.Um6l XwouX^^]^T: ^TUd`csodTBXVD ***)')'$$)))))))**''$$$'$*)'*''))*)) q{ * lk9$##' m ''$') g ;I.ZjI!!/@. MMPQT,Zx@[1$6QDBBBBe*B^UTPM_$wI5;9=>> m B2 GC@?@BCIhf?kNǺVՊjo}}etπTonqvoT}Nd /;'Cy||}~}~}}}{{{}y|}|dQoUN' !s,Y#fo, C {o NP By?xfO;J7'3 N@rvg ^]^_P9 [ecdHcfP PvLl  R'*),B,)*)**)>)$')**),)))$')$))''))$'$' nl , tp# g $$$# a1,`kP.BH'IMNPR!_v;M 'THGGQC6dDXYWVU_3p?5=9:>@u 3. B@???BDJ1ho/ M R|Yrޞӽyp~[qyYijpl}C}Pk >;.Dyy~~|}~}|}|}|{}{|yldkId. .V;g;#QO /ovX k 3sgU.yt, Q53'qwrn _^[i^;}3ت rtcrglۙX@ рX)$$')*,))*)**$) *)'#)$'$'*)))'$$) *]P , t #!$$ Y #'$$ V;,xpI'w_XB.;)ILLPQ)aoJ1 3V=IIH57RViqZlYo5h5C,9;?@j B@ B@>?@BHJ1grI = eeߌuȿn|W|Znjy{lJ^g >=?x{~~}}}}|{y{{~|||gg[f@h6c v 7MU@ k >} u;ZW 2 Ym yiW¥ Ӌ5xov}C$O^ZZ_?Bp g{h5>o؞]w#$)))$*)*'))$)') D '))$$!$#$$))*)') Xd9, y $$!!$ c #$! U 7N` 9ni6.>:D@IIMPP.mtm25VNLJWJ9aVYYJXjg)g>D@;=BB i .> 2C@@BGJMBQH ]  j ;lwÿp]sǂTno~ohvB`o *=#?x}}~||}{}{}{|{~o~yo]sNj:> )e]P Pc N d BG2 mrc2^  j}t}Bo6`_Z[N6 ]YDf,O|xUu##$)))*')$7*6))) ,$'$$#!$1#$$$'*$ hc, ~ #!!# J 1$!!, B a7tk |v* s7OIBJLNPQ,X6VBPNNLBUUlWWURd*d36>:=>Md .= ~ GBB@GIJM;N[ g[o$ Q w 9ZпǶ^xȁ[ppy|{pMw`~{ .=)Dx{|rr~|~}}y||}}}|{xnadk73# ,݆TZ NX.pk HM6 9Ywc=V, jXV['Z}sW _][]U2.qcxXvn~Q lo` G)#''*)))')))$)* {3'$#$##!$$#'$)' h , o !# >ap#$'! V 6Y9Q   =7JPLLMNQZ톩!YVQQPOHVU|VWQNM.n,D=9>>>c .= 5CBBCHJY7C_ X~Uy  oyƜYqirxnMl`y^ /;$Xy{}rr}}||}yy}~~y{vQrI{R:,ad :Y L ] J 9V wNidG;;,9 92!@t|f c]TM[^yZ ߿}np^9ORgLsoq x $$)*),,9*)'))*) N ''$#$!!$$$$') Y, vm !!! YhJ $##) ,RD d X  J,2VG)MMOQR1ÂY'^VUUPDYZUcHdQ9L1e3C::9==a != 5B@CCILPX:d cqƠRwl. r  2mw{ͮcʁjunCgpoj ?=,Y||k|~~{}{{}}yx{xyuh`gL5 ,9Y,cm2 ? 5djod Ȇi |fR!j} U'!}sqRDQCjxrp #orI a`_cyooY3#',')*,,*,*****,* )$#!$!$$!''$ R ,!@L!!!^$ uf1##* `[3fB^B ,T#*oRx.NMQOG)ĂJd@YVVY^]TjURMLL/d3D:99:>$a '= | GBBHHLNQTB_;akƥ:ld 2jsĤĹpep~Ok_poh, ==Zx~|~~~}{|}y}~y{|ylfRpLW7v >#Q@[BM $o !#R v teT! x u|{}U TU a7tfd#6hmoR,H!5,),*),*.,*,****, c2M !!!!$$$''*? ;{9 '!h| !!# v !'$$ tRykN#@ fY3qWk1OOPRH:˂,~ ,LWYdk*WYVQ;IL/cC:9:>?$_~= q 5CCIMLMOT1haie9t`К y u5͍u̹ĮwpGtfvm^? ;?[}}}}~}}{||{~}}y|xyyfiyJh7X u)'RWW nP } ] ^ Z kf^.yJ !T`x|I7ptZ,nIB5}poiWaxuoo !))*,*,*,,,,**,**,, , !!#''$')* pd /#!n !!!!#  ))#' [y^td]9: Ȁ RQ91]^@OPQQ@Jw$g x BYYe^,VsXMJHL?c6B,9:=>/_!; HDCJJMOQTCmyo|:o[}v_u`a qrȓ˲uGxrtyk`= ==^}}}~|||x{}~~~|y|yxdvXRk;> .TX >NYii B> o )TQ`g`7H5)X_>3cBHZ[D [I@LO x?qooykmor9c!$;*,*.**,,,,*),9*,, ›!!# *' Z* e!# r ')$)daCIl=~ _V@=gBQNQRIRdi,f ~#J]`^2WlVNILI,c1B;=;== ]!>a LGCLMOQRT@hr3vU{Mw_̞o > _ u !ˆv;}yw[gL ==o|{|~|}||{|}{|~y{nZnd`>,T )̱B] |B/f 9 9V 5R;h_JQs.$ >1uLYTo)IXotw9Y roo`qr !D*,,,,,..,,,,*,,,*,, J g !#,PO  R 'N!##!!or )$* qBoJfZ!!; |/_hB6 oCBOBDIoY6V G)^c^'VcTMILM1t/C;9;=? ^v';c MHGMNOQRB@hxV9k]xX|o;r_9  eڅ9rgxdZT =;p~~}}|~|y||~}}~|y{Zi[`G1) 1?^>v)$1 _>l.l Y BZ j`Q 噯 Y='uO# lT_ [ovq !)9,,*,,,,*,,,,,,,,., k ! /!]@ !Wā*`!#$!! Jk; '' @R,| Y q ,]|BVYD3o:QQ@NrLOG BYn,WhTLLNN.}3B::9J=hw/=}q LIJMMQQQTJUi.tWsIyp.lCj ! c @ͪnylYk >; t|}~}||~|{{|{}~yx}gxX}CQ5 2Y7YRU 7X !} c w W.@ff kcM$H δ gwP3yTCo^C j NsVss!#5,,.,*,,;...*:,,,,,.. i#@hl_;_{ ! : ` $ p '#$#' vn tc/k}>N  ecjLVYM6p1DIPw~6lB 5No,YYU?NNM't2B=9>B? hu/Cf NHILNPRRV@Yy]>q}]tyOtx9p3vyVge1n 6c ! H sʍqRm=={~~|||{{y{y}~|||wkRpCY/[ OB9WXh p'R>y#L RoWZPd[.NHtHQ$Grd). Cd@QT3|^ !,jVRrurO ,)),.,///1/,.,,.*,,,. Rca`p__N,[ 7Q  W $#$$$ i )* tj@Lj{ C1 Ze[XYN3̋~19Rxr)vB MXo9ZYUNNOM/1C;;:DP hr#,Cn>IILNPQTH@{Q|i>m{axNtj5kt'~lG^j۵r2 H ! e W{N} ;= {~~{y}}{||xy}{{||t3~{UL`B= 2HcULn .Y;n$Z Tv],e[@)T ,} B W^tx9LYMZ]BN P O||sttt|, ,,.,..,,11./...,,,..Ily|v~lm2;!! O 92 #!$'6 c . Qn ma= W5 ! ^OZYYI3@qo*^h@ Hj3ZYQ@NOP@B=;=@ ts',D$oMIILORUTHJUsh2xr`wO{{=]|*t[HZdl}uRy> x BsBg:=|}~}~{}|{{{{{}yx{|`d[oY=3W :>V?Ğ/?; `CZ1 ʜ] ^_ f_M oH3MvcHYX[LMQY issus~p{ ,,,,,,,,///1./,,,*w~woqpqo~$>v!' | !! x !##')* 3}O 1> lBg$ G;ra^[g^1UeqR~h H T^2YiTQQPP$|:3>>?B@ np$3CoMJLLOQTUV;jwa/ouhyJv}:^u3s_G[cvxYuXQI ^ er=X2;>!w||~~y|{{yw|~}|y|x|yYXD3 Lu.UfLo N$ ,u d XUc]'W^Y )! ޅ,ZN_rY@T'GCN_t~l k {qttur}n}p .,,,.,,./.,,..,.. Yvooqpneeco#', BxT Y #!!$)* {j #HclQq= /YT6ĉoBZN]GwUxm U Y,edUQPRPlRB==>B>xo#,CxJ:LMOPRVWOxj_,ennsU~2Uk:tUDe[tlkjo!OtLZtr;=$>/,x{~~~~}}}{}|{|{~|y|{yuZ *YuLR7{ #WDGZ}Y ]yB!v ,L v Vi}P`M'R)p lN=a By~eR/~B5Yp{Y *>rtrssqof ,,,,,,/2//,.,.,.. ~{nvnmn3vt`lCk!) VB D) $#, c  *3ym 'Rf]X2nwQZZ]R!L}v f Wo,jWRPRRR*aP1?MB@Bn6H/xJJIMPPQUWMtdn*ffvgxX{7ak7wYCgc}gh[d!ahf9kif,,.>,,{|}}~{|{}}o}~}||}ywk975.!$CkpTVMO cR3iMx2V֖$6]*}t ] Lsv$U[?` ul{,*gjdR>apaJT ` j}qstsqd}2,.,/.111/.,1..11 ujDLs|k * ==q $$'', ƔY U^N__,_ZTTLLRs^]YZO9 w J}DmXVBRUT`P*B@BBB }V2G/iJJJMNQQTXQnPi}'`cherWt7YlCpYDnkg]YYZfX@Mhjo,$1>'=y{||}n|}|}}{|{|{|~{v'RexII[[cWW: [fVN5$2C7cGy?]) qPW ɝR,aItkg,]QG NH}Vm OijftJl`IiYDMWIs ] prsssp|h. /21121,.///1/!yt_d{{Ds/) n h? .,***/ eo*H`OR$ OhTQRUWDtWeMZY[I~2?y Ym5ZWURRTT/QN5@BBBB n,D)g=LJOOQRWYNlNa},h[Udne:[WQj`QlV^NYfk[J^Ikp7 /=)Iy|{}|{}|}~{~}{|{~~}xv #=Z`ojUBOTdo ՍTJ3ۍQ Y}/ZwfU L] q q J~j|dTN6!Z  YnopW]Hw :WXY_^d37 6|trp}_5. 22152/1/1J ,o xV Rs|Leg U1 T 62// Y1PIG_, ]JPZRVU#VUYf][T,;̤d!夗l ek>ZYRUTRB7QPCCCPB@Y BH)]#JLLOPRTVMQfB[t5YQIkolYo5[hcrc_gYRB`W1hZOe?m{/ =:X}}~|~}}}}}~~||}|u / :Dj[ao}GJm]UT;.NIBI kB3O:^ `^I9d;N3 Q 5}g JuxB 5 Hijdxy$7PRVYaqg nڦ etsrosa'd '562111>y, J#ϜiIemv,x  g / 6Z !236 !ǔMcNJT_ ҅w=PINTV)oTYYZ^QwJtULD剰X)sm?lYCVVQB7>PDCCCBBW 6G1c=JNPPQVUYfk7an2]ULijXYs=a`Vjy`hPJBlPk#_R^=nq6 ;;hy|}|}~}}}~~}{}{|}|}lI  5D[_tye|_ieαhUJZT PiHL75Pԃ GoJ5α J>|pk̷g7!j#62ؘm1Xq9NPUYWOu s ussos` C 63531./. ;  ygId`u e'/P@su)hBL>qqPWNJZY ^oG LW@7mvOZ][[MmgU`e7seDLOIhZXaVRB=>Z5BBGCB IHH)NLLPQRUVJg|a5Yk)]R?caY`o;aY_ifdB~BIjTZ,a[_3y{M ;= nyy{y}~}~}}~~}|}}~{qH ) /BVX^{pp~~n`PYGZR1u^)y cI ɢD}|_l{x[ q;Xahs^5MNPVWDY16O {xqpra :65111/1  lRhry,;5W** M3la $CDRZ@].G; [ XD5CLNajHY[]_Xp3Ŷ`$Iq1a`NYXVB:]>QGGDDCC#Q!HI.|LLMQQTVUOjxd2X^7][5`PD_jBd`geckZOtNLm`N/WWe=wom ==r{||}}}{}~}}|fvq )$$! ,C tݜOGBY,fu#UU~ O Ze #Q ^ _y*)*6G t  ] Wtrs rx=MOP=@Rf [X osd Q .:633131 t[cU/u},Jaur ! s vt;N͌6UB^ f YCN nyWcOZ]^cZg*˴a ɬG P$XQZZUQ;T:O9GGRC62VH;$|#MNNQURUWMlnf,T^>cP9VY>dhInv|c[QpNJnMZi/BInVO@vYy} ;=#}yy{~}}}~~}{{~}}ceӜN ,')*$!)!! QHVV wB5P1X YjOCr5h 9 _qRkl5BP./BI,L=u3 ous? 5MNM6M[M yH orh /9551/ 5wTIWl|wy H  /23xx m NQPC Yq_Tw`ZQ[[^`gju,ĵx Y ; gC`]XT3aMNGHICG3*lJL21MNPTUVUVN}Z`,H^Blj:XH;Y`GlReXJwHPqaYY*HTZ_WUuQf);=|y||~~}}~~}~}i`Ć2 '###!) dRNmY .?:CVJ_ cC  yxӱ=N,R=  ya X`/|stu m 3MU53RdUl |Y lg ,6322 vvs|qv{yo d3!Th*OM9yD LOQ? jP[ P}mJ[^`fioeH½ ¾v B ؾ)a_YR;uCL5eHHC.7ow6L;:,PPORVXXXGZ];@NBT>U@B`YUsCrTBvJ`fusmZ,VcNU=ld~MX*;/.{|{~}|}~}~|}~a^a oJt1${f}vܱ ۈU s ZH_ajo>QB c qst}{ =*MT1$JY]`e|_ nu 31 ||yxy nH2TRPN$ kjoHLM>O ͓d 3^ @X]ciP]_cjmt`cfĵ]9¿Ī M *WoZV)~LJH7GGD6Ma6MBI{*PQQ_gWWYHNW.PYY`>fI5YUad7tH:kBdjRXN)dT[9Cis=/2=,;y|{||~}~~}}y|~~~d`쯌P C`B9?eTPy T pxcs5|3 >i _}|{Nѡ^[D'M=1sG7) j]2|st_ X 9T>BTcXfQ2|u xy r *~{y{{}OPn9 W !:#rXXVQ> `RLMMOGg5t_@5B/@L>YPJ[_iwqvo7^?iӿ{qYv 6OqWT5}JM:UGIG'O`9N:Ql6NPQVVVXYILV/QOrV]C_U6_Nc^e3l@JsBnWB`BiXYQ3qD#>=#Cwy||}~~}||}|}{}{|}~}ZWw/MNY =]G7,H W? VfoZ#{|xTmN==  m5X  qrtu | I,;MogZh@1yØ9 Ὡo= ~}axvG Gyd Rwcl^ZY;xt '9M>P*d~OB]YMZMT=kCY[djou~6cƺcNJؿᬋ_ 2[WR$eV?NWIHH1^^*NDai5OQUfWVXYBLR6QYUZYHYjBdQQeaBjJPrccqII]=l6^YM}*~x|L ==Yww{{}~~|}|}}~|||||~|cZwRT|J =Tk I ]JᰂVm)q}}o6eIR6 I] fj9r~q2.)9,!!IYdjVq>.wO .İW;xyԝo Y}itkYcTC;1:NO7jwXCQQOOQBUgh[Y]flou}BӴy˾Q5к銚T $]XT9dWNOLILI5cI9P:fY/PRTVWWYY@GQ;N]H^ML_Hm^@k[GoXhg{Go@/kLM6N`O9}vq`==^wy|||~{}}}|{|{~}WZtQy6c jr i e]1!5,B~~|HJ; i6 T̰, o|r{^! h /Rnil`yN$j} ؋,ҩ^Zh,|RZwy ||Tqoq ,59^qo]6POONVOsYaNYcfkruRme¯ɸ^ ̺T?T/_Y>5WWRNMLLI,u3QQ?oXBNRVUVXW[OIUJX{3[JMYOi=[WDlxoYIu1Hoa3OJdj9?~urn ;>rwwx||}|}}}}}}{||}}}X^OeY .@=D!X;X fs9r U#|ZvM_M'}Q]lHX [|'r,$ ~ 3QX^^NphipB 'ӫq:|BOt[I yq |T@ M* PWOQOPQR1RML]ajqcDRo]Cñ} ξQ.t*JYCcWPONLML.r7PP=|aB7QTVWWXYZNZ[TO@cBecWRg>`O_ha}HHv9W]![MYf.Rvox=>~uy{}|}~}~|}~~~}}}~ZWLRiY ;R ,}||?/]e~{lBBR$ /. * erq;$.J 7YZaaN7j w~R 3࿾ÿȤV=h,p|Q Uo mnX UL ntDQYXX^OBPveLY^dmu{~@|nt[Hm̢ L o,J;PTWQPMNL;*o:BP5_DCTUVWXXYPlwXorRP'Y2NYJe^^@`H{eYJCIpRteYh`Gm*Zau[Z);=*yw|{}|~~}~{~||~Z_k`Q~92kY psY_ /~}{?[]O m; ac_O۰',W{r{p' @.ºoϕ'ʜk}d//?_B6ľ_>Qk; ڿUj Wd g `B6_ _IY1NH3DDH xnYPV]hpw}rUiu2ya Z νYChaUQQOLIJ,o?PR:Y:CTVVXWYNLu{VeXG1Y?G_:@ZIDaUPoOLs*anqLHD!k?o72ssR=/:,.x{|||~|~|||}}}~}`[Uy=2{M,N2]=2 #q3  Y6pyyQ Z n,.3}^Q* HMyu ]l q{M#Ğlx|kV;6;5O^hN]QL]đ^a D t ^ r?VC[ ~jDL,g/, W J^}eUp.OBlŰox ; D3_GQOMJIJ5ps6TR1c7QTWWVVYBxjX=U?LPLGZ.;p:Jhf6jLIs5l[9h>w.YOnTyoX#1;/Dx|y{|~||~}}{~}~}~kMLgY 11 I ^>^BGOB=@}{aC'lc@ 3 foM52T rrprʪu n aɤyij~oLYxo aox3hI{n c uonrXX@/H l ~Qneno]kvig}osHh}?Z)ӎc 亽p,,tQROOOJI3;f;PQ9d,PRVWXXG`C;X'U^s>^='f/Vf6m@JoOo}I?q1J=U_Y1nrY >:Zwy|~{}~}|~~}~}}~qk:jP^rID= q`Qi1@, 12}ynGc oB)=:J5,3u)u|^ mt iȸpa`kpe_`V`»Dj3 h ] ]/V2QpeJ mx [Bf[cdV{V``Wk@kmUd ÿ[DNȿ *kZTQPQLH=QcBOPCp3RUWXWZI_V>.R3[Y3a55j9a`Bu;]oOp==nG'NDpG@hq== qxy{~{~~|}~}~~~~}|`el[~'QtL,XVv7I?[Z q3' @YIxwWr ocB t2j*]TI)dy{BjmH1ó1W_q n N m3iU.pI? 'Nq=:_dhkWBpY6dopkhtwtuH C,ƿIi[GRPmLI5eTBPDJqw7RUWY[C DV9;Y9gpQUmX=mRYmMJqUvR9tHY` ZHB/y`{_?={y{||}}}}||~~aXޚOI M3 n ;Q h9Us3MI6~|wh6Z,Y =6=1'.,Le q@,vpBVYyL¾ͱsDq|QI} : [g93=C w)1QknqgcZs`#]oYZ ,yGg|}YT>þYѾjOV^TQNI7|Q@QBat7VXY[M ;Y3CXV>uPXZGcw9q:YmX|HPtGwcTfk/v'yU]>>{{}}||~}~~}~~~kTTeoH 9> N{rs #51 OcctZ}wvB v~Q?3/h I.*dl2r21mx^B)^pyr`2HQ~Z3 سí Ck96.;=D92[ B[hIw{j#Bo~;J^ |uico{W6ƹs{ Qi[TRQOIL$~rBCO;ef7XYZL.:9PHG[f/m=wcY]]>s5mWD3RdW@l=.VGw;xV>1=.9xyy~}}~~{|~~}~|kUo]Q1togPǫax#B {5j@NuZ=}xuYa#W w@6C*gy hio))fjp_jforfDa#ɂ ֳIpa |$s*'3^~) C2Ym}@s6oUI?Y xhQ{drt{xv Ɍ]$LiNRQOIHM*{JRQ7VWXZ_,9B]XTYI}7TsG^iL2t?QvLI.p_2n/P@WY`h'_#B=Wy{{{~}|}~}|}~}nVQJ yT)nnt {j,YBCpshfjgywn7 nW2?dѰ9NVWaȺ nQ qYh~kN?YȾ ı>Y1e/,!]@W IW~*BwZJvB 3;yc2_qsw}OGfۿ`wYYTPOLM?=poBQQ,t>GYQ= HW~o[_Do:Be@=qBBo?@u>[o?Y>5j,,R3mWBhs>>my{}{}}~~~}{|~|}}}}qP:rhGGot :1Zo[I|xuD,QXMI9=rp@xj eR ȷ}*eaaY`m{R/DʱĴjW`#sh  !t9!VXk}3sߤ*wDq{fG|;noqu|dhBD1׾ͿoiU?=QQMM?Of6RR9tBYM2 ]d=lBZwW=s?7l1Tig3q3n_pD,Oh^`BB~7Yku >= sx||{}~}~~~{~{}{}{~~~~dPsQd/Ŋ}yNBH)P3NğM ?To^wl`xugi? W*p'YqojVgo҂ $ݷފޫ հn5`C>iW !!@Z{f{[mlvYhIt[r_WVoqsx|YDeȽȊc[/@QQO2deHP@=t:T,N]W3oByfvBt,B}/i_BoCvNHudX,`U*5'tl^o>?{y|}}~|}}|}{|}~}~~}plGU;jL9 W t5;wastLyqcD9/.xuMxyrYq t.Xk҇ q Ħr ѵځX :* !]1LOxuY tuo2|}Qimpqt|},}!ؿ[Noq,2GP)wQCQHNq$ )BlM'g1`WOuBDmHXvMZfsM/Nt=2}=BX=s5#{`M,>.2{{}~|~}{|}~~}}}|}~~}hYmUlZN? *RQ6VxJjw@1IB]iyhY:M==CX:ao qqê!B ս^` Ȼ^J6Y #|'Unq|_5h{,~~q3]qhu_`PJ2Ɍ5GUVHY}R a>p;=o@,BdmZf}:s7tV@|'odo,>RHajh:vl2='Jwy|~|~}}}|}|~{~}}}}}~}~_7y3P fMlUZYX^O^_`Bh6IrqrXB@UY?W[`mBRNJZWMch~k[L5q;g@GPȳ mҰ ~wjh ¾¯ *x ,V3 ! 5 ! D[_rZ{ }jB|yl^JqpuVlBI9Ѷ_$Ƹ xoLB?3nkZHn7BhZ7;`rWdmV7}6ByLUu:uJ:p9c3p|HPngx >? hy{{||}~~~|}~|~~}|||~}o7[h pppvY?wpT9~orp|qIp~ZtsUiCIacQ=:$j|k9B1} e pÖ B o2UU3 3ۿ !jU !, ,VjPe=~gpv'{tt^B@poowhBa!Żɟ~{6Ѿ}G iLWo[Zk?|6@L?}UBo2:u1f[p,,Phtd'6}>Htna >>#|yxx|~}{|}~}|}}~~lOoU9GYt_IGw`Yr,rqcnY'gXH`#9*c>PVT*m5,ij{TTgnspoIH/WVpc>}DV|ݑ xpv ?ȵ ڵº Pny.H !Wj o :JB:*^w=w|!tf_;xfBI=O[|k|2pmpx.)ŵtWLұ{^|ln$m][iLYi;:u56r?_l]Gs,rNB[nR>cQ,w1 {m]` >?*yx{||~~~}~}~~}|jP?GR3Bum1f3 J$/)5 CMDwTvj.M=/rDw5to ~܉ hf I ֿĻ˺RamQ)޿Uy !;v ?36f˛3!ZjZgIs.N,fattPXomp|h!acLIMȻP@Jd3WvLBs@vhh>v/Cv1l`cj]7,[q56l[TXo@)yc>#=)>xxy|}}}~|~~}{~reVw^~R p`*au Wv^YmRlRyZRkuH=BB,YI i |օ dm 2 Ⱦȿĵ؊Nx=  .~ #'N ]Nkun[Tj۵Xt@r=pnot}^[tRG^:õ*}iYOLn6;o'_OXvMLpTVN{UH!{X)y$d:VPshn$>Zy{{|||~~}~|~~qYUdk?`RNXB}PCtCqVxNl[۔XeYDeVC2BeR {roΈ cJ 7}Np ҿƸZ`P g!M/}r ZI ٮh@qoau,|omoj}7qýn)Ŷ6} rYCj2Bh!7Ckfr_;w2LHYkBW2JgT#t,5CXskNx,=ryy{}{~~~}}~~kQ}X`rB r * l7:ܴ?DxuProagduBDBD)n@,|@jΕ wToX6 eYmaC h ,gXJYr e¿ۦG Ƶ{eHkmmot{d)~ ۹|iC̰Wl$LoBZe>UoPBo2O|Phk?!.)xW9$wkO1cB/. {p`{~ >>{{|}~~||~}nXv]ef WW;ԜJ?2oXr]MWfUmOdRCC?:ksȣ k`TooO5=!#6@Wn`B, t X@~V 1 6e /NJȵߋJ Bpֱ~w^$wj^e`[nMXaܶıDTsDZ}{T9w*kY|nZfd:2|BM`Tw@M~3=2H}#;]eWn7,gs 1.2vx{~~~|~~}|}~~jLTks?aeN,2 ?pdjyrYhZca:DHR3BgTu̯ ~ű 7šdH]waD5>q© YM@ lcX #v :|yyYdOihnr~3Y=ԸX:IJB;o6PwMB|Bv`M;u/LCmg|i^lD'ng]#|6 o@xVInfsg 2Yy{{|||}}}}~}}~}eTR_] 򺐟 kt2Z̤QNuXHYo>{7ITR*hLt~{|T ͝,n M77:7/9**2VĽM s M 7yU: nt 쑃*x޾.dmW7ff_qiY!,µ|?ŵ7 W^D9{.3|6euWOuTPx;cNkTWq1YOLnYv1*B>wtRsh 1#ly|y|y}{y{||}~~}~jTZdDUB?>J.aYXtYjQ`[;hMLR?2:yoiǃ q}3Ŀ| }isBnj;7/ H:l>U_ΣfHNe~r:fiqx~aToWl1ŹldHRqsRIr7:i55tRd_uqc325~;rU~*:^xQ7hP2; nRj} 5!|{yy{|||}}}|~~~~~}~lNOoQ ` Ik #2yy]PxZ:ya)>DUR3Ү,us*muŰ76t ѽ _#NpT 35q] !6 /a2pv aM?_=dhow*WJظHMx[oBwBkhLWhT@}5POLCB,Dw/P>Ny' PwG`[nB={_Z $;|xx|{}|}~~~|}|}}~}~lRgZ~_v et~![U'grcia^/hV@_QLU3Luۛ2ok2hR~UJńŵg ĵĻݩTY !)WI7 Tfh: 9 *v T.]Buu@hnu~Oj>Ȝ e,?#5y2Rl[Le391,/^mBhaN,*pe_'x3 OVY{a_rUoD Nyy{{|{{{{}}|}~~}~~~}oUMroGac;):U3,ԶJgl{uf=f]P;TT,{GvZHs|ijwkU1Ÿi ԺX em_ GehBV sp >p W塢CWlr|r@Jl=俵ғ,ʭ@ Bk;@67BjlxC|/B|2}[~LZv*PNYc[ aDG jBoD s|{{{{|}|}|}|~~}~~aqG[goa ؔZ탽5~R!ruaTY=G]TLHVg[vh9l ,ȱi Ⱦ~ 7w[TY Y# We` Mp#޻tlfs6{oy^QMԵXXZmgm!e`g@,3}2VNapN`jYDB6?~Q/;6uY `f7|3 l[ yxxyy{|{}}}~~~}~~~qJr]opCeXI3TB 雉2o=|kxutkoDYaPٲj;V*Xmul7D VxD |M ɺ Ndp6[2Q ,2X  O6DQ_Ȯ]B 3rcUvݖԾa6ömDWHfk=Hk1;Bm~TgM:,?t.B=W{1 ;7DYkloXLNoo {|{|{}~}~~~rJPcR yݺTq|6d@;|>sddXOk?oGTB3rwNryw2 ]øk 1. ̽ÿa !mhv9 BYt@ NGv@x }te'w!n=`[γȠȹ;9,Ml[jBw67?*;Wo5o[NI,Y{BnB dB,U'_ ~f.7/J,h|~}~|}~~~~w@U^}r[)qB/nH5h͈?Ue|ehnooJXs,c?9`qC}yȉ5 Nɪo! Q= ?Ϋ t/ŰZ)noWk^$ j )^VYdW{r2µt~oY2onhaUӵ˿c9Ƴ_vDĹN Wu5LDNBeeX9.?}6{UymBemH,@opT _B1: Gp|1)W|OQ^D sy|~oDMpnP!UgdO*QN/wUgtZXYuePJ:?yB|Ģ9 ѹȦm Ny7' ȹk'9Dywj=C ya6 jOgWWRȶwZf=]oq**o'ȲȹYWپ`QqWRR>.1fLisBjmDHH,1oL6* ;j>^eiXDfU@,.oxpnlhigw{}~~}~~kDJkpo| j1H$Tf]vfr`tl|I[k2r7,qHs, Bǩl! O? :@PIBRlk$ ah_Oo>2ȣuyhY?diXao#or*BVѿ̣{`QTHejHBv116uwXZR2;MqB,7qgN7|5 JY3Uy)[ //{yxvs]a|~~~~}~}~wIoNmvQ`nJhtd=a{?L|{vP^YjHdNkLmL  ! /|Ȧm CV 7.uY. ~|oR | 7 uJGwķ6)|xZ`Veipgj ,ҺԗƷQl?ĺ {GfXWuXljXGw/,B*1To;sXlV{B@Okeo XBD 7m ;#>w{{x{MW}|~~~~rDU^~f w7B6|>ږ]cnrd|Q^Z|MvrIu9 #:7=:* 5~i [~2 1lq? $J;`@÷WkGxeg>edkovmaZpǽBeG̺T?ĹȾ )Nm gD6XIg[W@~5Mx;N{9CsYq,3 D^fx[oV@oV{I:i{}|~|{yy{co~o5qfN|uJNBNh6^fr:yecxsT`eLYsHpdaP #:7696799, .rοg YųwȊ=I| [gvP6ź~khM}TRXe[mt}qIϵĺŲn9ǽܡ$Ӻȑ$$r]$D, T[ XI,/RQ_jRw]X3>9,9Gap6*, sW3Ts'I .='y||~~|{yxoY~}~}~}}sIOf~i ܞ@kCPf:ZRey|eyXgcd` |lIG !)97:97697667$T. :ɝ[ Y{Wg ,5@xIy^C[w B؟Np$}}tBllns|_j ʹ^}ĻDeRȸXBo5*BC }},$ L}hWy616dJ?N;5lkM39VQ[mo$v6#@ @l ;'>y{~}~sQ~}|~|JxRY{wRWV2;p6ȃoVqY`Q]`Udqn6[y{HO #;6:65566777#|{Y TL `w@[|)5]1?rMl۰=U:sshu|` @hUպZIӹ D=q,VBI/;HQPPPB75 l7 #cڬnRo9*9;2]k@dJjlX!7PLcgipQ;aRrB:_y|{|}|~~|rM~~~~~wIV^X ۝|Ta^vam5io]}aɪcel[naCdqk ~GW /99966565657!LUq}VUn @|ŵU NpTuP6ka;Beh3¦ʭ.vȽlQi|}d r!ŽͿ}'Ƶ@/]{= ,/T>WWTTURTG/$, NCd{B5]p=oR':>L[s1?yVU t!W ..y{{xw~}{~}{R~~~}~~q:YVytcBY2.jY}$tqPlOh|B_sXBoT3NwLZ ,9:7777666556''INlR 55*X G´L N5O3' uC[ǤƿBҿinB{OTX_rԺBfwĵY? hyXtrk_nVgIT*VVWXL3 !Rvd]O.;]p=3DYP_nl {5'1 Bo :#Ix{|}j{~~{~{tZ~~o:Hcf ߓs]Qب'j:Cx~U]qn$jgg`Y6oQ$ux/ ,)977557666655557.2 t$322!D#Z QȵP ,gwLh3,)̺Ldn;Ѕ܋'̺ʲv=˵cU  ,CJMjelPpuBVZ]_dYHQPB>, /pcf/>N.nTaeL@ {]Uhi_pj]^[X3;#vx{|x|~|~|sM}~}~~~~~|~uBMUqd6eCf9u1{Qp_W_`YZQ79OrJ $979669573566515555321...#oB5; aƾ, gg_·Ե63];x*ŹٙefXۺYoHԵOY )>*'22#NHeiorg]vliggeYv2>7 ur~V~MYk/@DIcr:!|> N V #_ =#kiy{|~~}}|t]}~}~}~~~~n1qrMZp i=|![eO~rR~_եhfjoy^dQ=X $$:7777776656652553/,6'$$$=6yH'525 ch  xpr˛T,ȿ‚rXYgaGðʼn@'Ƚ[P̵¦}I Cv C`9 @ ,,;9,BRIwpxw{wlhrZeU_aLR{ ,nw*MU{=BOPlgmx2:=:tYqc;$Yx{x{~}~}qYx~~}|~,PRrX9e7BUkdgYwwHxdސvUYYgcBgظ1I ;:77)!7666235//7##! 6;o121123) U ə|m=vx}~t~}{woN1ŷ©Ĥ[p9m ſºotO̿h6̻Qo`l , 2XXBfaw~t DtqN',OaeeT|pxyvyi^`fGON6:! d,3HaJmMijH @ GZ`vJ_ x>Y$,yy|~~~~}fY~~}~~}|}~~~v9kHZu ̨~| u:nivytqˉmUqjleUQۥ,T ;;::$GG#)33=7!$#323123625357! ͓ ܝ{Z?qmypqpqrsqpu}_n=M:yJĸď;QɿM]|׏ kWĔ *!=dO$ I Ps{Y1! 7Vasusp~ojdc`cWW/)9 BZOU?Uhl6By, N H 5o :,7{{{~~~}}~}o`}~~{~~||qBOXnVLc;oN7ºﻤp|hŦkt]giWRU֯1} ;::;d tW2;!#),.//11?22B355#7 ̟t:MlffeYegjijjofI}HI>`r ̽ȸV| ͇7 qYe c ,./.3)I|X6RN6 Wwv]i 1BRPcnvuuxqjuUaaRH2k. ^|_7N)T.s[$x5_vP@de_[ :_x{|{~}}}}}aI~~}~~~~o/xgGDu dҶ~fipx}sxij`crcYW)h׷,Ā =;9:$atqn7:1!',B/11..2533336 ƥwL5ia`___`accXY`xPs{|}QZdo!ǻźֈDX!̽MmYԗ |wv > ,1/216ot7YZk g|V9Hr?`aqrgmmhkjpdIUBTRD'gB o~}p1I=Ngf Y ,Z*|{}|~{~~~oW~~~}~}~}}~~~CXLtX[|L{h qŅ9n}rfаuneZl]aM/]BtČ M9;:,2HD=,)$#),.1.11/1/2235 y ŞH>k^_[ZZ[]RONtqLilnoqppqswn}}ZcQhVdշNd!VĢ,oǿG ,  #/12577 swOJVxxYkyq`,/#7Gnw}tjfx[gegP}B:=U2 UuqUs] C=}>YOQtu,1Xx|~||}~}~|}`Y~~~}~~~~}y>sI= >3h̲7{~l_,i||YܻgdY`'uJnYi G ;;::9975/$B'$,./1./1213135  ǢL6j]YYYXNOPY[@_``aefjkkmqrrV|jI] ɺ~ ٴl>`^uGپh 3 k !$* k 5269:@B/?y~hj t,tNrqtwkUw:=Rc[wrlqwltIdcO7>)C ,..~LxI#i >3 !=}||}}~}}}}~RW}~}}~}~~v3QI^Rme`hgq|{ĕZ}I݅l_mhZaJ3BqkW M!;;::7?@!6!$,.,.112/2536 xQ1hZYYIZIZsNQZZY]Y^aVgfhkmYwvDxot/õ`Uo࿨dD^իH  5 $) 1 69:>BDJ$ost޺[ 'P YkNv~`yo[G/Lcmolhrm{l[tYecW)=$O|r @;P^9Bo :!B|||}~~~~~~~}|Ya}}~~~~~~~~:{JI h5lPXуWNvjągme[muPqfYT;R~QYC H;:9:561O!)..///211156 3>aYYOLTrk>MVUWYIYYh_cdfgGCn{r}ugaQĭo ŷ]YkyuQ* 1 Z !) ? 77:BBILB6}[P_޶jxC 3_wky|txB$,1RoumdekfgL[VTTMY$ 1c| 'Jy#T=7:qy{|||}}~~}}PV}~|~~~|~~~v:Y@dRUꃜ$M_Ͱ^M~}vjoxcw:oYaJZ.P9 N =9:I,)$:#*,1113315 MCXJ@Iox6:XRTUWTVVXZY__URuBfglpquw|YaGԸ_]Iݠ W '#* t 9:@VHLN=Y}Vg~oZoq Oxqq`~}{yx_ykZs )/Mk}pjkXiphfJNNhY6. 2,Q1N` ,$:|{}}~~}~}V`{~~|~}~~~~}>N6~j?=ȔsXhiw^‰VylxQpU]C6ަoBڵGy W =:73*#)/#Tfm)321235 ¥2JJpU9HVQRQTTTURVYYZaVYanejlortx|[,]q ȹiac޿ , I ') !9=BGINP7o|uvjsuNxUw~}}y{yywugtvqZMP#3@_phop`pgcdYJ[YBlr j[OB :m{~~}}~~~|Y]|~}~~}~~}uBh=T^볶Ru;RyyUߔ~pghfxmxP[UQ)t_2oV R ;9B.!$$#)/e) poC@Q2123 Y/n@RQQPPPQRTRTQXZGVNR^]dcgloqrvw{XNiȿأ},׽daD9  ~p )$, ` '7?BDMQ@MucmŶ|{w|Xwo~{{yvs|txolg@T76UI[mth~qf_^WPR1U=o ,#,{}}|~~~~||~~}}~PX}~}~}~}}~~w$H>Y6tI!fePmkkvnrrĞO~W]J,mB,yԍT X;9@,#!,#2',1jXpgB!112 Ʃi>B?BPNNPQPZPPQPQVIYLDYY^_`fhllpruj{w6TWBȿǿe$7= D ,, ^ 69>DHOT5u9BRMrXuNxok|}|P{xvdjtrslfUPq:??hpocyBgqH]:Zy|}~~}}~{|^`{~}~}w,lCQu}CׄV{aZi|llxxi˽tqwΝ^^c]:Uy6 L_ Y;:3!')$!,'/nx31.3 iY7>BQPPPOOOPNMONOPV>jCBXiY[^_adghknf`/jؾУxZrsW V {t **, @ )9?DHMQI=oY $PahfyxUommq~|{yyuBvut~5cpo{ImCG9p| BB@G]T:X *.{~~}}|~|}}WV|}~}~~~}x=R.NymrvDpe{Hé|}_ypmhlovҤhUVIXH7Vq j:9>#R!!!'#';#21/1 ~ BITPPPOOONNNOMNNON:@mo@JWVWXYZ^`cdfi]_Cvȭf={ȾXoTJY' ,* u 7:?GYPUN_o  kƏs Okn{wluVp~ar~}j}yvutk~turqtyouTmO|3;r efM^:Xx}|~~}~}}|~|}W^}~~~}}~~v9|LHyoC}2щZn^uc߂poސo~pҜau=C/c j 9C2#!2!#*,,../.1 ƞhR=XUVRPPOOOMNNONNOP6Ms=VQTVaWXZZ^``cgO]RxOt ԘH]i6Qv ., $,7;BMRWMGPɉO ! wȜN >TZQZ{^uR}|Un|yxJfvt@}^qyyVcnlxMk Y:W !>$~x{{}~~~}}~~~}Y^}|~~}}~~9WB`Q޶R2QsoV~vsycvo^Ow]ŌY9BGPk m :93$!!!!''#$,,,121// vVZWUTPROPMNNOMML?:6Ye6;QQRRRVVYZ[_adOfDqwpտ¿W]ixa,_]Z  e *;@5PC) TXjor o NYkoeiry_xoh{r~}y[wvwsYfspGgpoyqg~OTqL}[ ;V{{|~}~~~~~}|aPy}|~}}~~~~~9yxO7P>_Qhܡdl߭Nsgؙpm|{sQ򍺢_hL?C65k'')p t ;96.!!#!#!$;!!)9,/./1D2 tNZYTTUOPQONNOMOB5GmwH=QQPQRQRUVWXZ^dMsIkqwYNgĿބ#yBTR wB BkM>@Z /x[  7 )LMg~nru^sHs~~Dj}Vn}{BcuqCfrrr@m OGP ,'s|xy{}|}~|~~~}}}|aU|||~~~}~||~}~y'oLMo9kGs։c`֔yq˔{ltPXt_GBYH/;:s}Y*1 y :97BI*#!!!3X#$*,,/1/// { tLXXUUTTQQPPPNOBBfj;BNORQPRQUWWXY[TPtHfinu~Im[No̻Wuu f:pIi]. xNJ` ! Riusla{Y7o~vNyyRYvvsqgDM~p:N6Vu{{}}}~~~~}~~~~~}}YV}|~|~~}~|||vLGCC`֠jn']lmqlssiR/ ^hcjgnJBU:/)y | 97799J$##!!!5$,,.1/1. ~ åt??XVTRQTOPPOD6Wyd,?OONNQPPQRUYYY[PJcgjow]ֽe|3>=B9U)@ggӞ  ] p{oplqT}OlYfI`|x1dvu6kQL@ *ww{{}|~}|~}}}~~p{nP}|||}}}~}|~~~y1kBBY/{UZٞ?ȩeo`}fҥUxj{vlipe9~u p x :9969CH1#!!#''*)../1/ | s3VjXUURRRQG9LlO:NNLNMNNOOQUVXYZLpQW`ghor}gJcǾ¿دaB` ePY?Q:,5fU}, .  ,DfowpvR3>q}[jnwxrU:Tls,}7 6Vv|}|}~~}}~}}{|~~}}oP|}|~~~|~{~rv.ܯ`=mj)Pny?dvZ|Coŗ~yvcs3 pf ׄ 997996DIC)!$$!$$!!!;*,*/1221 } r,VVWWTVRV:UjL9@NMMLNONQNQRUVY[LyLWdddhos{Mn$ʺT{Bsnd WXjiG`k3B?l gy  MrP[jwmovv~pT|g!aww,vC/ W '#}v{|}||~~~}~~}|}|{}y|ynO}|}}~}~}~}{~~~~BC2@{XؕhRuHQmvuױYlXryeyxhag1˔aM] ԅ 959:76:96H)#'!#!!!#6#$,.,./122 o p?>VXWGH:Tlh=9@NLMLNOOPPQQRTWPP{XVaddeimrP{rO{^V ]NM5;.2:~cY=;Ġ} ! [QVke@qry=wMytB 7Qi cLYvy|||~|}~}~~~~}}|yyylN~|}}}}|}{|~7sJNkBTCYeglyyRoBd|p{wjiÕȕhLy ԋ 997:;;9:76.'')$!!!!!#$'j#$$*,,.23/3 o p,$eYGRgogD=BNMLNMNOOOQQQUVWBWOP^laedflr|QBڽP:YBGl~ HTkie~mdR;2:r|@p{ s # :XoPu^uwLR i BT7~,B#3||w||||}}~~~~~~~|{}|_R}~}}~}~~}|~~~~xIV3{_3JMu|uprfrwuuv~vuLnQěYŘoy ԋ ;97G9:9967?#@))#!#!!!'H#;$,,,/3313 p { PNl~h;7DOPNNLNNNNOPPQTUIDN}WG^``ccehms}c~`]Mf|t=kC>G,@JYyqLB,PVh HQ P' LYXM=|ey_!mCeO:2,ly{{~}||o~~~}}|{yRQ{}||~|}~~~NtQ3BPǥT[VQ{xu|{}smHnql``mթěQYC6o ˑ =9:;79;G79G*!!5$1##!!#'',..12363 i t,`[@>RRPPPONNNONNOPPRRVH[QR]^aacdfioujo1ĽsxQ>eJptoc|P,.*=aGjsQpxf|m | .@Pkk, r9j?@l'{k )#C~jxy{}~|}}}}}~}~}}~|{QG||||~~}|~|}~~~jhlCIXGi3sDlܤo~|nuHoąej}eG,}Z ͜ ;7::9:9;677>'!#$!!!#1)..,/22335 i CoN;BTPPNOONOONOOOONRPTGJkyGO[[_``addioux[o1ѣ^;ZiioDBf> Linda? G M M w@?'* 6aYGm /O: *,jwy|}}~}~~|~~}}|~{||}{JRy|}{~~}}~|}}}pp t_n,w9HMu|w|njynnnPLVf}ksUҢ ơ :;97:9:9577B.!#$!##),.11123235 h ZX|Z:GHUVTRQQPOPOMNPOOPPRTJDmJQ]]^aaaddfj~tY3>^)m.;oyT@ )n~U9 OU@ZMci,j͛* D~L9B g! l#>pu#O=Vxy{{{||~|}|~}~|}}}{y{{@R}}y}}}~~~}}~|}}U$:{X5H͵*=}nw[|myteplUwd|xtrYdIi 9;;997996973?*#$'#)*//1?3G35565 h iNJJVUTUTRRPOQQOOQQRPPPVCgTHP[]^_`aeeffjnW5Z| DQ^ZVBt !ȚL!nxyRX fn |w O;J 7UD?wW`a GPI=e /,2}y|}}}|}}}}{}}}}{{|}|{xy{~QP{{{~|{}}|}|}}~|_oJl;NMssևc6c]oڝu}rdwqBuh~xsf@kW3} :9:996@977666>'!##3$65,>1233533515 g cGDgXWWUUVUTQRQOPRPOQQTQBInPNZ]]^``a`ffefkYUǿԔawv9BhYC)^бcɓ_# X '1OZ|1hv'yqݑ]QÛedh]$ yf@Y jqpRT)q` rYs5d1$.[v{{|{}}}~~}||~|y|}~~}~xy|kM{{{||y}}}}}|}|}}}~dooV*HܪX/prBTXdexؐ|ucruqrwvj}vqVHxH'n =:9887776756552'!#',2323H3253553 h l;UVWWRUUUTPRROQPPPRRU?9YmBOYY[]]^aacdef[cYm׻U@eYGQVφUYIcĦ| CxhXj 6lrnPB., /{njgvC 9}˿ Lx1wuBV W_BHwDH.$jrq ./C~ty|}||}~~|~|}}|}|}~}}}~y|oUy||}||}}}~~~~}{|cmoofG,Z,Zn)JRextr^qkYoso}uoRMgT,q :98877777667673G@ !#:33333635533L3 V {kMTkYVTVUVRRTRRTQRRUHJRnP>MYZYY]^adcddeZ_c_6fRZBCR@J̜uNBI]~Zc[anmыssӅhjT=5LCUoWJD |p een =LO ,/.j{y}|~~~|}}|}{~~}}~|}}~|{pOrxy}{|{~}}~}{||}Ylk_mcY,gq|?6D,BgqChuy^vxBs}p|s`LgkJ 98856766787666555B)#(!915G22332363333 U iZ7RhYXXWUURR^QTTRRGL>iu?CXYZYYZ^_``nddXYgQN |~>xJ[s;JU3yq{5Yudli}_ea RYogR [!T?H7f}Q 5v'7='Vsx{y{}}}|~}~}~~||{|~~~|ymJ|x{y{}{||}}}~|{~|~pmvlllo^TQU*'Bn`3QN=ͤLkm~۹BfΟnqao}{Qyxp_? 1 9837877755888876463?9,'$" ##*-.1331/2353333225 J hj2@aYWVWTRRRRTQRTL;h|~D>YXYY[Zg^```ccfYcs[|j N2I{*26{XLD2LPofr[olnT yy| l U I]'pn *$=}xew{}}}|}~|~~|{}{}y~}~}~|nCy}|}|}||}}}~~|ammmlonnoc`iTLH,$#:lv۟T2eaT{t}ޭ:oޏ~x|_rq_}xkwpZ9` 085777787553127787766;:2199:<230323/2321222333I giDBadWXVVUVTVTHBGRplBMJYXYY]Z[^^aacdYdtQt~N,B`pT|ko{C;U^pjj;QR9@MJ Y;@]QG uo[[n ;QG '.#[wy|}|||}|}~|}{~}{{|}|~|oNy|{}}~{}|~y|}~~}_xvwlvonmodorpMZfgRh }I$Vx:{vd{ެ?ĂplpkpoHwxlxeT@j ;857777777789655433776666565543324422263333533 3 Qi56XYXXWUVWUXB>hm=NMYYY[Z]]]^`_`aeYotY}u|~;L^wx6[U=D_khPP'P,gIou j?woa ^ aG? y!9yu'9.5Dwrwx{}|{~}{}||~||||{|~|}}}mLy|{|{~{~}~}~~||}7Xkoo~}~conGHI]! =}t@,C.ajxl۬'voxs[rGyxycGB ;8577777777777788765567777766655544433>54533636 Pl5/DYYXYJCDO^oGDZYXXY[Z[]^__l`ddYprYnrw|os=}Q:M2?o`wx[UV/cpBaOONQQV=iY tur ^ Tg^,sn =,3ouy{}~||}|}~~}~{|}}}}{|~|~y|oP{|}}}|~}}~~|}~}} >ORLZTVkvufC]WLM ;f5N9Lyq{{ݗBpsׁUqavgq:X r;847777777777777777877766777777766655444564345/ 2{# PHYNHJYpy?GNXYYZXY[]Z_^^acUXUrcYlptovqlaBx^6CMfTWP3fdM3J3Q#d e o} W6GiNQV >OM $**Ywwy{|o|}~}~}}~}|y|||~{}~~~{||xqR{|}y{|y||{|}}~}} ! ),BI[PUY^yVTRVh|Y^/O=gCystܘIxsېUa|upt;e p<937777777777777777777777777777777776666565665 )m! ͟>LOmkC@OYYYYYZ[[]^__`cacYkTamnddiWNGrm5GmGU~QBmjR'fxrO[xkVeUoX7U vq |n#B #/v?,=/Trw{y{}}}}{}}~}~|}}~{|}}{~}wqd}|{||x{~}}|}||~ !#$$! ,BGLMZ]]esqYON`OuiܫJەWOwfk]R ]fp!ZPyoBs]ZmM aQ$]L'^ ;B^ ,/6Zw}x|{}}}~~|y}}}~~}}||{}}}}}}}~{xoW||~||}}}~|}}~~~ $!!#!C }7@Pw?{n]Zɱdt{yayTulv] : 0937777777777777777777777777777777777777777776$) VytORLU]]YZYYZY[]Z]n^[]]^agZe{RII.#]DYs2=IJJno[LNWon[B{xgHZYDBI oq| s*Q, 2aN*,Ueu{|}}}|}}~|~~~~||~}}}~}}{}~|}|~oWt|{}~}|{}}~|cxf  ېo*YBR}^d{]kms~xqxnurdYr, /756777777777777777777777777777777777777777777., 9.)o'Z^j^^[[]^_[[]_]^]`aacWPti7 Y:kt3.~cdN_m[V3a{NW[H>2[a h|w3J hW f 7.o.,=.M_{ty|yy||}|{~~|}~}}}}||}~~}{}}}|}oYt|}|}||{}}}{~~}~D˛k2 ȫ^)O{J~Zowiomxlƌggv`{]q> %986777777777777777777777777877777777777777776/= hJY v?5cc^_```^`_a`aaacfYfi171jnC1w`Rpo?/hvT*^r{U!Y]n]tm=L> a{;R to _[:^ =,IYhy||{~}}}|~}}}|~||}}~|{y|}}}wcG{|}{{|{~~||~~}I֌n â].UxJvVqwht[luȥ`V{wcoZ|? &877777777777778787777788777777777777777777767*T o6lJ'>2dIXIXYTJYYLRGXR[^Xv=3po2Ctv:ONuxYLRpWBOuqo2MP5B P l{ qhCB1[| @Qf} ,=,Wfx|o|{}||||}|||}}~~}~}~~||{|||}}|oP||}}{{}}~||}}}~v;̐N*hwQxDwugwщ]p~´g]xpcgs3 '(977777777777777787777777777777777777777777756.[ o>WVsL L_]5 )LWhYB3uaL_m{1,UJR5iv@V3rrB:#Y kt xx[TBY oyr Z,)$eP !=/Pavu{~}|}||}~~}|~~~|~}}{yy{|y||{yoV}~~~|y{{~}}}{~vGփNv{yPDvwjțQot{_omς> ,$;677777777777777777777887777777777777777777577j qBQG$ ;^l:@w_gcgr?ZuqJ:nu?*kjL#[DqXgBG?h*DX w 7)q{H,.LZj}x{}~}~~~~}~~~}}~~~~|}~}}}}{||||nM}}|}||}~|~~|v>Ȁ>/~nHIxtpɣ`xo~Xj~7 ?998877777777777777777777777777777777777778637,n qP^ :L6,Io3u]JwI}vcLfBrtNBXoP6YBqJ^C*J T uk[ me T'k@5;,IXf{wyy~~}~~~~~|~~|}}~}~~~|}{}|{||ymX}~~{}{}||}}|~~r5uJYkuB@wotjinofjxw @=976777687777777777777777777777887778777785469؀ qDi C,OVDtmJ`ivMm`@@yBTW!iDV3oa@L Ys vr` Y{o m#MN km'PvHM =/9Wa}y{{y}|~}~~~{}}~~~~{||}||x}^O~~~}{}}}|{~}}|wB_[vMGalw{nn{Vu` O :9:957667666;777778787777777777777779777794/7+ Ӈ oJY,>QgeW~tL_!slMolI2]t2dhy|U2knB/]tnxj}D?7V?Y nx}r1V,Or);X}u *=,U^lty|||}}}|~~~~}}~}}~~}|}|}}{|y{|nP}~|}||o}||~~{o.v[jwCCagv|avoxlrr}v f979677666766>677667667777777777777778777796.67 ͔ >V1ZV1 )#mHB{ePkdJPrLRocUJknvW3Y pgoB2M ] ~U V_ dd.*:`k ,,/P^k|}~~}}}~}~~~}}|~}~{|}}}|}|{|}qH|~~|{|{|||y{~}w:눻q]Y܂9Dggtu[ { 77777766935664566567767776777777777777777;4/46 Ǜ ȁ5B3=X DTku`DgrCHqBiks=g~T/_QJ,qm_OL] }kx snC6] t ?!j_ #;2M[iv{~}}|}}~~~~}~|~}{~||~{{{|}}{}{pM|~}~||y{x}}{~p@ؔqafۉ:Hf{qatvo} Љ 9796677763655566'9"66665656666677777777668+677 ǝ Ƈ, 3>9mo[OVM3 Q]7yeM7t}?ZO9Z5ke)^xsP}[O,hTp5hP@ hs a NjwB ,.5YYxtw}~|~~}o}~|~~~}}}{}~{~}{w{{{||kN}}}||{|y{{{{|||{~{@oX_ԗ:DcsZjrur} ʔ ;::5776666567376A&9(764544566766777747669: { =cvRGCIYZ^^_cUJ2 di_{uBIO7iYvC'plM[5[!hD;N Vye o et_ 3 PwD ;11T_tv|~~~}|~}}}~}{}|}|||}}}}}{w|{|{|u?R{}~}}}{y{|xy}|||r6mnNdʘBRatsdqoq ;7:76796C6775566 O-^V55$33446467766646537 ū|C ,IPUUYZ]Z][][]^]B/ >Oy2~GBjToWUJet}B6f g5qVY nT/Z N U ZO}) Tp{}~~}~}|}||||{}~{}~~|~|n|{ylL{~{~~}|yy{yy{|yn}y@Q|tYZŃMyHa|ȏYitf ;67:577665536666 i>@Nc+9633453436666443555 o` .#=QXQWXYY][[YYYYMGB^xf *,mL6_oq{I=Y[R.wv{~a^`!mi qa#x mt]7 2f 9m,nV~  `w}~}~~}|~|}|}}~}{}}||}}}}}||}}}{YL|{}}y|}{x|{{}yyyuCootNV{YYPewojf{ ;9:9767667565966 @QRUW.W62532356446323137 t B $,/)CMQTVYZ[YYXBJBhpx3 $# ZXZ1daYT.e9UkoNccP^7o:dGL _ YsW$)a5cCq _@Nyr{||}~}~~~~~{|||~{{{~}|{~|~~~}}|}|'jfJ{}{y|}y|{{{}{x[t9qyYTāoVD[|̌ge}{ ;99766695767*)7'; jDL GZ3353313533553536 Q]Xp ).6BJPTVYYYZPMXoG,;:9756*! $|{6o[B_)rk!dUTTZP3gM@Z Q ^rD rn n^Cx ,g}|{}~{~~~||~~}}||~|||}~}|~~}~}}|{{ ;O{}|y|y{{{{y}{|{[vBj؉RJ}̔NȣYarkw[f~ =7977663795*'I,  9)IB'!d352323B525332313 URooB !!!.5@INTVIHNkqJ75C>:7521/126 ^r9 d*k_'i~5}Y)}t`>XjB_!n5c j {}{ mjc^!om wm=VJ~ !'>Q6{|y|}~}}~|~}~|{}}|}||}||~}~}~~~|ueGW|y|{{y{x{x|x}||xXBa͊XIɖMZ`ZhU { =9776766567/UH?)$! !,=y)5225233332522323 YLroptiHR=72  #=3GNjsX6BMGB=6621/,,2 $a  }Iux6~sY^wuPDvrUp:_ os i s [atNi^Ws Wm;LeI #^X!nau}|{}~}|}|~}}{||}|~||~|}}~{}{}}}}{{x3Wjwy{|{yyxy||{NnBWyԌRIqoejp_^ Y ,GD76666325'Lx 1 p,G )7531333232312331G2 x YMcigvkiRYU_`[N@#7 3eoP29NMLD@=62/// Tfh .,..13# _ NVvXsU]qiP1|ylmuhO*fv [}{5`q Pn/@Tx QYWVMl[Rmvr|{|~~~||~~~|{}||}|{}~~~}~}~||}|||{y2WtB{~}{{x{x}|HBPךX?~uXoqpo^f G *:'6$!31123! D*| =,_) 6722222123332235 d [Igfgow]kRONPPGYagv=>JCQLLHC?:7//, ,^5 ),)**@! 9~ Yy{lXYXBJw}^ qx[3wW`Rq_}k2j| V| Lj 9N Nj}|m`qk}}~}}~~~}~y{|}}|||}}{~}}~}|{{y=YWc{}}}yyy{y{{NIPêaB|epZmgio]. ,77Mh{J,.1> 2 ndZj5!3322121233323 T Z5hfeec^]ZLBCcj[:=GTRTOONJH,92/ Xfn )*'$$$' Gy ../* 1mBZI]`iQ ~y.iGRj5,N{g ~ 3 nl Cs[h},H Looh_u|}}}~~~}y|y|{}|{|}~|}}||{xn}{:YQnw|~||yx|}{y>>Yd@WgY`}pr_D .Ie` 1oL,.2 'GVM{ X,py),)22122112225> ug#ceefdWTVgldC11BHVUTRQPNLID;$ Rc #'$$!#$ U *)**,./ iH oB6ZRR yt{5pUvZQ Zg n 2 ym isq 6o,`gktp}~~~}~~{}|}}||y~}||~}~{{yy{}}{?XWov|}}yxyyyy{|wCJBxDVemYPqZ~^}o /,V^'*,.139  w# `W79G .31221222/23 , pi'X[RVUnppYumhULMIDDPPMMH.,D_[ !## W '#!$)** a^  ?d^|3uIc xurGjRGW meg Q ) j ;j,mxup $*;r~gBYo~Uko~~~|}{|{|{{}}{|{x}|}{||||{{PXWmv}|~|wx{x{}}XrBeυOBrcwIdYohom @'',,///531$'GOB[ 33232111/16 YZDpulJ/Nmq~nhHM;C?BBXcmu )!!! Y $!!$$#' [n *, qt M?6e oynT[P@e v f j .Ydy^ piw[ B?1j~vjdgqousPw~~}}}{}|}}|}{||{{{{{yy{{{{yy{LTWnw~~|{x||{}}isLqYN`^TYymn .5,,../.22335# 9>` DC2231221123!' >vp`W!OP^`djkm[_]XtecYmp,*B=D72/,. mo ! [n '* ]q *71Yo{ H:{ ixnQYW3c yy oW6 M6IPe2_w@!,;?B:1Z|gt{gx_c}v~}~|}|}}||{{{||{}{{y{}}y||yL[}Zow}}}{yw|||{y[sIr^McfwVg|{l} !$**,/1/33212335595':M3521211/222I; *mroYJQYUZ,gl_cndpfdWc[QTg= ),H6B@=H:D' /pZ ! [o #) e ,?6.ct=@D= ?@v tjaYPp| p~ f: CgCn7[Nf3l|kH,;=?CJ>ix`}pZBq|~||||||~|{|}|||{{{||y{||{CjXoy~}yy{x{y|{a?oxPUesi]ohp}a ,B!$'),.//2512132322555212131132J32 B nBU7Rccca^g2QYsohikklaXksV)XifsaJC6;66B2/ZwM '!# ks !! mx 7,#cq.9XY^Igk~ C oPQ_ ly `d}T `BNkP=U,l$#>>=?CLQWYY[joZUr~}|||||~{||y}|||}{{~~y{x[^}dYy}yy{yyx{y{aoBdȆRYu`gZi~~oo w '!$,,.1121112/3225B5235511/1J3112$ Y v_C/Yloa^fH XRQBPRVje^ag`YB;v^d{idI?/3f{/;752;,)' lm ! mm 2' _p1CTXNUmmQfc[T YkM]j pk N/^wi7YI nG5G.k!)==>@CHOWYQ}{aoUk{?ov}||}{|{|yy{||yyy|~yy|}y{|T]|1{}~x{yxxxymlMY}ǛZJiQYf| U !;$),,/1313323512352221135@313213$ ] h`c.*=d]]pH,eQN/7 /d[Xdunsjj '#=::635) on  s}Y . _q,5PRXJncPPegOZOY> f _D7as ?N{ q.NCDuq$>:>BCIPUY^RHwXooBv~~~~}{y}{}}|}||{{|{y}}}|yyMY]px{y|xx{{jo@YqQnkY}e~ P ##$,,//3232225133313@2532/3232226 m vc|cVTQ:Gjd7.YQN1*BZojn^QwusvY|jP;7.6,,*w` * .rR ) p/INUHvtOVaOXVZfghnOG #RBdo 9Waqm*eZ/==@>BHNUY]c[aᆃWMTY[~~}}}}}{|||{{y{y{yy}{yy|{|}{{yPZovwe]tl{yyxx|wvo:RTgqse|x] X $7.)!),/1/233/3335212@212121212232# ӆ vlhdIYaW67T,!CMZHmfyh# 5Oo=|veP?@l` 65QwG ! m )BHBNlaCWdW_TYdefkR_PTYMVIm DMos J}d] =q,rw21>=;@BGNRW]`gog|}YXY eZ~~}}y}}~||||{}{y{yyy|yy}|{{{|wuPIvxxwwxy{{{{{>TUoDooXqj_l *!!!'),..22@233322@2252135123/3212 }O7h_H=ZLB]agkx|^ 1/$ ,NqaO}pkyo[uqQ !, [k* 3. pp =2;6iuHVd>osLe_cdlMUJTafpdyVC, ^T n,$.i:u{)?;=>?CHMRWZagm|tQ_jRw[@ ԗ}vO|}|~{|}{{}||n}{{{|}||w|yy{y|yyxYZwwyxvxx||{yyyuTx;d{Yvcu!r.2!$),,/1/2323231@263222332113133 ϭv CZm_l~ox|O .,)**,,,,15' UG|rlt_YG*$itU69C6Qdo ,?tf '$2/:hv;Ta3poN`^RajRII]_eokwOYg,v`C1D ~ G2BOLt^);>>?BBGJRYZ_fvrtw{f~,67{}|||{y|{|{|{y{{{||x{{{yyy|y{v|TRywyyy|y{}||yyx|o=i~edthjxY3 !!!!'$).../3225323232525212/253522 G|kg9 )52.,)*))$*)..3 Bfns)X^~`=B65.'j@!5M9Yj@5I5)Yhc!7RG>HhDI`5^M^[[U]^G`^aVnvsTYpunTf*McBPg,`Gg;$,==>?@BHLQY[_el|uxx}}>=Mn 1||}||{y}{{{y|{yyx{y}{}|{|y{yx{xyYOywxxxx|{{{{{y{x{{oq=]ftfYwkd !$?$!#)*,,.12533B533352315122322132 XsrRBG.>.=C@=9532.,*,$)6$, Nki  ,.HDLQRop?2?RVmXnGITRWqm=,@JM1okl)MJJWNMYJTTtsMI[_hVrRei*|sLgd]}w*tCc!===?B@DHNQW^cfkrux{y{|qgZI6] Z~~~{}|y{}{x{y|xyxy|y||}|y{{{|yyYXyvwywyx}}y{y{x{ygqBn}rZkcry/W!3] $)!'')',..122232513632533321312233 or@vrn:1ghT@2O?NM7BB>=962/,*)'))' ;mdR .,/,.3 ap{^YkWGg[R17:=[hpDGX;B=dYL#B7^@GWYYaJo@MZ^gQoOei#~{Xe{PUY#uBYWI#)=>?>>@BGLQW^ahiquxx{y{{{jR ,q }||~y|~y{y{x|{{xyx|}}y{|yx|xy{xyYPyuvvyw{y}{y{x{{w{oC[q~klrfjO _ ,=#$$$*))),.//3321325752@25@22322213 2c?H~sYCPOJJHBB?=:751,.)*, LleW ***,,)*, tB 1>Yv[71GQQair;M`_aaip=1^:i..9B7dJZ3ZZRiRYMaI:}_fGOYQ@ZkQxm',1@=>>@BCHMRX[`djpw{|{}}|}o}pqo@qB G~~||~|}||y{|{xy}y|{{yyyy|y{ywx|Ujwxxy{yyy|yyy{|y}qMky}][_Z ̵ 2Y 3 ))))*,.,223532336632221322232332 w 2g~u[:Z|kTOONJHC>=>:652. ZkfX *)))*,*)* 5t `Wm{ctpouly{MvgOTJDP:HQDXcXC5U@_j]UU`L?~GckoYg9XYyiZB$*/>?>?@BDHNQX^`fkpuvxyy||y}||{}|yuon[, 5~}~~|{}y}{{yy|y}yyx|{x|y|yyyxyxw{hTpwywyw{{yyx|ywucTqmtihVeq #l eθr' *),,,,123255332323353111221231 d 1O9Bi[>2X`P=^JGC>=;99 Li_iW $$$#!$$*) n}u Nao> ,][st}r}~|oqN|fJc.lvDGOLY_Bqy3=DCCYsWae2mqnV5#^Xqn}l{T{a,,@????BBCGIORY[adi{tw{|x|{}{~{{}|}jrW>Gw}~~}|{{{{}|x|{|}yy{{{x|{{{{yyhwTTpuxwyxww{|y{|yxeM;L@ZungYf 5R  ,kӺW>9# /1163533333233231211132223 J 6P?36qdD1Xx_O/IIDD2,?jndR $#$##$!$$, Ny: oYs $5:5oYlDft^WslM6tpnl}fLZ,?;H`Yl$a#|}WeYrTfe*|~al=)1?@@>@@BDDINTY[aekpvx{{y{|~}}|}~}~hy||}}}~||y{{{{yyyy}|{{}{{{y}{x{y|wxwuyLl{vuxyTyxyyugvvQHseYdiu~X_ 67 9[Ra^_T$ $'656353363322112312232 : vxmB/MXL2OmdJ*XpW@#@RWlpXl~? )'#$!!!!$ tt N_wG #*#JgprYBGU;?VCn}kTyhtryn;Toim]Qf]R?^3mB}d]q:B}~xYZ!*?>@?BBBBCGLPRY[`dhpu{|||}~}~~|{~}{}f|}|||{||~}~}{~}|{||{{yy|}}y{{}{x|{yx|{x{yvvy[krxxtde|xywjtUH~ajypww552 9 / :Ban{}X ''65535253233223112 Mswo>!LM1 :rw[72^{pcfZpY .,$'#!!#!! loB 5dgn #mhmVa`degiYtL>6rxl)v^i9dq^rvU9_DY|oh Vt]hi o{}[a!.3??BBBB2BDHMPVY^`ekotuyy}}}}~|}}|~|~|}~}}{{}}}~}~}y|}|y{{yyxy|{{y{{|xyvxxyywyy|yyxOTqvw{xh,rvYx{yxxHRޘfYgv~p[ 5>* UJ rwlR O2 75553233332233# 5otWfe{o>1CR,/Wjj_Ydrn? 51//,,)'##! Juv} mU, UdogD^jafkNuoL`GCgn2Jg`YfjuDwvaq{mt'eRj?6{ew{y;#2@BB@@BBCDDHMPV[^afkpsv|}~|~~|~}~}|~~~~}~{|}|||}}}|}|}|}~{xyy{x{{|{{y||yGxxwy{{yywxtoeRwxxit[q|x{vQVІdXer 2,5T |u~R ^̪q) )3353255325 *5kU I_ThhXeill`qug? *;DO?763/1.,,* !ts. e]|Y 2hiy.;ULPWjRjIoDHIGG^'}khjZlnT~vo~C,l: jtm]rd{cxyx='5@B@B@BBBBDHLNPV[]`gl{sv{}}}~}}~~}~}|{|~~{}~~~||~}~{~}||}y{{y|{my{{yx{xxyy{wxyy{wwmdYyy{yyxxp{|{yuQẄkO]o,//*,M* {mrojyW !vȯf )6565365! R }yhd*,PeHCDDCMPH321. ,wpI d_lv oXP$@NDJdBc' ys[Xodms,n^1:Jf>ny~!V[ @[_x6;Yuyx;$.BB@BB@BBBCCJMPRX[_cfmqtw{y|}}~}~}}}}{}}}~}~~~}}|}}}}||}}y}{|y{{|}y{y{{y{{{{y{yyyyxxvx}icMxuw{x{xxxy{{{ykR]ۖhUXi} !.),,$ amaqnY}q[@ 2ϿV '757 m mH,*PcXI;#7HYDBBBB?9, 5~q_ iZg  lc~n!6:7MXc.vnqmPYdfi>Hs^gdegTVUqI#~i 7o_hpkhsp?1.BBBB?BBDCBDHJNPRX^adioqvx|{|}}}}~}~}~|}}}||}}~{}}}}|}{{||||{{y{{{{yyy||yy{xy|y|xyyyy{wv|h`B}uxyx{{yyxy{y||ylWVpRZYu .,))# onoyonYoko QͺB ̇ u|evpmopT2C]?^`G/97,6,CjfVIGGYYDB3B/;Yjm nPj !! i`w '3*WcY5 YnYeefpY9wo_ijjk?v9JuUm ,o{kifM{hvjC$3B@@BBBCBCCBCHMORTX^chioqv{{|}}}}}~~~}}}|}{|}~}}~}~}~|}~~}~}{~|{y|{}{yy{xyy{{wy{x{{}|y{y{{yxw|QdGvw{x|{x|{y{|y|{{V^rYU]j~~N ,))$!Jow||max~naZrk֫Yyc# iͷC τ ĝO 6]lY,$MRQgm_IGGC$)7LcJLI;:;11oplh *kPj  P^l) #DaRMNqRWdehg$fqLigj|Dfrk;:W lkGd23uwi2/)@B?@@CBBBDDDHHJPRX[]`ekqsv{||}}~}}}~}|~~~}}y}~~}~|~~~}|}}||y{y|||{{y{yyyvyyy{{{}y|{y{xylfYxwyx{{{{{y|y|}{yQc՗gYWm /,,*$^Y_ttn`mnmmOfoU]grvmW . k'>:5>kmoM,=OOQhnZD.BXC,:MQ@>BpjnX YZCo  `_t: =hP~WJ|[Odfoi,[u_YfhkUC_kY#p| kj=U6$ouyM,.3B@@@BB@CBCDCGHJLQRX[_ahkpuw{}~}}}~}|~~}~~~~}~}~~~}~~|}|~}y||{{{{{{{y|{yyyyxwxvxxyy{{ywyyww[dHvxy|{y{|{{y|}y{}H_Ū/ '/,,6NR:,7dnnkkklkG}xow^Zhxl@ ka os@>5L9=?Zcf[H7GVMJLUZRG99B2B}v]rB;ROZt Dh`v, IjP}`Y]|BOddfg``[YghV,r_T!Y3#o?/_B#w}~j5'/BB2BBBBBBCCDCCGIJOQWY]_dfvpuxy|~||~|}~}~}~~~~|}}~~}~}}~}|y|n{{y|{yyy|y{xyxwxyy{|{{|xywxxv`eNxyxy|y{{{}{y{}{y}N_ O.,'! xc>*_lYX`jXggjokonujjowyvtq]H w}jL12:;;NMLR$C.6JJ7;Xog[ap?9TMGnY =aZeč, ! HdOj3PpVQac{e!XoUYfjn=t^L!MY/cBI`='lwpX6)2@BCBBVDBCDDCDDDIIMPQX[^aegorvx{{}}||~}~~~}~}}~}~}|~}~~}}|~~}|}}{{}|{{{w_xy{{}{||ywx{{y{xy{yxxfCwy{{y{xvm||{{|}{}Xcl *2.,,) !L GuYXUMLMts}oWnqr~whťdUqwv}hC.*2II97JOB$UnouVaxcOHJ@cp Z~jT^x _YXa*joOLUcrGWZMZfji*sp?XByLyTfc3.keH#'!5BB>BBBBCGHDCGGHGIMNTRXZ_cfioswy|{{~~|~~~~~}}}|{}|}}|}~~{|~~|||~{{||{|yxy{{|{{{{{yw|{yy{y{xx{xwmgDx{|x{y{{x{{{||}y|`Y 6/..* n 1guePBoXZto~~WRtuu}{vmg]x?IHUQGojgc]?*3:;ZvxiVcspPIDTR'P|rNOsg# MlOg_2wi5?H`q:.o`RVdq]3qp=U9}i|XgX*|`2?>@BB@BBCBDDIIIIHLLNQRXY^_dglotvy{||~}~~~}|~}|~|}}{|}}~~}}}~|}~|}||{yxy|{y|y{y{yy{yxx{{|y{{ywx{yph?x{{xy}{|xy{|}}|ZYq #31/., c gYZ?B^p}frvoR6]Pdn~ Bj{~{kYT_jD/1D^aG_tkDHeT 3g^NochH )7ha):XJVdgH:srLG7nk5BQ'>>>@@?BBB@CCDIILJLJJLPUVY[acfinqtw{|}}~}}~~~~}}|y{||~}}~~~~~y}~}}{}|{}{|yyxxyyxyxxxyyx{woiCyxy{{{|yy{||{~}|~Xa ,11/1 y DgiWTNHITypko[Xm # sdjyfwe[YaiiyaB,9Gaxeen|mJ5?rI Bj^GnmiV =m=1mi@7Jef5D{U;YkD )n; ,B>;>??B@@BCCGDIJLLJJLOOPUXY^`eijosvx{x}~}~~~}~~~~|}~{|~~}}{~}|~~}~}}|}}{{}}|w{{}{y||xlvxw[~twfvyyyxungBx{{{x{yx|y}}}~||TR '1/// o *=[tnfoedYe``Y[nopsx~}]B?;Uqo`_D3Cwd $Wi[GVrL ,WdY,QG )ZN5T{Q#Y|oI Qs!!BB@@,@@B@@BGIJMLLMMLJMNRRVXg^af[oqtvx{y|~}~}~}~~}|~~}}}|~|}~|~~|}|}||my||{|{|yuyvgYnW}pp~~ng7w}{yy{{y{{|y||}y}9u 6/.// ČkMargyxvkWPBMj{~uV';Htp6 [_9?W?2oqD,=xoH,L[[9L}p$ >kV, U:,BB@@@>>BCC57WNY^YMLJJMNORWYY[_dhkqsxy{}||}|~|}}}~}~}~}~{}~~~~~~|~|~}|y|y{|{|{{||yjwtmjXqO[``]ome6|{{y{||x|{{|{|}|# .2/21 ގWJWntywsowpxwrwuookjkqp{}mVZ^@, 3aXB:Jc`JDCp^HR_],)IywX;IcU,2os3 `Z5 XB3$CBB?BBB@@BJM[M]_PNOMLMJMQRVXZ[`cfhorvx{||~}~~~}~}~~~~~~}~}}~}}|}}{|{~|y}|{|yxhsvvowZ[n]ii]kkjo@nw|y{{{|{||{|}~|} #31/# RX`wv^D$ #?XqX9H@*'.Mpm2,@,,M|nn}iM.mD NT$ 'QxJ,#2BBB@@BCD9IJMhmY:aMMMMMMONPUW[[_ccinqsvyy{|~|{~~~~~}~~~}~~~}~~~~~~}~}}}}}{|}|~||{}{{{yvgmlkllhl~[ZrfBnxmy||}|y{{|{~{~' ;511/3 mymd_YVML@MBTdju¸xW?'  1WqugB1*!>kmI@M1 :q: Up. MfJ' *53BBCG67GIOQa[lNQZMLL;:JNNPQTTY]`cfglosvx|}{{|}~|}}~~~~}}~~~~}}|~~}~}|}|{}}|y}|{yy{wgre}onlmkjumjhhQnuwy{{}|{y|{||||{|q $=52.22 Y Bcv|[M2 #5Vlo|YG' OjnhND#UvQ $[YGYvJ *C55CDG:LLOR]^hhd]PILJJJMLLNQQVVY[[acflnpsy|}}~}}}~~~~|}}|~|}||}}~}~~~|{||}{|{|}|y{d{xxvdvqomnlokjnmhjTotvxy{}{{{}||{|{ j )62/23 ? =dU9 6 Y]x}utpcmXJ?) DgmU' 2^r**Cotx{]C '3IIJLLNNPR]ddeemh_UTOMI,DHIMMNNRUWY]`_eegm|uwy||}}~~~}~~~~~~}}~~|l~|}{|~~}~||}}~y}}|{|yy{|x`tud}qmmo]nnkjiytyxw{|}|||||x~}wk _ >72237; #aB Y O);TRXYXCB;95 )5?PL]srwppprstqYPDC97/BUhwlT' 'YrR@IoqrY:VW=>36,>=QOOYYY`QR[R^^_hhh_h^TTOMLIIGG2IHJNPQUUX[^`fhino}txx}||}}}}~~~~~~~|~~~}{}}~}~|}{}|~}}|}{}{yvx|yut^pmmnpohgTp{x{||||}|~{|}}{t w 59337:I, 'HB) myocRDLGQNGB/*5/., >|ȿyg='9GRWkmvliYU7. ;cfsrZc]vyHO1D;' >9LNMPPZQQPQPQR]T]]ccfTTPRNMLLIIHHIIIJ9ZLPQUVYY_adgknqssvyx{~|~~}|~}}~~}}}~|r~~}}|}}|}|~|||{x{{{w`hqcpco}qoifYny{y}{}o|}|{|}{w /,)97*PU. 6 $R{nieQYUQOH?'536^]Y~p$J~]W,Cjoj*@G3 !$9DTXY^MUYVgp}g|umkknV_aljfdfPUU uTXZ>BOUJMMLMNMMNMOOOPOMLLJLI;IHHDGGGHHIJLN=NQdXcZokdglnquwvxu{}}}}}~}~~~~~~||~~}}}~|~}}}|}|||||{{|{vgUpuudeppoZiMk{|||~}{}n{~| '*;:>COeR>:3! U|~okdaYWQMG) !3,! 2/.=LY!?*:)'!6)$,)$>TYkrlhmpadgdaaaaj`cVNLM9cHTgTVVae7]}jLeO1PGIJLJJLJILLLLJJIHHHHHHGIHHHHGJJLLMOQR?DUYe>Peiotvx{yxyyw{~|~{}~~~~~~~~~~~~~~~|~~}~}|~|}~|||}{y||{xywxgopvrsqrwgU]y{x}}|}}|k{~}{} 9)2BBBHDUMI7$@DXB$_~ylYcaZBI;, ,/@B??$>#.IGC>,#5$65 XOP.'.'119Yh[I)! /?ehkndrojiwYgghtMi€U^jf :BCCDCHHHIIGIGGGGGDGHGGGHIHHMJLMPPUWWY[YNZBP`ux}xy{y{{yx{|}}}~~~|~|~~~~}}~}|{yyw[{}}yyy{{xwsqvtssq{mhe^{}{}~}|~||{}~~1Q $176H52,3/)n9c*]h|wpojW^[jgfoZLLL;LJ;HJIGB!MNOPMI51)':G;RGLZfh_TU;/36?Q_usy~|}tsoonkytij>jZ`pe_ =@BBDGDGDDHDDDHHsHDDDHHIJJMMNPRUXXY^`addfhhggUTGQaquvy|{x{}|~~~~~~~~{~~~~~~~}}}}||y}~|yyx|{x`hxroZjZnt|{{}}~|||{y}}{~ Y )2, $YBpvrymfaD6Ha`aolkcaWegRQVY^]]YQLHG5BGJQ16L?PJTr}oq|~ttwttwsqsonlmjxBdkf_YeJBBCGBDHDDGHIIJII:HIILNNPPQTVYY[^`aefglkorss|srreTYZswx{~~}~}}~~~~~~~}o~|~}~~}}~}}||}{|y|y||{{y{y{ywutyyyo[k[^y{|}|~}}y{}||~|[' I~yxsompcRN[``on__^gZYYqkYWT9);Rcw{rvvwwuuuyvtuusrnommtY2tcjga[i @BCDHHGIHHJLMLLNNLLNMPRRVXYY]_addfgimnpssyxyx{yxyrs`]U`tux}~}~~~|~~}}|||}~~~~}~|}~}}}mx||}~}|yx|{yyy{{uxygrnn[o{{|}}|{|{{~}}{}' o}jHORJ_ak`n_[Y3/ 1HIRj|wytstvyvxyxx|}|{wvwssuusrqqolijm_ihc[] MGHJLMLJLNNNOPPQRUTTUWYsi_wadefgjkmoqrvvy}{{||y{y|yyyyvvut]Oauw~~}~~}~~~~~~~}|{~~~}}}}|~{{{{}|}{|y|}|y{{{{{dywiuxm|}|y~}~}||{{~|| {~}|q[YXWa@O`aQHLC Rxh{y}}xyxxxyyw{}{~|{ywtuwurqrq|plllipaZg VJNNZPONQQRRUTVYYYZZ[^`adfefgjmnopsuwwyyx|{||||{{|{}|{{|{}{{yxutthddw{y~~|~~~~}~~o}~}o}~~}~}|}}}~}y|}|yx{{{||{||{{{yxwuJ{{}~}{y}|~}|} mu~|xrc9exgLћt~|xyy{y}|{y{wxxw{}}~{yivwtwtt~roqoonkiodmcLORUVRVWWVYZZYZ^_^adaeeiihkjoorsutvvy|y{||}}~{y|}{~{|}}~|}|}}~~}}|wxxwxZY_lx~}}{{~|~||~~}|~}{y{{}{w`}x{yyyy{{|{yyr i_Zwu}y{{}}{ Vo l~_7v{y{{|{c|~}x}|{vxxyx{}||{{wwvv~qrppmpoolja_u IQVYYYYZ]_^^accddotfhgkjlmnpqrtwxvwy{{{}~~~}|}~}~}}}}}}~~~}{{||{vkYY_hkwTy~~~}s|~}o~}}~~}~}}~}|}}{y|dv|||x{yl{{{{y}|||ys#jorrdwymjyy|{|| ,ts ,|ao^hun~}~{|}yx{yvlxxw{{|o~}{x{xsddX`qrpliaNT Oh[_`acadedefhgiihikmmoppruuvwwxxyyx}~}~|}}}~}~~~~}~}~}|{yxua]Ut{}~~{Z~~~~~~~~~~}~}|~}||w{|{||{i{x}y{{|{}uplvvWXxxvywwxwwuwwy6q oy tYNԁ~~}}}|}~~|y}{|xv|{}|}}y}}{spooaZmtsog1vT_efgihfghiiilkmmmoooqruvxwxwxx{}}}}}~|}}~~}~}~~ujgYLUguw|~~~{}~~~~~}}}||~}{|xx||}}{|{y{x{}y{{{|||vsd{{}y|yxyxjRJf ,Dea| htPsp~~~|}|~}~}{y{utswy|~~|~~ktvvtqlD|ussok;Nfjklmlnlnoooqprqssvuvvy{{y{|{y}~~~~~~~~r~~||yxxvu__civ{}~~~~~~~~~}~||||~||m|}}{|}}|}{yyy{|{{{xy{|~~~~|{Yv_>_ao{wvm~xvHp||~~|y}~}||{|yxirt}G~}{{juyxvwv|nrvvurr=  :Rdufrqstvvvvxwvx{{|{{{}}}|}~~~~}~~}|y{maldlki{~~~~}}~~}c|}~|{|{{{{{{||{|||}n|{{y{yyy{|~}~|gTo{|~q}|x~~y|}}|}{~~yhsuuv~YH|||~|ivyy{xwwcqvyyvxwTe5)3JXs}|~}}{}~}~{|~}~~~yxlcgYkwyx|{|~|y}~~{k|{{{||}{{}{|~|}|}||yyl|~}~|~~V5Zooy{~~}|y~q|~|~}{luxxx{w{'}|}|xwx{}y{yyt]{~ym#ەX@9P`kyt~~ieV[w{~|xuj`[WWuvxy}}|~}~|{}{}y{|{|}|}|y|y}~~~|{y{vY{}}~~QBuh{~}wx @v{~|||yv||{~|nQ~{|hw||~||~|wYs}r$HG7Rfw|y[ؙgBR_r||xwvtreW[ivtvy{|}||~}}}y|}y{~~||yyyj~~|~~}~~~CQBmy>=`xxvx} [{}}}ye|}~~}}7~}|wvy}~~}~|Ov~],wV@J`p|x{L]t~}{{wwwwsie[_^Zp[X`ry|{}~}|{x{{|{}yNvj}|~~~}~}~}tBIG r 99~{xy{{w> ey|}n}~}}~!~|yx|yYoh'ϗZ7=H^qqxtTY||}}}yyyxwvdp_`]aovuvxy{||}}|y{}|yv'`as}~~~~~~}}~t>Na_f ^m~g{}yt s}|~i~,p}my||~mp`>͍Y5GLhw{nfRu~}~}}{yrspnZ[dRdoptvwxy}|yiyeZ~}}}~~}~}~q;HtxhȊ!hoi؊}| @yo~}r)e{~|~~njI>U^ox{yLeq}}}|yvturpooo[psfUaZ_sjwx{yxufU|~}||}~~|~~~~t@Hj|o_̀u} y~}}~Iu|k|~psTަc=;MjmYo~}}~|{xxxwtutsrtppsusststwu=f}~~}|}}~}~~q>Tmr| lg~~: m}>q}|ky~s?[HGWo{o2s{~}|}}{yyxyywwutuvvhtit d}}}}}~}||{{~q?W_{c~Q ~~~tv~a}l~glq!n?CP]nw{|GTW|~}~}}~||{{|}||yyyyxxwvvwv^Wdrx|~}|~}~}|r/hPu}ipq}` jpx_us~l~YpuݦmR:Lds|}cwnN3:YXj~}~|~|}~}||{}|{{xwwwut}qu|}}~}~~~~~~~6ooB{equL ˃Qx{~yY…~aCHRkt_|~~}~~}~}}{}||}~}}|{|{{u]px||}}}~~}~~m:nrlou|~} ;qluw}O}iv{~yOom vM>@Yjx~y~~~~~}~~~~y}}|}}{|{{}y{wgqsy|~}~~~~p.Yi~~ eWo~ug}Rcx'{JCUnr}~|~}}~}}|}|~||||}||}yvssw{}~~~}~}~o'>_y|~w~}~}~~ k}r}/m~ha}]B~,֏P,DNfn~~~~~~~}|}}}}}~}}}|~}}{jvv|}}~~}}h!5vdx~qsp osxNiwrvhwVLy~~pB؎O?IY`yuu~~~~~}~~|}~~~~}|}~}~}}}vsvx~{~~}}~BxlM~~ iYh|hNuryy~measy~~e]΁IBOYjs}}|~~~{~~~}~}~~~}~||yjsy}~~~|~Z,*6xHy~r~^ ~}iff.s~{}}hnJ??ao{y}}~o~}~~~~||}}}||xuty}~~}||}o22j~~Yo~~y}~p }jYvQ,@j;=D^pv{{}~~}}|}}~~~||wtu|}~~~^#OZh|x{_{Yl65‡xy}yeU[t~1n=:B]iwuy~~~}|~~~}{ttx{}}~|'[}vy{aXjL*v}~{|~q3{O:OVpu{}}~~|yuu{}}~q pnv{^xM*v,a :BQmo|s~~~~|xw}~~o']O}u|my~y^,Qkh3#7P`{|rڅ~}yxy{}q`xoyvrU5,Nierwx~~|xw{|{o#6;}op~toeDŽ5':Yfx~}x{|}~~ ^ygxu~dmrkW7,GOru}{{|}}# rk~]wowxw}>jhr]=>Ohnq}~}Y /YV]cqpo~hHB7Neuq~}}V gkOwgP;@Udr~y[~Q] Rxwxt gH6OWp{x|hNl# j}vs ҠY@:OefxxtyTsjyo6Ď]@BPolvjt{sshB6 w[{X{y|sOh BBIYn;|j)wxu MOg~wji_. N kcuUYgw|vr^VVLQdfg!5HfXsi t啎wxwxtrrq_JMLptv{qjpBko[jjl kwuyeʓ~t}ystomZP7G>duyxlrseZ]k}{}o` ! :Uvq}PywrpqRD:)HpwxdVJ/@kYHOXfx{3 ! L?at{O~{|wuurYT@7Ut|nWQB*BN9BHDWfup  7sc~a}yssYP7GYwfNO>?$3ZZGW]YIMan> 'Wsrj~ywu}roQ3GGrkgXRTB11:RfOW^^MNNeqgne}yusr{ZI;=YxvaUTOUL@=VԐRHRVWYVixe_goI{ytpoY9)I[xmeVOP_^YPZYB:XTYen|]_qJp|utoW9BnxjV^YUR^^coֆ:,UP]ko{hYj~j|}nD ?oxcWPQW_Y^nqV1'CJc}BMY>QB 2qy^URUZcf[o*#2Uo~vsYk{aPLJXeUfyO1@YpinZWRO_kowY3@LCMHBUYlssẅp endstream endobj 11 0 obj << /Width 460 /ColorSpace/DeviceGray /Height 597 /Subtype/Image /Type/XObject /Length 274620 /BitsPerComponent 8 >> stream =Gf[p9 5^t}rxQJ2MK& +6XQpkc\^\L]LFaR:- W' D{Foiiea`N[ZfZZVSO)L#1, .*/M~WolifdebN\Z[UWT[.yLRTZaXia^XWW@HGb`:epl[zfeb[\YVUCNEW;S[begnsizzzphN\JLTv;skljifeeb`[YRc\6xF9V^avjl^igo~sMLW3FZqWEepThllreue~ryqa\iOKN]}9qknkjlkhgcbZWFS8tEK]ailk`~qwvycifYWNcnc4aninnok\hfcbljW,MEai{pqtwehwiSKR7U@l=ppljj~kvyheecIq1gDxnz[fxzy]l~~uqnwqkTRVDOORa7snknpanjjjfYqgtE`lt~qw{~yvksn~io~~skfQ`K[GTb~ű@`{nbqrolok]uiv\I`fuygvx}osun}v{eutVxMIUJz9itpqssrocpnolCgvn}vx]uuqcq{~soux~WwgUUDMX137E`j?vssbstudttrvOdlpvkidwz~vlRlk @LETYr9jqqvwy^vz{yQgxvtwt~rroq}utvjrzs p}eVZF:r>X\eMdu^vwiy{zy{}~V\{uurz}vpp{}+trɈgn}?IVri:lsvxu}n]}{}OӋz{ytlvn~rrknsnrjuv^kUGKNT3}wwxvh}qborvu{zkrwnxpput4ixjcrf\[1#@doQll{yxz{~rtZkvw~~qstzTfuuk}brx[ZHHKQn?{}n{tiluz}{xxjvwsZvvtvszjod5py{w}}xz}yvvo4^CFJULpc~s^{~~ywxausvw hdowXj<\Ggp;~~}rar}g{s~t ruuwhȤ¤żiz\[Xi^¨ErtqRu}w~~}w{w~~nvx7lx{yv}ܞǛňγtue^taaol3EZ]gbpfَ}~w}rstsȬŻѳp֙ĥŖy}yyS@kvpa[[WCl{vdsq]s~d⅛s~ŀλz~gw{i-~}gypydgFZj]hjN{wr}v{ϰҼx~t{xvaҢu}}p}}Yov]`7giiy}rpve胳}}{~̠âëѯǰ~vznfqo~~—ddá{~sąwa1rvrayElnV~^ډ}xηŵ•Ģxvyt[tlSnulksswkw~sv v}}~}cisgovtnzqqhdZ[YibyÈi 3:pZlaky= fn}{Ĺɰajwxwtqo D~ow}xkyu~ltnx~ynvoY~o~fj{hbM M<]R^UUiijkihqk Vw{׏òǷ͵x}y}~}{zveMYW[nwsq~ 'juwtjy}uu~ouqox}{§kt~j1l\]Opefh{kWXfb? Ruxo˷ʷƚdvszx{laYaRvUINwvnlj́Mx~pznztnnofvx~q9uM\^`hip]wicf`F o}szzk˶λ·qyvkoĠw~uThn>Niz{uyywl@yzpn`cwe~tdrj{}wuuEw]^qShksfd{U ayzut~ƻǽƷžѨ{wzvw{{ytpr]Fdycz`z~~}twxyyzvuzͷx6ab`qdhbiwOgwC L~x߾ͻΫʷhyyxrz~viJOqln~Ïosrk~aq~ytck}e~ujy}y{<}dbSUhpp~FiOh}R Ttoxnj~ƿ֯ƣµ}i{zjseCUw}oiyuwku±owOQw~Fhvdabhwonoj{aC ]oÃ~ӼұӥԼtr{}sUbh}etrysoqsrjxzxǜu~s{iyjx}ys։Ņv[igeapwilWnnb7 M{vi~ȓʹ֮Ͼǩ{}kU:kqstwrȐxriᯔŽ}dsqkrzvMid`dfqRivhYxWaO otit}yԫϢ¾ȱԺӼ~uuNlqxupyyerwz{i}qusyLzd`aageifief`]4 ]gtq˽̽Ͼ׭ɷz{juvUN`ssvzt}dl6~d`Naehheghe`Y] Lkt~ѻ̨ڻĮȤu}ӧĐxdcFi{r՟wx{twss{wv{yj}vr}/dda^bbfcugb^ZG Lsuq’y¶ӳȭǬ}tu]`QxzrƑ{{uzsѬv?edb`abbtMVtda[M Kxuk{̟ӶէȨioyvtxM;zϭ~Ȣu~vxrvjYbsbZٸzFd^`^dbTrcccb]Z} 4ors֫߳Ϫwy{{yjUsb֬sqgksrzqqu[qĻIaRb^ukN`wdcjH\< KuoisrŠӻڭިɧ{}n{[lpu~lǷ}}oo}w}~ãihrqFbb^cdSR`ne^v[f[ 5tʲĶkwiyãӾȮrryĭilIihst~ʟzuߪ{ŝvbtyr۫ɄLabj`Ssakaa`O\[L ?~wqkbbeeZ]]Nbd[ha^bbTkO®̬{v^7vxxþzztn˔ix~z@^`\^j``qbcb][k[ ilndxykwidllfghlhhfiigorieokjedeyz~eѺѰɟֿͤwruxvkGjwҽɢlh~to}lskswhpDo[Mo^aabTqjO^]\ ͝xtpr}p{orrpsrfuvvtuvuuwtrtrsrxuϲİĸ׺Ԥz}~pv}gUqdѺ¯Þäÿxtƭunu;^\HW[apj\o`]^wX ؽvsevqrnonkakljolnyootrghbiahZitXW]UOXGKIMK@CDF`Rtzã۱ywMOy~ʮpLjt~~\s{GsMCYY]`[^Z[``N@ ֺh][usckaUY^allkkiih\klkesy}}zwtssyOyöؼ޷Ế~߰dU{gn֤xwyʣ†}~Ol[XZXeMi@\\``]s vdyfoli]jirx~txiizvty.cuw̺IJȶx~yyUssȟ@tQZZZWMZQNMMMNONb()inuwzw}˰ߺʎxt~hz}{ʨҵŭf}±Me^\]^`Szao\N\`g yurzfoiVgfec^YXWUTTH>H?TCYHIZIKHCKGWGUG@G?HER@C=5=6N8?K;JJJin^^w``h]Z[ZXXl\g^]lo[j\\\]]\[dWYWWWXWUaXJIKJJIGMSs~qɬ߼ƿ֕}rVrä¼ʫӰvQds^jbecedui[]@d ܯt}hlifc`][VUFRVhrlnzi^]fWXTSFDWY]]\\][Y[fZiZeZdYbv`ddc[@MJIJIHGIc +Mxڥ]^dixԧܷԚեâ[LcL{Ufdaccj]]f9 Ĝk{wpjddsZYVSTUSVVMMNLLYYVVROSMOUXZZZYWXZYXUUUUUXT>G=3;?=?LKIHHG;L)>RyuƲؽ}zvUsc~dñɢѧʕauOL~{gfdaSi]Yhg ѱp}ujfbq[YSRRSVYYQC89G3>+=76+76?K4.<./J/88/55//5().1,=43-*%!(&91axƬ߷׼ͺ«llhwyZĞβͿέëƳ˨fTgbaurgoap^i(uutwzizz{~zXz߼}s~txWrszɪĽԛʖɲʱҠ§9ofqhwgjktYddi}H,ߞooYew#tugvfxxyyoyv[{¢ɼĸѨ~؎wīɯͫyKdNeTdghlhiehYg Ҏrypih }xvruf\qtwv{Ytzɽոռ~xu]ɒǏ֬s¨)beecdThlnygihhy>i~wojh {vqtsrloqpvQy~{w°ֳ̼l{xsry}xzğɫƣƫˬ˨9bcococh~ihhfii] Rq]i sr{nboplonrtd\yt~}ߪĔư{zyo~°īÑ̖5TTa}dhhgitxMrizX{qj\ (t[plljnlq}sJ}uuֲٱϳڻĪww~yyi{vºļͫʧs6dtbbfjhguidcwgC~erkZ xropo}kkk^oox`wvr~~}ŮƼl{έޯ˔ʶĿǖxƣKceCtgyhghgdeXg` rs~uno !cssro[ju\ziik[N}qr{׻yxyzipʖoœī~~rlgvhzѡߩXbsggiWsgvefggc{h druh~in^ +yusoniih\iggffCp~oi~~~tz{üɸúury~y}ep̧ɽčfX[{`^fwoqo{5cbeqehsYiJyhbrK+ aovezpl +wsqlyojjixiccb?y{~}{}īū¿̺Ś͸z}ȗ~kwx^ةÚӭٰߥhZKbpYL#Leavipw{}?q`TwfOzkfveoS\d iivh}~up 'bsnzn`}\fqcr`>ttyywxy~{~}{y̻ո̼ttyspyŚfKJaywcfUFx %}hss{FJ\]keThY}[eee`i- eWzZtp'icsooWnZiqeWs^:}ftwyxyz{~}~}ͩ۲ھ}w{{p^]ʨòҪojfdafXJQ?DFCGv? nhq}OR[\^^ngg{gpUd^M QK^wq=q){stoxjhiHeclcFinpvviwwy{~˼ҿؼǫuvsx}~sc؂krؓʽitplwuqcpX`JIFEG@?:LL^{:pSuy}yyzMd]\]Mctfgqob}ckL 8Z`jhZ *y~coiYt{gaacbQvMxvuwyxx~~ɹضֽs~~otr\OـĪβnlpvp}{xonifVTH9!3'Frs}IK cczZc}raV`Nt\\cdcMbSGpc! /iZxg~vpowigihfdaa\Er]\}vsttwyyluǶ{vĺoyt[gçߺpigjp}~{ywuqol\>N8+2oܑjL+(/:D wZyxzo^o`[Y\]aOrleovpqo6{iZ[}}f+~itpniiugUVcJpQ{jpuuvx}ǿ¶i}}gkupYglu~}z~z{xxxiwf`MFSio~wwwwvspcprruυZ?>?>=/(4[e{~{IfUWZZ]^^]^^Obdy; 9je`{^#yrroloOlnkggVMqkkoqvk}֮Țhxxgcgi~l~{xsnlkjiirfcepdcWbSQRNWTQMJJEGE??>CC/>?D?@C?>E:GTlu~trEEITYZ[\c}p`o`uxw OrSrvc> &v^b{prnniffT^pqrtuy{~ɟïou~wx{qei}wt}xwsqojeeedcc^^]`\\\ZZLjSRQOLJGEDD@C@@F`@EDFFFHF32e^}o8eTUYY\`kqRQ``fq> .sh}c{v)hrsgu}kkhtlq[r\uxy~{ʨln{sxkiȄkoo}zqswuslihhba``Q^gMdYeYWVV^TROMJKIGDF6DC@CG8G<=>?@NNOM aVr{o=EfHiW[^^`Nnabdpx R]tdt{vL' wwqMwwtu~pnw]Zse~trtvx{w}ٶϼˢqzsQ}klcptsi^lwsozgdaa\ZgXeZYITURTQRMMMILH8EFGDEREJJHIK>HeMM\\IeR~M<`DSUYl]a]^^evM 5piivxh/[iwvvtvxtqq}llawe~truxx}~}nڥ㼮luyz}~bniلg^iios`OfstkgeU`\YiXXXWUVU]QOM?NMKJGEE8FFHJIJ>?:R=9@=FOkNMytWJKWRQT[g^^`]iRVii .p~pexU:W;MEDYf߿‡zɂ7LWVSTjWMh`Qv\a >splgp~rXadu]ftssuwr}ep\ufuuuviw~ڶյuo\rv}Ra~M]YebhYWVRRQ\OOKMMKLKKII8II;KLKMF?8FFEW\y污{åJ[VT`TWWW\[q][`Ko :jcayqjb}squvssvurppqZvsswuxvvv{ĺϕɸTz\rYkiMYYZ`]IVURQOMMMNKIJ<<<=KLLM>a;FTF@JQ^jpǖlzLMWSTUbV[sN\][]]q 4}wnt~tblpstsvtwuvbqeutvwwxiz~ֽµt}~y}XpVgw[LU\\eNWUTQNNNMKM:K>M?MMMOS<:<*938@M~;͢oƺH^VVSEWcXeZn[X\g[ GXqizfkbvutyyuwuf^iuxvuwuxypȻڽ{~}{dN`slvlgd`YUSMNLMKK<DF+ 'UѤɻʥɡ{M]VSUVW. 5jҥϓFITSdHVSUXUiXKiY[ ,o}itnx`l[vyuwwxqo[}xxwvwvvwxlªغϢĜlghj2\ߨycV`[XUUSE@MO>- Mp=aJ>eT^RUWVdZUe\3>{}nwuzslk}hvuywutslVkxwttw{իʟȋwM˨^;o~odpe\KTRRDTUc;) !QĉڢիKaZUiITUTiKZY:KM ,e}pq[t}tZncvtgwspWyxuuuiv{pϿ˒vvx~nkRuyjs\~UOMVUDETbh51xĢǛըLS\WWVXb>iM[[[kv\ 9~~tjRiqlpqtusguvsqWzvwttux{}ĻǺĨѧw}RoIpjwohpzO3WFIIUrl=Uɑéȼʓ˝KXaYiUVXYl\[Y[Z\ ?`~{ra~Y{vnontvrrqjexzxuwyy}Ż߿ԶZfhQgrlEj\.LJ@JZy\: c~ٙԩu}USj\YVXXM\\X[[^fn8s}khf{xplorwvhgwtYXyykyywy}ȫεǥxxz{KtU}doiX^uwFDMIeYik8 *pêYTyMlVKZ[\tYYf^^D a\~niW~}unanvxwwvsdj{{{yxwx}«}n:[hykg`CMLQDWXs^7 (lyˆxYYa[YZZvg]fYYWYiZ tp}k}gtYppuvwsqYzyxiyz~̫œİÖw{lO~`eq\~bCL]gLMi\Mj~yÐǶi`Ul\\e\XMYXWFVYWL iVjtrwxeloq^vuqtd{avwxy{qϼѽѪķyZīhiivup:?UOJ@[\v+1uwZldOYZI[XhTWTST`V -k{ol^tlovwuahyyzxxy{~qͯߧѬĩֹq҃[fC*`JMDXt^:&uwqמ~[a}ODXZeXUU>aUTQ }Gzy}qkuvaaqrtvsrW`iyz}{yz{~˯Ѯ­ټʓzzzxqo}}GTi]FJZqc(Qw{t~{ͬuSod\[diWXpWhUWbVU/?pyx{vsfbn[urbp^v~z}i{y}q̱չ̟Ļhvttykulxxz~wSXyHD\pc<@vqy̛s[[dhZHYVXV[hVibTZ*{lzghjqzxr^rqokXo}y{{j~}՟þ­ɨ~wzuguupWnS;[]pW!w^~uëlĹgZcKHKXYX[CXGVIVJ :f{{}j}atopTtpNd{ywly{{~wůǰϹnys~tow{wussr\ZfVJ7\rbJ9~fxΚq]YbZWe][k\ZWUqTHT *pzlnsakzpnyqla`{xy{{ź߻ѫhys~wtssrzliqba[E\`qe3tTi~tÿ^[fkGKt]g[Z\c?fU`i @]zzsto~uXpQpbh~ixiy~ʧ۳η~}~~s~ltoplozeaQNNE`xcMHrgyts¬ëIQpi\]NYK\YXVSV>T!y{~jnqtbapbazvyzyyѾԝʽ˺ħ}~zl~zurpxlzfc^]XZ\ba4SokΏh»îkSEa][\EzYfYcVSTWG NW{{{juأi~}iqonokXywjg{~rͳھz}xwpliiicc\YENbrnT.u~gi{̟a?s`ZZZYFn\=VHWh (ozzzhiqbllujvvvx}suĤɭʱӶu~~~}uvrnjhdcb\KM]krsFGZs`Q{HpOk[YZKk[UTfiVU xDz{{}ucqsnpkb\fyzvw~~ũx{tpxtbljeek`ZKNidvd*bnntiij^ZZ\[Z]^ZXXU.Sb {hz{nbyk~enju{xvz~»ɲ½qizuxsolhga`[[L^ccss&clohgh]YW\gNi^\fWVfhH Ey{zzgghtdk]Vxiy}vƻjvg{veojhe`ZYGOblonc.pittŸϑτ~t~K]LK[]^]i^ZYZWU?XHqyx}swk~rbOiuxw~~t~ɩѾھ{zzqfuok}gbc]ZDpnffdc(wadȫknC[XZZ`][`o\KlUHb8\Fxyxzokpqobprvvwyyѿάzu{s}xqiie`^iHHkpihvC7`[iчQ]eWj^^]]n]k[WTVWyewxvhip~gn}Nxwxy~ѯֻʵαp{o}cpoiifjM[ManfepD8uIpqy6ZWJ[\Z]\hZ\YVH*d[bGYYZ[\aq]]MIjK#Ks[Kbcrwdo͈hyslj^z}ųȳ֬~]k~nydq]Ryvkonkkre84MkihfegedceM:M]prrisyxniZ4ȷϭȥp~hfadp`}wllkjixO:>lihpwﮡE^vYX[l\v`[ZKZ7ZN ;XigfqeqfgeacHN{qttfajdkiD`Ơڼ~xrw̓wbunklkllliivaF.jDlâHQ[M\LZ]iQ]NsXnG3 6]heffeiwhcgoNK``opswjwvojg+ȟͥ˳}s}n^sl^lnlj]usb[-wajMkt~=]M]v`]On`\o]9TR/ )tgfpfdfhfigxUWjI{rqg{ryrniK[دżƾp~sLfVvsl^knniji}o[/a{zVcx5]\Mpb\\][^o]WWXG +SWWdfqwzwgheYw*gToosa}hpig߽ͭͻͳ{z{nnaoVjxyxvijv^D7kz>ex=\]`i\]\]\i^fLin! 'cgefffeYgYfhih5;oqrejhvxpphDN׼Ӳ䧕zxiYvpjlnnnkjgxbM2ghu`rxʼnOF[l\N[]i^]ZI@k]` (fRdbefpffigff^xt\oqqdqultqkg5ŽӰĨßsifcw~g[ujZjnlkjifpM/V]Vbԙ?^\MY\^raiNYe\p[1 /cgbfddpXeghQqhM^wEqqpdzZvntJ?سŲǟz~rœt{žq`urliknw^kihT[?JxvVzyx>a\MZ\^[Qn[Zf]]hj .ZgcdnWxffgihieMMqqng~iwwp[gI٬˻ͻûqj`vpdspljllisgv^L3hjwQzxDTh\Z]\^\]]^Z:hZO %YgUaeWffitiiheZeG]rqohzbakL]Ǽ٬׫֥vn}vuluoveilVvrl^llkihieb\+dYOruμRc^MLZ]a^Oq]k]]t 'Xe`b`fhithijhhSui[qoqfzhsvtl[Fѩƫ{zui{hUtrnVlolkzghu]/MzxqiqyKbZKd\pk\\lZ\ZLul ZfabaggjighgtgUigJrrppa}ytwpjSƽůרz{zY{}rhrkllnnlliht^;GltFu{UdYKWalci[[X\sZY* #dYb`effx[iikjk``rIczosiwiw}jNJڳɈǖ~xliwlplionligqaX,hZxIn—JS];YafdS\MZ\NM\^ #\scTdfesyi~kkjToi`dkncqxywtniL翻̱s{zwx}qeokSnkxkiiws^+bT{dkMdDhdoe~`\\GQ\ [Wacadihi{KnlcrDcnppvzx]}n\Iް˫}y}iujrlikknjjhpi9D}}x~JՑuxZTaN^exOea\M\`^\ pXdlTbdgfhjnnpGvtt\lprxbtc^?˨̛~snesp^knlkiluiSM.jf{jsqRWccrdeucl`Z\L^fL ptds`bcehxinqpTv~^oob[h-xtdopxzgg^oo\nwzѫ9[lnbpvrgp`QòeYrnkiithixrgalt栟Woihjkisghgn\X+{{M{uO{Us`zrrnha\\][:OJUbeqeU3 )ezpookiihkkn\iwūܾ˽5Ykllpsx]idX=ʟYoi[huihieff^Z(YWryztsjvrcssicb^``lHO#[jbeupdK 4xZqzkreglnd}rʥķ8oljnrwtiubWbɟcXkiXikjighfpf?9wT~a[rhqqqzlVccJQZWi3h`aVhXbS 3cpbqnlieM{ilZXrǮԡ֢þQSjljouzgirbFˠUnkiizihhggcYC#zZsx^dGitoplhbua]^^iX[ gpbdppdS(;vucnnnvjrYsiil`}ӼʿÜĖKlknnqyxuwS\Wnjikvkjiign[ZhgvUlssecwrpWba^a[\[HIQecvfgedaM 5yu{nxjiiiihijbqtp{ȅūjUnl`ps{wvsbCԝ`Yi[ivkiiihgaf*MiXJUts{lf`i\^]\LcfdinbcMbvgbU 2vvq]jkiifgZjbXߋ}Źư=nnnaswxiypXCfdkggtjvhixhnp39xuzoCsvhoO`^^]Z[XVU8\y`kcphdb w4xtp]jwijhgheio]oˬֻϕFjilptxxviu^Ir桝]kifhikzjhit]J'z@v{SLjFedaO^n^fVWF;X^laaTohedD )wrpnokiiiXfhj][ьxնD[kjnrtuvwsbHşWkkhijkiiiif]Z1Tu{suy{zc]Xcecb`[[\YYWv}?g}bMo`excL KwroqoiiiifXhj]\}͹ֳǻDljlorxjx`H`ʪ`cvigiiihgiqc\'L~YszehobsbS`IpgWVVI@2[ab\^Odhen KxprnlniitffijchΎ}ó}]^ojoqtu^sn<ğyoajjitiiiiihd\71~KtwzO dcRdl^ob^MXiqS\[j^]``eqpM/!Euc{lo^khhghvpbl϶˻ɲ4pkjofxuuS]ĠVoifhitgyihxQI;i\tuv~u wdada]^a`ZCV,VdV~b`acncetaQ .wtrrlkl{ijgilafҎʺ֟q{b\nkn}vygxta;⟟Qqjifijihighbo1VMqtz}O eQbpao\^\\dXYwD;i`^`bV}Oonb 2frkj\zjij}nMxȸùӮԙ4cjlqsuyitVF}~tw]Xnk[iijjiirn]45pwdwR bkN`R]\\\gYVYkSe^\@sctfpbMi7xbznqj]ihhy]kpgɍuȹӻʷǸʳdXnolqtwgwhl9ҠōVlkijuuihiix\M9nevIpuvzX Sb````^h\lKVXhlVjszMrabewfd=Ixebopoj}ihih{Xp~ŷʹ¨ѷ6Ylloqxww{rZMyvHokhijk]ifrga[-hNxrZprvR daa``][\^p[iXksuq{plk`hilòȵ6nkjlornͲano^klnlkifu\c.go~lHcv{}R g`i\\Y[\RZeXc3Vq[HXiYo\`ctfeO OyuvspppnoliiiQMʶ§ZwfC)+ )%3 (5W̾Zd}jl~nknl\var@t~~~}qswzug Wb]h[\]@^\FZZXqUX[VWXXM[n`egdX Cystqpnjl~Xiik^qſD @Q- /(! lȹzQliUxnkjizsuX5<򏓃}~}Eow{X Rp\\M\ppZZ]rDbU jrJUdZX[Z]dfeVJyxto{owijigYhnfÔ}jʵɱ: &w 21,! *ñMovYkwn]hhi~GT!y;kb}}zz~}~{Iow{xFR`O[ZZ]]Z][n6lTSie@UbYWJZ\beqW5tl]^[][\\JUST5UuJT!lju{{tzxh~puvsuu]1ivwza#Mxdezdb]q``gX-n`ghT@@SSSRWUYjexfU Xz{trplnyihhQn ʞ„hHZUJZNibMIʼ£̉s 1/& Q^V^iITMML?QxX].9zYplzy}}z~xqpstxxiknі7O~uxR&TwfSdcd^M^ii[W4!>qEMZ[SROVWXagr[j ^d{w^qppajijoi}Ư Ο~2GSQTWWY];sۢíʶ 2-1 ºļȿȯiY`[WR[MKMEhtU:,Toxvxy~}tqtvc}֬(Hlsv{]3@gheQyk```\^[XedUfQMOMOROSbL\nghn V}wrsspook[Riat~G ?{ɳ:RCNSTYYK6ԉ¯Ǹ 2,+ ֭µ­ISiYVQQ>JCWIQv9x{wzzy}~wqqvzz}ipM9Zvw}zZ9JrhsaRNa\\n\[[r5gbFN`ONQQRaZ]deil4MxsfsponkifgStc ϰԵ}ɵ2;NKMRVcX+Œ -+* ư~MebgVSMMMMF{XS6UGz{yvvz{zsquy{?:Jxux{}yO)]eaki\^n``]^\3WXVYVRQMOaRRTW^brjZ;TM}isrsppiiiVi\ԍtԬ įڲdz3R1U@^VLEc”֓ /*+ ðMQd^ZSOL=K?nhS5@`]x~yyzl~xgsx{~t 6yy}{{Q:LV]J`[\[^]\ZtfeWVwTDNO8OOQGWhTvukRW{tss^kj]hiehp~w ƵⰗ9H(HJOeh9vێi 5+ IȲĶ͒{Kcra]TOKMQTxGN/Y.{{p}{~}~xvsvuzdD8fqC.Mb]na\^Zia]\Z\dn?oSROMXiRcRX\`etj] :{trrbliujsfWXtw} ߾¸̳6(9GMOX2璱p 4,+ u௽ƶ͛GdeaciX:=]TS[6DkVDN26RfETY[]crh[ ^{{gs{ljvisffc}N 7ϞǸiW*GJMT;j؈Mh n .* رÜNWcaeeqX1gFcTRJ5>cʸu{{}~dgoywxrZEgy~rIMSgcba`\`^MapoYiZZVNM:MRQOUWX[ag{] Uzsqnjjiffhd{ّ ԮۻƇĸǹ6GHMR5z4:xs̈́] (,, Ǽēd]Sadot\8fcbpOJ2-O}o}v}{{vz{{oZSVpjN\LYaRaaa^o^a^]]\YViXSYMZRNEVW[Mbihi%Qwtsrp}iixi`p}s (ռϵ»ӻz2KKLT2х6Ctyy +, l丱˕IWecgs`7Vy9w:=:*@ˉzr{xy~VlYt{p{RvMRkN`^oR`^`^i`eF-oTRMMOeOS`Yg^ori[5kQkt^qbsro]ysSRo  ɣrĻG'MRCW€4d2} ))/ ҰǯMWVVuorXGyDsRa/6/rrppozy~G\zy=yHhnL`Ra`\i[^o\i?IbVO=ONOQOTX\jezhfL7Rzvtporpl^jgfic~z ' ֱɅǻ·2EU?O=MFa{ *( ɌWhfdtopX.jVceMI=5W̼z{}~~qW]UkY~JiubrR^^a^L^^`LicZXUM^?NNSTI[Qchf9M fdstp}sqllkiWhTρ= / ̺ǬS;VMɲ}?d/ѯ ), ๲Ƕф}Gcbdfbi!fjGnM=<3G½iusq}\`G]t}z{[CiXc`]r^o]]]\^f?[\[WSM>NRRSTkZ`uwJg YdufteoklnzgiQhԄ + Ķѕ·-@.֜aINn *(' ԰ʣNh`ad~g.T6yNM875ξrrfFUXrx`c?]x^^`^b]In]\vZE[k[FSMMMOORHY\^efXg Zcfvqop~~ihzTӀϑ +- iʔϳ󖫻a&)㚫@Leٜ6 ): 漲޶zVfKaesv=GzKiSMHKŸثqsM{IVx}N:S]^`^^a^``nLgnZ\lT[KJLMQOTX[bfhgi O{`sqllVkhlUuo ,*N °軪 ȋ핬'f9{Fz )*/ ehXS\bsrK*fXTj>8J/CӯeHEXzVY8ib``^Q^`a]^OZYkYfXUR;JLXR^VWYRovhgixvt}akliijcwv @)( ùԪɺ¸n 斻@MFT6}Ԫ )+ Ē~[eG^crZ%uf:o?I:/,Ģϭqhuqni~[CLkusuG+ifab]b^bb^Og\MK[YRQNVJ=NfThf^cehZ}Y~vvwutslllihjSu{u5 *9! \͸ձԧø;rNCJ g8'· )T Cq^]srZeq*wMJ3Q ɫih^dsttruutvF?`~s}ulED*jVtbckbkal^Q]oJ{tiTMLIKJMRFiMMbbgg2aV}utudqspjikj\r2 )(&% ˟aԀOMEDGeTxֱ +; Zh`Rbjn.Sq;ccW3e^خŔgaZbRML>CJRtnzM94.=,ifpddc`car`\]oM4tWSRMIJIYaRhZM]nghR+zg{ihvqrq]kii~trnf 3,)9! ܸ̮ʤ¤^އhIY7x*'ͪ D)' gXqWCp)3L6áٕj^Xjz{}w%ic^aa`dazcoM[eZrIVc@LILMNSVdM^cuhO ^{xwttppolij`fl ',)6 ڱǹw¥{Ch-w*x .%  Wvc'R}Q;}9:LWޮΡlsieck^acclal^KdVYf[XVQLMKNQTY\^cdggQ hlz{wfupoiu[iN7 3>,& фѳĻ䓬/4?*<6ە&1ڤ &! 2ZL~9Ey=9i ټӐu~gdbc^jNabVbn[7IjYYSRMLNOQUe[]cgqdi u\~zyttuslkj[i\ě 1+<& Ģ˻ȹĻοķ+F%5UYZZq^cfvVE@fS~}vxvxs{ywjzjn5 1++!% ҫӖȎ8/1/6E2Ť-4  9Ird'5opپۧqq{q ZcakKs]i]^abaa^gjYkUSR=NMThW\`^bewgFjegiv~ZnnjkiQ 7a% Լ{ԶĻùu ;+.1*@6?UKbViż ! 93pf5MC%ŕuugqsɑ+]gck^cc]oi`^^qkX\]XVS\Z@RUWWZ]aSpqfM Wn}ywrnop~js{p ()% ƺƷűøux @3.#DQ>)L?g3; #  (1Gt ̰ofhNMTa7{ՇYWecTdsI^Q`^I]D6f[Z:OORCRWXe[]``dpTW lp}{wtpppnkir )&%  Ʒºծʳɡ~f 9#/1)=H:-@npgϣ &3 T% ϻldcJKO>dѻ}dQVYg{󅟡 pd`dcaQ\]`^ak9kj\YaRNd>\SkY\N]dfdge ]gkvqrnju{*(## Wˡߢɹƞn)G!!8>JWiVni~I 襁 !-, ./n:G̻cGJ]ZZZWKFs~J4D7>NNikip*bjXdLqb`^b^`chYXgMZbSSONRTWk]\^dpheh ]wcywuoovc '2%# )ğԷȹûû{`Ѡœ :%#6>J?:z&NaFQr>;a'  #  Tv Ԫz<;MMZZYWVWYD~UGTWHfNjMgƿxw)\ie{b`cbbkbjilY\lZXFeRQNQTY]Nh`aUhfg XsyvitssE %/ ʱċ˺ڳø΂Ӓp*7 6?Mz\oolQ^U+N 3< gN:MZYiWWWV`QGH&d^k\\qt͝at Yjgfbbba^ayQZlXet[WWVTRRSUYs[[adheh Totzxtovs\ 2% ڽeQU}92493fSFMV@Kcv.WD; O !+ :cS>@MGYXEWcTaVSQORS;s{{{}v5 \iecaaaN`^`]KW/,uZJWWSTTQUXYM^cgfqdd Tt}bwspz '%# ̬zǶͳ[D# U=>Jn%aD? e  R:-&'J7FS^\WRTSSRRCM+5t{1~ ssVbbbb`o`n[]uWUdMZVUSTORbZ[]^dxYvdT pvzyws !'&& rȾºگߟki΅-2>Y~ӾSQZ'11e] #) ѧt\@RRQORZMaOS7˺v~ivy~v`dgUkb^b^^]ZJaiL][lJTUQ]UVXZ]asoeihg Wsqykxu#''/! yŰ޾vַ؅j{lyeZWqDZ~OQ2 = ާ ! ].42:NS\oobkONMKLM6L+Kozwoo`w{ }ced`aba\[O^aub\qv\YYV;R]FSUWhaTcWh}hVnpur '& QƁ{suƷv}]]lc7afjz}rwyp>K[FF6\ Ʉ ( DjjtbF;NC=-'-CFERTGN 8q{zeKCV ^Er}E%of`]]^Kbr``b^aqFx\\Kf@RRDUU[\^codhgd6D\j~ (;& s¨c̭꼓ܛ¹ˀ۾Νoysw UUF\@N/>:;I@4iJHM &{}uVM~o XYc9XeaaRqraca^del^+]YkVRORQSXfhoTefhefH Oi 6*& vbxð}ȮrǸƷɓջkjZ >?STղųï ' R;=<F6+?EH9FQtnN z  aakH)bed`adfeq^kavd^`\XZXURSQaXZM]`prffbM Wi +('! Zjfsunw؆¢okŀLǾƮx' &,G8:;;<<=;=>N55>FDUFQ#njcEQ6 n Uqx]a8LuRcUdpcaSxTq^rR{\XYVE`CSWYj^]aqgfffJ E2,+&& GlSctpӹYˁգȟp}ºƲʻe荃Ą %E7889=/=KKI8-.6XEEG4M; {p5 % q:zbL,@eRydtpdcb]Sb`6^q[YXYgUTVVWY^bfqrOyh\ QU )(!! g[celr~ɶLԂã{{l}Xģÿϳ  @4669GCL#7[FDDQc- gusuzyv;G^W9HTdccMeWnabba``wKp[WdXWTTUcX\abcpfhev? cf(S## &tv}pipn۰5œȱѯW>rTV~VhïǮtîy I36789:R=c8 %RCDFOD: xx{}{yrlfq}WM7X-JFygdV{Vbera`qaY,}\ZZXVSGVZfgQaMeggxIY K *&'! ukllpac̭ğWߑŸхiY}l[9ܥ§šՐƩïͽ˫i~ !T46D9,*=?;:8L#6Q??CCQy{y~qiCNRdKCkgcescbcbSckO[\^ZY[YVVSUXZ\[scqshxxh -(2 ijkkdbxǫJԓ*`:; *ytjiiRiU{2ojebaeoackM]][[]]XZeXVVVX[`anvehgiW ;)! }k~iilxlqesseįߧzk娜ųijʳva})J!)֓yWe\M5EFf~· *)+)++/E23* d :*,-325566999;8:98: / .kun\iq~^5:jhXedcbd`qr]pry^[YYZXYVUdY\`ddgOikfW #,)' nnyx[xqguˎ]֤j황^r{f/ +gev~ur~ě 21.*((&))*,.M! x D,/.11&54**#%?=<@J1  eScijv~¶i#+jtQpdcdbcb@^qSFi[Zj\[ZJVZ[[`}guehziS .(# r[zonijvjne[hϩ`ةӕbZ L hf/{ya5lڮ` %...*(3&#%#(( Xtn\kpont{yq .,+*+*(4'## %D% վ  `OZbp]p{;CWu MO7 pyxxzno{i]fcfheebdSi4d8t][[[[[Z^aaaffhYhijih --' xxusonkkji`koiÏy[Vαϼl*? Xt^cbv{pz *)+(('(&%!!#%&! %=D  wzx~׫dYw z}r}§kw !qiiYhgipcua]ns;]k[ZgJZE{daddhhukuiV 1.) J~wtsol`ljkoosȅdրeپón 1 wor]u~}{l ('&%#/)*'+* RV 1 ȩF ob{{țpi}}qϨcnn}ehiWifWbird2!&( j 19yWSpuKZp~torry~zǶ]`;pZiyZsggitrd]]\\Z\][Z[Z\dtWfhlljjhR)& #1.+ lsf~ppkVwozstju^zHjϮϰ57hF%3:  {9HiuraY}y^fhpuq}grz֟biO)ran{h\jkhshvd]*a[Zh]nRbcdOhhj`lkjdL !1 ?xunj^nlobnoscc}䞹Ѩ{Xxp,t-tN8E6 \O8̏5#]'GDެ + aEΟ  U5a}}~grvafnny~v{Dȏ˭bqRrc~lkjlktgWb;'Nja^Z^h`aTSdiZjnqpz^gW 62. 1ppnjikjnln{ukGayjpd nil3 oڗ%QS2EJ 7 7Kjfhho{p]c{elJb^kwRjiffebu]na\[^[FpbfixXjno{qnig *4/ !lxnkkYkwnkptS[U֔I󡳺Tgjqsþ߹T^H GծNM9HJ  ti W{ihfgwXfqcaysk``\bbcLnhjwjnorrtclk Q3! {ytjjkpzoqqZjZixťZyiq]  킫= l̪&@[-D  U 1Lu~ě{֟jw' nkjgsghfhfdHSS]`R^dsbcfl`nqrKvfq` !64 (jwtsniwxlakbdbtEC W# MÁ ˸kV3  q ]RSvwȰ~y֟dy nwjzXixiiqf`ckbkbaqboffglzptwxk +54 6zus{n^i}onn\lpO2dvX>wuXC='' ãYE*) / uawuܟp SykzfegheOuabesdb^lVdfYuloossUxvoW ,62 .qvqlxijijlll^dcg&֥GㅏJM&51 ~F߱Ig8W߯ 3 R MTwڪvv nxkOiihiycelbnUa`afgriVquetuvrps ?64 JxdnnihiYkj}nc[YxĻ`엩F?/C*1-3 {޽`N ͛  vR6 jѭitflq\coik}ihfheKdbSfenefwiiovvssrswstf ] 75/ hrpjYiwejnjjn}Ghjn~eɕ7b?-.2<pܷ1 ¬  QXLE jw{qeihynkiikkifqggf~uSdpYi]wcrwvuhvuwis 55/ 4wok~igQfiW`yUaqtTcn{d7Ӛ &.1!SM*֛ ٶ ( R1 ɮti^y1ValkghkgZi}frgUfdgRlbrvwtyxxise 94/ :htpkJqhgZYgTjYprqphy`S}꿫₧3w葎 21H/T`V=۰ ʵ C +I: kz)Zy !UjurnkhfcXhfhijONjkloqtebh{HGw}C ,YSMOQa& ٵl]F  H ?M `偐ìÜ{]Ryw6JklyxjkolizzgU@TsgjuWrv}lxy  485 gxtqwgdeeetcpg] /h2oa\\^qOi`RgCagwriziZpv~7brfTĥ &GòV哕8ZQ`M%̀~^ȷ &*3@47/ O/ ц~~ xYYlVzhiijoxijefVFjzrtgtscN) ?73! 9cK`RZ]^\Y\YFi5`dedXYhin]{iXg 69( 8:&VVST\a,粃՛Ѿӹ  F26577 @F xևyÛt! stXWollh[konn{hhoTe\tvu^t 3(&% t2LHc1uZY[YYWMfHabdedwgiqynh}{RQ 8IF1 4y]nUއ1XTd3 rҚoix> ! b32556. T1 򆫼هvva ;`~]kaonjZnkijjeceWlsihyN M61 lHJdvb[ZWTWUR@bD^]bcdefhgkfu{kxd@Hg=G@?-* !VojqtCX^N)תܺhxgظ -`51257+ #3S hk M}UQlljkyVli{dfe?lukvM +52 9GIadVHiGaSGTND`IX]`babcef^vgkl}wiMd!SD@9* `OQnrp6baƶɸ̙>  EMK'1469+ W%  !i~thdqxi\lnjn]kZee}dl}~J *?/ -7\]Dr^;YUTTTa?:\r 5IC:85Gi9yqֈ}#.(;WZʰ} =zl^snjhi}wij}fheN``]nWwUURQKM?W=Y[CZQ]Obgis{t~zWt͒sGR =C<,YMTQ\O]ߖwL  gF=*56:M= !Z- Ͱ uixScSujjjiij^z\syfjxk{5M #62# LZZ[Ht-iVFaMHH4:yJWien]iabdkpz{xc@`*J+ XJYQpNI?ԩws - M:*8GLV !X* Ο HqkZijl~`\wltyYptXS 44 GUWdWhDdTNKGHD(TFVUTXYY[bditzziQQ Q9WL[^7ouՈ 1y  R{jg{  &Q31EHOW7:3@U sȷ azd^lxlUikn~jwk[VOzŜe 71/ WCS`TOEfSKFDDE8FJT^TaVVZQttloy~rzxcdXԤtWV]wa/jej ] 9NNNMN^Y\qbeuZkY{q?>V`,+=}gQ96C78&?9S[C)\XXŒz  # T =TRTi^^b;@1EF U} HjpoWppl{nlixu3cz 41 I4>DECEYEC>:;:If?ILJM=OiWM^`bdSi}K锶l@ {Dh !475*J=CYinD Şѣ{ !! (YdYY]`^VW nꂍwt 7ƄJxvIllilZnjcqZys E'1/ F?+Q?2MC?=/<.8IeJT8LYDSRTSYiZMakOjosy~ks;?̯h 84I9;-&`M')-%5G*8S27RRV^fnsryu~gjš\Ն 55678:8<@FNIV fb =! Ul^^brfq8F%V1G4+9 2@Ysr`XNMILJC,27GI[H8MGZF\bc;2=HJSD1@@6IV^h}{iɍvq؍z 7&)7DD78.4eJ^4ljt &) 2IS^]^bph1g#JH ` 2҅y3xyttetsslllj@p{ 1// [MIED>?C^TMM=JM\ifVVC:c^-+LX@>;WpD.J@<:;;&S9RSx; s ,:DR::>\Q]i/ǙYc : IKL`]ctge3g FG rli q{/zyts]ssXqnlwvhXKŜT &/. ŸTKLHGRJKMM`OQUTVUXVHWY]d}ipK7D?O;7+;@MXgqvow ; 󥙠dsϚע #,(4?*9F}itq ( R tWR^UpvX f, Sš 5wsuusqqnWizhqnês #/- u˻ZMQJHGIML?COdTVWZ`O`Tc}~I~e#>867561IO\qq,N`3˱֨M 19Ws ) ,QT]`adgd3X!FG z߻镈 ~7wudtaq`z^i{7uÔ~* &-+ 7Ź»jMCKIKIKMMS^UKJ\Scfsv}z]VN5!e~V9(7678C\O]gN>a]^C%eƶٻڶagy * sK^^^dodZ Y <ƌ%zwDeryWq`l]p̨v /, hWD9MJLKLONQUZ\^dh{{}pZRL:,-8 Wvwe!7325)%?8:cp}ԁ6c^aiq6 Sӿīòr - )f]]]`dfe3b+?I Xƣ h{yvsqpnoYyojZiŻ̭ -/. žzk`IQOM>?OFUVZ]dp{afIO8-<8552/% nN424669@Mf~)eccc[VT:)鰬lįvr  TSZh]aebQX. y s9y}udoranoonTl̪үͯ࠯ %.+ ŭzgEION>NSFWZ^b{~}c]ZR@( 󭞠 6eyqt^qs^yZ`ƅš '-+ ľ{vtlfKXFQFGIW\ilneqi`[VOMLH4E=;?<;::<:97:8667#9nYio!149E)bbetwG4iXUU`S 1ﭪK  O]]]\^`]-u%6R wϨ Lƍ8dxursttful``ֱƩ: .; #廯~zwpibQJGTSFW[]v}pwh[UQMIFD2>====>?==>@N<=;:Q656fyYv] ..#+ g4fbeek[&hZZVVc(WMJ { 3ca\nlMYG #D& ꭖ΋ >ryursvvuvvuqa\QX˨ƭ !-, ֵ}yyxupkgaMMHJULj\ouq^i[WTSO?KGC@>@<@C<=CDMCC?C>@M9853./1--rXqo  8dadsi1Vt^]ZiU%*kispTF»°9 ]e]L[YXXG Q. 賝 Җ+yuwgwio`[\Զ ,5 ɱ}{xyvvuspnkhdUO\ZK\gfjko\YWfSQMNJHGGGDCC@?ECCC?@CC@K>>I=H*33:,,7)) UjJkV 1eUdezD8fv^\kWM5zu]OXD&FǮё / bYZZWYUs9< Ȳ {M{{wdbtyw]rxaV̝ҷѳģx ->' ׺s{{x{jwsfqnnluhgb`^\[Z^k]jZiYXWSNNL=I;YHHEDFFEE\DVEDC??=?<<<:889N1-))+)&(eUj GN`xqX5e^`ZYc*2 gyjGS^?/9^o}}^* ,).rY gd]WWXWV= ~@D/ Ҭ I֍yz2w~yxxuyeln`S沨·Gh ,(& 5Ō㳪w^dwwrqttoqon~iiycb`]]Z[]kZiiYWTUROLJJGGIHHFFEEQGHGDE@?D@><<9:88865@41.+('&#%%# @rRT#pIcbh{].i^^\ZiU)egqol^YEOM%8# &I39/lu94s^VTHfWW{ /R {űل Ky}x^j}{{{xTolYGӧѶoQ8 ,:&! ǹvшvQ\pljjwjihhhea^\[][XeeecVRTSRMMJ;KHGFFFFEGQEOFQFEE@?><==;:9766422211-7+%%'%%! vR)ò8aRps^>Y}\]]W1߾ꆢggou5]krRIgZ# '/4;gxw tMXVUUTTD (F2 ڬ r9yzv}}yxwuqutg]߫ÕˢzX *3 ͣ`GdjjshegcaaR\][YdcXbUSOMa=IIHJGWEFEGFEEGFGDEDDDC@@=::987674342/./-./)((#&%!! :GxEVadw/W\Z[Z\i,@5ײxpdnYjYt,7. !!=.DD=I;=<:86541452D1J:.+,,-+'2#   7cbtz[7j]][[rX8壺xW( #!'!.7::=>=?CGMYf~y<[g[IRUUbX?Q ֶ Oʈ{Dk}kyjxuwwbxRٮ [ \ -85 ^ߢv7No][XVSRQMMMIECEC@DD@??C?CC@?EDC@CCCD?=;=998887C665431//.,--N,++*C#!,! 1Vbfsi.f`a`ZfjX{jG W !%18RDZRC???C-(Hao bVSSTUXL i!S2 ˬ΄ }-fx}iyhvxyuuts]Wիş± 64 '% ۱~<]eaQQMMLJGFC@2EC2K>1>L@C@R?Q=?>ED?@?==;9:89696632341//:/.+,-)++)(' !! GUeetr/Zg`i]gq/!QԵN #/7^Vg[686.X@CMQ[vkhZN[MIfHb[\#4T {{>jf}zxywtur\Vӫā1o\ %% թqx9DNLHFIWEC?2@Ci>===>W=<>=>K=>=CR?O=>=<;=I==<;>;><<<=>?@><=<;<:D877656573411/+..,*))5+*)'36 ! :ddprEXk^^YYvc i ,#% 8>cML/L[o938K:HD@OJVe?Ti]VTXZ^a=X ͬ ~^nigwvxwwwvd\rEծ Lըz 4&- ٮsg .CC@@>==<>><:L;9=;<:<;;<<>><>=O><::;==98::;;O::9:Q<===:;97763@475355113R/-,)('++4'&1#/ TOcgvbM^^i[][i@% ))95 NhwaMeRO1iNL2=JkGI[II?\]q UkO[XZ\a`*'DJ ۨѣ ŢMixvtxiykwwiywWѹ̿ ϼ2'% {wko֝6(3<<<:::::99;;99:<:K<;;;:9;9;;N;8974534@7655231./-,+6,,*))(((2&! ֛>fen{2^^a]]gig qnx S+ ?lf\W>NabRQMNO`<;KILMCIyxpa ueMZZ]`c>3]6X8 - ndj[vy{yzuuJOӲȞz* (! ǫ}o (=<:U:89969,S88888:7879:98::,7796H4533224Z43//.,++)-Y)()&&%&& w:eftk4[``][\[U'tYh *- 2+ h԰wizSHlRCREE@iR[NcbMMM?iK`Uh^F^jQ[[\]bb*#ID Ϋ# ӌ}i\~zzw~}jziay\ǩ{ %.N ïd}pQٔ͆?;=;888987:;7889797997788J;:887863331123222..9*>,**)*&((&&%' HYcp~=Yib^^Zfw-EkM !(3 ܽyv]lQc9HTfSj\DCNR>MMKNOHpi8 xZR^i`dsJ,X9j6 {ծ qg~{azy}~g}csTƩۛ #- ©pυz~{zxxiǔ =:9:87666J86489)78888977778667@?2222.1..2//-8*)))()4(')J&&8 pQfyvFL^jb]][dH3 ) >&' 깗z]euT-ggDQ@QOO[[M^9 # %%3 2ҹ̲xNNkVgTNaadOQQ9O?RS;MaXxnVbcbchg7;IJ ljyyy}d}~Stvȝ? '% o t. wgbyvoolnlo]gǙȼ :785647754766752?356Y5@6422221/.D1:..-.,-++++)(()W(()+) \So{/`c`a`j; % (%Iْ{ztiewivSd8R7EQ*bDO=kN/12/322; .,-.-,/9-,,+;)*'+'))))= oiadqx>bqcae{?  !%>N1Q1ʾ̻ߟszjQid45V\OabOlbQiRESZ2 Z ;pzel~srV;(ѽ֠ !kFkZ   qZQUe hSWabWTofŐ 542343>23==211/113/1//!; -.-/.. c.,-**=,,+++()4(((+,I.8+++,+,*+*)'*(C)kV^ueOD %%:-2D  ! >SnʿʒoVz9MLF,^kcdlORTNQlSRGRfOzD }bZcedhkFMp1\8 ۋ ~wJ{̞ & 6-4 dhnO bRQi{iM> 11-12/2./13-.../.-.1,-/.....-,+>,*,-**,)7*;+*)((T\[c}Vf :!!93+.8>- /*87`x۫{lghyYJ;R5`=RR]FRSSVWkiE@jriebgij`)/NZ ĭi Շsvo`,ƖΟ ^& X  xpMTe<}pYvfuVykwE-//..-/,?19,.-+-,-,,-.+-,,-,--,+7*++@=*-****+''4( WbWrXU %&&9;%!wZwH #,/;iֱt]ELZ@6}yVQfThUUSV^Q>RWYeUffdL nWeeiilTI3^7 Ǝ suqsr~϶n ]jM2ui. h}vUc[[gXF]r][) ....,../-+,+,-,,-,8,8-.*.--..-+,+*=,*-++)='9'&8& #]W}( &)-@4 p?k\ 5F\淹ta]L=HDGVUUTWTTM=FK]qb~^\v[Yqfii](-EN f( Cŋ}izjdӫ 2ZN   8D[@>C-MD8 6Q3v4 9x ƙr -,,,*)+,-,-7+*+-+=-,,,.,++@+.-*+<+-*)++()'&(&%h1 '.&<1@z  rM]&H#-;\j͢nhYZew\snoUEWTUnnRQNRf\Rlxk1pgeggjlN4C]3 ipgӠ [( NMM}   d`QpUzb}{ ?p > 8~W .+)*,**+++*+,+++-++=,,.+-,*++++***6*')))*&2## gR  1% T`}  iOQS:K1y؞~aiqHNCGF?UbEESRN@SH7NszqzQpuiYv{jjT4&HZ M Ȼ kz`w5xotebwU Y76*'lZYMI:nXgq< Z Xc]# X4Hw ++))++**()**++*,,--,+-,-++**(**(((+5*&))&2#!#(On %#3.'!ji`  XiR G'/@&Tbĩznfu[cWiY?ej`S[MM?MdYcid? dXfegilI;}5]F vǧ>؄ ȍc{vvz+Iidebdblpi\ !467h3Y`o^LF   +l3XL4Yʲ ))())+***(***+*)+,++77**+E>**)9(('4(&)'1! !!( %&%*, .gwfH6 / KhH !(4,1KcʷtlW^WWWXeiGH\[[iVb`U]]SNkOoUYLiq dRefjki?MNeøuody@VcWVF`>dGn8L vDx/U Ka  G n%U ,)'*')''&('''('(&&%'%')'&(&'&'(&&% !!!! -MrdesvTW ,. G & ! *EMttǾtq[efaI@WWjcTJXFSTbRUh^di7ORegjkiEE5S9 W{ wqIT\dMYWXVWRUTXXM[{#5G7)h}  {.MG ( zNoMtS *((%7%&(#&(E8&&%1'%#&8)&%&#% ! 5!E!kzvgeedsWI6  >43C4C9.>:iٯֻh^^Rf~YXLWeqXqVSRRDUZQVcsFyiUdfjl^,2R] R ya[ dhchYW`FRQKM=RTbMV-47(:sg 9>-  DisvdEq{]UM )(&&%#&%%#%%%##%#!#'%# %%&/#!#3 &> ghegccckzMW  + ! DL 7-5HRǷԗlEbQrZZ[YG6WVSOVUXXNjsoiTaZgegkG?s;R9 n \pvv8iqb\DURDN-IHXKMNRf`(2?68Cv  %N,H < !]V{pRhngHuk ;DC&#&!%!#!##5# &!%#%#%!!!!! #&!#%!((He{}ihdcelpRT , ##% yY9 , 6+9=RɬdYz;[MMY^jXUVaGTVfWT]ftwwjeegjnn./I[J ֱ z^yMiYcb]MVRQM[!CIKMSI132(vV w95/6 t: MWHzOkd: '?@4+13ji]cx{vjidckbrQ?  !&36=.. Frsx9Ov E#TiӞǃiw{uidFdLq^iM[\t[XVGy[Tgkv~zUgv`gggij^5C^ Ra¬lyu@e#fhdi^LOdaQ[fGFNMWIDCCIO, (=14I`  <% #! fZbeik[c1 '1#! 3 C #@&C6 ZfMlivjihfxbMchf4D)@bU,>@9=3 '87JrjgWQNg  /%Qnro֯ز`{fnLwhnlb^^\^M\[GV@X=`ejtqHhOs[[giiilF*9`E >ɽ}Rs:[ WSs< ojd`\R=JS7C@CJMn: %+/17[ T/! } ]a\azjUyb4} ##.   87# 4/ & ToYbgvikfgVbaa~iELFH:2#>`\N> iy[]dH^TXYVOi68)KMkhwȬźUokjc`Ki^`]br]YJiqkiM[whYdw\hhiikkI^ ՝WudW cȸL9@pc]2IQC@L>DGMeR (-25d  5 OM' %HQV\dw]ovF4#(!!!! -3!#-: ;6ka]Vlzieca`a]{KH   MuF-?DFa7HYTVpV]V  &5D^`jb«Y}[FubbR^ql`Nk\LXNRfhlqgo^5Htp\ZiijlJ'{6T; Ȼ`iuygY pF(RaY@5DD>C3CILiE 1+.2Y n  U)>LSZbc[n87u+ !!!F;^iD`wigebbbaalOW  ;jG ;1*D7LRTauq%--YYgpۥ}ihdLea`c``aZXZ\btwjb{by`xahhhjlbHR Ͽ{qeyv\` 5X=iXXOhbMC><<>]DEIWK.(.1j S;Y U5>HQWrtgnH`~6  =2!+ bv>\oxhXe`^\]^goC  (DhqqM 7 TEJM]ZS[d )! -,\bakckzLnkiv~bcILuK`^`qsTdgaj}n9IgMhhhknI9z=`> ɺͽivʠp@C @gqa *t]]gJ1>O9/@GHU[G&+%g( ' ^M D&8DJU]crnpc8 C 3#2  ?JtQZcefd]][\\kg YtY`bWNVt4KI\[\;Mh*  *5 -8CS]enzӶ˵p\hZeeberatbbabscfvo~oGqzqShihwa-#HOοڕdi”vc-Icg> 8,i[^rJ.:97=@F:LjV)#+ g% ,? JT Z/5>EZc^U ! --, 7 1ZOI]wgc^a\KZ[]oM)iENLVKXMV% Sk1J1:IJJR J5  (4&Mk]frfn^wr{igfvedccbu`jacr\`nhz5@rdigfilyH81RM źyojʶyzRIeeEUKQ 72o^`s<-GF9?GJMMd(*1f# %sN J/&74L[ruE *44! &Xb@Zsnd`][Xnk\cj,@)?=JIKLKIME —OF-SIXu5% 1'I`fX`WdԾ`pVoj]iZXfctdILaphj`ptw}lMr{Ufrhjln%*Q^̾~ָkrgżxuK\iMlcj{<);99(?FoXNy!*-a  1b N1 C<`qU !##? 7<U  /)Mg7Uvc`a[[ZVZYje8#OJ7FG9KLJIHGhT բ <:d\H^C ! -#+3>KUrQjxѯůkr~q{p{uisgUeeohWZoy{t~LCSdZggiooC@2LD óעlwi}x%M x i fidjXK2G9):?GJMMiG#&,] &( vM L/S2< %?!(!?2-*ETL:iw`\ZWp@WXXc8!1FQ*@EHIHIWFR9H/ĕ Z{UITI3iM * /+9@5UZgĺhX`^rrl^lxfVhxwlquy{kR]vzlfhjlx`2HQ ȹz~hڢhTj&FW {tsaphJ>;88=GVM\f !)Z  /r G>7(  @ & & xe,Oi+e]iZZVUUUWVg[)?XWF@MEaCODEFFFY) yE6JHgi '  6/5;8QLcni׺zwt^{Wi\fs{gGgQiScw~:H[Qf[llnDXr1a? Ȯԫzndї^!j\hHKsSzMpo/?964FCFK^VV  (V *'! [9'# MSQ .%5L MC O[9@q`\[ZUWWVWab&'GXIDC?D@4@ENE@ET@*O*vg9GIj -&9%E<69GMX`lnx}xsV`lkjhsZfgvZspuvuxoVtxnZiikxY#*@cå܂zsۢQ^K(Qu^[[kvbzl1:95(:?ILZiC!(= &' ! . 'ki +#-&%1 W DWG,po\\ZUVVWWXyFMQQF?@C?L>@DD3@D3?57*:CHK/Tj1 )?+15.OLS]jw˼qpzspjo`ZtXghiiihil]nduxz?2YdihiiopEIDS@ ưgxlkqh@ic^]HbazhSD8(:;7MQQd4 * =? @ ' !'9 *nlRz R(3 L,q7 LLNvh^ZgYXWWWcdKCfFD2>S><>>?@>>?N;RCEGHFE5CN? &%395(W5Jfo`h.7 F ; #' OVbe= TR   N j7 KD.eta`\ZnXWYXl`(@YDC-><=;<:;,?4D@M/CKp -&+45<@MVakuѫswrt}q]vjji}uhSTjeicJcg[ihipp5\CT8 ֶ~ف}uĥ`>icbccb]c-J,RE,//?I<><;<>,<>:::KQT* =2&#;.58?IWkwo׿èjvgsrp{lS{iuISChhj~^swyh{tHdY[gklpf*(H^ ܿ]knn afdbbvxN+%1UTMQVZ\xd   F 1,!4%,4O4435*TgG} 4  M&.\6Qvpd`a`ZYYjZj2>/'OLG<==89::M=H:;987<=IRanv~ɝwuryws{pwjkjvy}kodrhuyyaoUkgjgi^opDbo.Q2 ~uѤ[g5 h~g9MH7GLaSI\nh}5 +C+.,-7#!!&SMI3113iULv   6F;e7 )LQ7cdTs^]]Z]\oMY\KZG)8L18&Q:9G8F;:74244/36455C  Q(1 &H.5G?UU`Ÿrt~zqoqoznlTnnvk}bZvvz~tMM`Mfjknq:Nq1M7 ο᥃}yԪ~orI ShXMNTUfXY[Y]jN 4>!!! 3!52**'! q2uD* ?M IN/<>M3'6<&58#*!C*(,<77;FNWVzy߿i}wprr~ollnllptxv}}}cCT]hhikp{>ap5R9 ɻYةˠsug GMZdddZYf[[nuI 9+/3:N7;HRDNHFNV=  <  -S Ma[LYK[Z]iy 72#3 qMTOGHSHKJGR  2/I, N@Litjffca`alee51>>><87966JFL-++@*()4&!'%D(= neM<*#%/#6*) 68LH y 1KMC{ijigcqaa\[dH >??=:7D9QK41**+)'& !:#3#  9֓s\;/+&&##!'(+14:%?F5Vuz}Ŷ}ykyxvstgtvssptuzz5}vybzillzc&S` ޿֤xj~ƒMLi4FVn~q  !4CaXk q  vJJK[KKOQ`MT6*&  &^4   M.,GKWz{~iheT`]\]q^=<=;K665H43 .?*)';&+   Ѹr}48<>UKN[eot˼ѭr}zxzyzvvvvgsiwldMlrzYiiilq[&*ST ̻pp}ľTn^flh%IIHFb ~ 7 >cMMMROSUTTRLc !.9@n9*%, q MN[[~kkhdcckj^\f4 <9898743#@9-*%!3 {LspW4;%H '+;>69<@FHSc`isoڿ֬~j{wyuuvfwuxzlkMIW`[jvnoqGao=M2 srp}qȪpû9JIHE[.  b`RQSTVVVS]NJHS:E;TLH: G#@ W @RJ@{ikghebaa`]qLF:G:764.,99'(5   7đlI#D8-/ 7H?CHL8hFd]}ӷwrz{yvvigsTEze{c~{HWu~{Z]jist'4QQëfrp}Z7Մ=IJHVQZWX=<8F  -t QFM: qrz}%?UHHFGFGNE]hLa^RSbYWaUSQMIG@3=99K (.  VZM\jifeb`^^^kh#(3&2%.++% &#  2    ,!!(914=CQKL^@QS\Tiso˽{~zx{y}zyuuzjd}cxf{]Gr{~Witinw(+IT ȹz]pk}suå:JGGGIIKJLNQTiWVXVXSQROVIFOE2;=F.&' LH=~jhfbbaa`ZlD(52/G++9#%  . .     #((178>EGJMN`MRZ`qlvҸ}}l}}}jixyxn}~y@hh[hhksu?es@V8 co{t˵G&(LJ;ZMNMMM\STVYYVYVUROKJGDHaD@C[>LKK/&: ^a#YD?zihhd`^`^\nG7K+6%%28  @b    6'),.3Q:RHHMN>ODVZ\cZuҰ}zkdz~}{zwld}{nz{}i=\s{Vikio^%MNNQMRQUSfVXYXV^NLLHG8GEC?DGGUXR[H .IU3 ͇ͫi{{zowܢ<7ROO[O\O\STVTUchUW^@KLJFZZFDEDWJIGUd,. YC7~iguc`aO[hs &#-:1 G     -G:%+/1478=E]?RRNDSUX[iMidxwsl}~lolE~~p{~uVHesnciikn^1DL ľzީjwylr[!TUQQSRRSSTTTWWUTTSOIIGFGFDED8HKLID6 ph .X3XkiftTba[ir: ,W  * ! 5#M(-1EC9;>DKcQbRROTWI]Igktۻ~~~}}qz}qgHds\ilkrHbqIS< ʨÆvjxy~~ȭj՝H@UTSSTU`UTSRUVSON^KHGEOFX@5GTKKLcW+ *1 x,(yhfVabb`\sT     == 51#.%!#%##M 3.3#9:?DE`CQQRcRRVWhbuiq廸qyq}~qzo~xlu~`ihkph.&ga ®ֺgrxiƋǏ䍐*WTRSUUTTUSQSQOQLKIIFEDEDC7TVILJ]4 -6 w R1 ֱḓg~}ni³՛ɚø…ѵ x3XVYYWTSRRMXMKHTHG@+DHKKJYX7\ѫ3CXaqhoc`]gIE<9' ##!1##8&'(3(+,**''('*'') Vo^ibpSsgxTddfvak^`bdWXf\notxoyǫzx~nr}ol\W^}~[jnntwb4-Qa κՆtxnƏϻջĸȖf(HWYWiVRSONJKIGHGF@FJZKJQR3 .wk{vhgq qvZfdfehirq]yxWxfXrvgy}Z{rrr`qo}sswwytxy}}k}~p}ӿŽ{paakpsxFdMU61־pgsfsk}ͰȻջ۫󲩭QoK18U~txu`n hoZtyyyxxrsxtVtdrnosshyza{odpqnqpssgvfwugz{~oƼqqyWllqvtc-JZ< Ɯ߬{Zz`ssuey{˼־ϺܰɺľR >alwrvvy tjorvsus\ue\xusfsroo~tuvaor{popqp\svwuxuz{zk}wĽDZq`glnouuHtKOM9#ѫesjvvtysǿøĸֲ~s:qoqsqsv{ [gio`qqersf]utrctxvVsprdp~edppcoopoq^~qwyy{z`{x~}}tûȽxr}xalotwb)GZF ڳęƃWzytujuWW\MSUyMFENZOOnTRUfTYVZYZaaddhfhTffighji}tl}aosttwixxw{}{{r}snurƼƶѐzTlrxi4MX@ ӕ]Թчpgwrssjoߩι >& 6QdZduE DFM Ok{gQEFRQ\MQRSN@RUSRSbhVK[\M^Obsabpfsitioptuvwvvy}~z~`~ͯɥʪgolqtxw@^l\2hԻˇnfsq{evzstijٵȳc~wl]XSQXLKZ\aD1+GUvidTONM>Ra[QQQNRTSDVbUjJW]]iadbugf~xqtdtevxy}k{~rͲԽș{pal[v=Mc?=̨MgqrnavyȺޟϝ5Q؆tf^XVTRMMLJe7139.&2(VaskTORRD9OMKXLNQRTUUDVXVY[]`a^levijyynspczwlzz~sw}ɬ³üƭʮ˻fllrhMwYpL,hտϲsnlbdteϻּƼ˼ǿ,y]ohe]oZVUTQKF.%9WK>?@5+1JfvV^@M@LKKMMMONQRTeURWWXY[]MRcvsghlpqptvvyo~}~~utqygڵǫƬǫ}enpvxCFD@D@@?<<DGEEEDDDC>>==@>'!I5a^^;Q>=<>*6Ia{Ra>L@?O;=<=/<)+5H[}orNMIG9GE71JK=OMQ^TTY[kfiglptwxz{{Ytqzj~Ӱ߭ŽѶɰjclqt{Jr[Q8@՟Ʒڞ[XnYegikp^xoտܹԼĵĝSxO,.CMLLFFIGFDD>=>>Z<=;)9/FTvg]K1GIHHFHLNMMOTgiNbacXijlq~trtxzts~Ƶֻζƪǯ~dznfu7FV>5ļ«ẃVTWgeg[i[uzi[ %DKJSHGDDUQ?@=>;9:78::%#8if}xXK7J8GILMM@b>VX[\]`thj]]zrqqaz{jnjxvȼǣżcdlrt}Q[c<*ε߾Ĭ˞˶o~[l{eVjoslsι~14HFC2@CC>N><;;:<776M.*-JiutM;J=;MMM]TWTWZ^`cevhnaypvxuz{~{}ub5jni±]nnujGWU׸òƻ¶ŤøwlRuplgNhiowӻկѶɻέܳފ 9GFNE?>;;;;<<:F779669'*!ThwsQN<<=;;Q:89:86779*%E[syzVVVJJYYY]^`a^Vvghhjlzqsusegzyz}sopėð[lopsyJfT ŷƸéƻȻ˸Ǻ˳媃c]ipahWe[krxʻŽɶєϽO%8D@=<==?;=<;87:9<;9(2&?Ruwi{\MaN]aRabbbfegii\lkqpqqyyyd}}}dlywcklrvy`VT+Eѻέr]rfnjihiYVY߻ҷ޾ĻCWl%-EC??@/J>=?E7NXliz~ggfKaabebecdgsZ[kpojkqszz}t~{pń~glpsvoG[E 㺳ɱq`bwdUlZhiSa{ҸֽӼ²ɲǫ˾ϭѢ )-#8GCC>K==>C?Q@=DCCH:L6EXb~[gedfuXehhhgilkigjxoptgfuzysloàwdnrtyzM[idLܧdanpvsnjjll]zszwɽ֪绿ֹոĵֿa݆)/+1DC4@CDC@CCGHYchyyjiZiKfdpcbMoc`dgiiMpwpo}w[lns}f\Ӑt=/徿ֶĻfjyzxwuhi}~}ªϔÿ߸ܸϰ̇nb +>JRFRSMQab]OS^VVSUKZ^QFehuzznl[hwfcba]`aapVo{vz~vsllqxQdq&pޢȹλȰbiieutuiy}بܢѼνŞUtx 9WENMNQQb:SSR^TTWZDYN]TdgizqrQReMt^\NbQOlq}xvyqaYu܈VvUͿְ}^ld}yyylz{xx˫վʵǶn׸׿Ϻ¼©a ;NZO\@OSCRRhVWVWcZWYJbiuonjYVKdba^Ink^wz{}}tnkc[HZs<*Ӽ̻vokdwxx}~ruqɜĻϷ ׆ܖ;έڹޮ̷zl_ +UTcfSQORQQRQFRDTcLN\Ogi^iXhNbHw\uz}p`jsc.vnW˳ũus~wu^v{~~~Ҿν㼭;̿ջּثֱٽѺҺ6 >ROQSNN>MMQSUTSVSIKZLMTzlW`egiiodphiq{yin}pjK6flv}-Iچs~{xtesc{{nuwַ߳Ͷ͸ĪѼɻƭ龱w@M (]XXYXVWXYʞ8MLUIN@*',qhZkOoYuy~zyoxttzuUTCfe{wol=Xusyzyz{xixs`x}q}ĺͿı˼ ̄ #RNttɮƹ@H= Jwrbi^QU7Ƭui^WRQRMMMVWNVnvY[\ssfk}xuy}lyvrQSMzck{3Ts}ijwi{ywvcrwzֱ»黽ػ=E6ob cnY\eowxzvrc2@Ncc``L6CGHcxtv^vuuxfȀ}{u[vzwrWIduoo{5Wpbvsixyx{y{pt}ڝɫ߻םb>:MNwtEpjWekiuwyѽgIORdfdgaQ[ZZ]]]^Zh\jdJgUY[FMViy{c^iRw}g}xytzturXOfZXzlv;Hozuti{p{ĸɭڲɽƻֽ܌I28IOG`neSeϽνEERhgfbO`^bcbbndd^i[[WXWLK\KV\^zbigvyr~wvv}dT{WNbn?sޏNk{uhŷֿ¿߹ѭҔяQ>/M\{Ҿ~M>K[/eNlhunќ ܄U?jqdVeezghqdda^]O[Y\[gZ\FUgRXllco~exo}ivtcTcagkn=;ۙsyλ¾ӾŰ}D<8IU~ǧzJG4DGMtxu`wyqu}sˬɒ݋SN\xujv]igeufllb^]^iMMK][QOMSl~ijuyrxzqz~q{Xʍnzwvtcc]b^UoO1Ѿӽʱџˣt=GLMiŝ{ND>I>S)j+ahhZinpthonjz?ۂPM`xonjiiShet`cct]aiO[YFFHOLUpof\{ix{i~q}^}ioۋizuurpQchWn\j]/}ȲûҼȤ®iYYYV]Ϸi]R>3GL~sJ['U?WaSfj]npuylŸt@Jqx}kjiYffNeeed`qaMnNLHOMZSowwa~ww}~sp{xwwrq^fxf\ij2Fֹ˽Ļγϻяs}⻑iMM;C8ReD/9J.3%8nbeijkqkuyrŎ׍W2!szoko^ij\i[i[gquedac^TTFXLa]uQztcr}~yurtscReniiZkJ:񮤥ʪ׺ڼοɱdߖaLUD>DXծY<)9=OKIFC/3brj]sy}v~u̹2 ytyplzzl\^iljshgpcdcLJZZsvlis~ƞoixtsq~edhljhgzk4\裹ȿܬǵ{nVQGDUpK4+:HCMMJ;IG[YE cuntlrso}ʼʳq2JuwxsrtsoU}iixgqdZSRTYqr}zsqvvuuttTciigVhgtnTFnzȬ{̖{ozxtqssscYXwedfehyHḨֽäs\}NDFRΟYM==UQQMMMJJJYLTI* 4hhik͖¶y:^wzzuroqr}plhWRDEQfZ}đȟqzvrrptlNV`^baTf]~~C'xѹټοͫlJVxfW@Xc}@@4=DSOMMOKMLKJKJ;TGli6 LTؿҹϳοպ^? }ejjiwvxwqoqljMSGIMx͠ztzwsrqsvwfRSjbaghnyrM.[ַֽɪҾ̭ndg][`}ۜzG:CMHUVSOQQLMMMLMKLKHH8`M D.vlàʿֻι˻ڵ3C <~{{{yzxwson\YZQaz{utz}uv{xvqtutykOLRRcffiijh:6lȣԻϻ๲lHcusgdhʡL?>DC=TRQNQROMONMMLM>?NLbot C9ʨֹѫѵH 8~~}yxursnj]SMTUofwz˽ynyxetvsv~iMO]abeVWegue4*?g˽θtZXjtqpqyXNI;EWFSTO]cNOQNNMNNM??T)&M *U 4yμウ֓ukM !cq}nxheykj^]>Jfwisl{jwwssussgSQS```b`MghkiKGDXaslu~{iiYZXkoy~jZLCGMXgDQQO\RQSQNZMMON:2!&)-y L,ر֞7P L}zwcqqxW[LERZxwkhinʪ׫ywxvtrqqo~~wcO]`a^^RTgJ\lxpxnzeag}~{rylkhedLaMWT`SRQS\QOOTOROZMO;& .3D7~;˳ʹ{Pkzz{yxusriRRXZIswgyUÍw{kvtrr}opqwyfaT]^][]^p^aegfhkkjopoonjfVbb]FYIhFSROSROQRQES\aQDQ(!-KX˼ۻ㿔tP b~oyhit^r~ijNN[FX\prbpuz ьkzwuvqrroojkshbQ]M\[N^[]MiRasUaSeeOcccRO]\YXVUTSSSTTTORRSS^nfbO5%-Fj¸ճ˻ȫ֮ϓt U}~~xtpoljiSZ:=Rapnuus5{{xuturpnjwlrgn^M\\]YYYMZM\Z\ZMZXZ]YWYXUTVTUfORTTTRUhhfT:7 8EeޯƬŷŰ`]f 4Wlbtr~sowlkal[V^wcrdinwqxs6{ޠqwn{ivrqnpoolkthgb``I\KYXLYWWWGUKLXEnEYWVTTRQGT>eele`7-DMrѸ°ɯֹإߺ٪Ժqz LnƋ{rk}n{xwtrspoQjGSUlrikozq}]@{{qzyj{lzwssrp{plxwui{qgdb`RR[H[NM[L\]^^^ZcTRScGhp`US61,/Gc]׾ŵⷰϾʠ̾¾ԎQlu F{}zzxqn\iFDQUtu}}yKMqssypՏpl}zvsrttploolkk~tsqguoffndfepfxZcSQER^eS?1)+GYZ俿ȯȰջ۾ڹŽd| 6n~q~e{ytz\iFVFp`lg{p}~yv>VlapafXaѐnv~}xvxvsrrcloolnlkj}ljljujj}h`MI`ORS;6*2F\uƳȻƻںʼ8 ewnq}ezwylhRS3>W{^l~rINyj]lwnlrghҜwt{yvwuqsrp}rpppqqloono\\eQIUUJ1=IQ¾׷ԱֱúƔɫή߹ѫʳʷ⍤Z (zī~{tpolljMQKQzz^k=:~itfhsglrw{ڵfzyyxzivwvsvvtuqqrsrsrqpi`>,3Ch߳ϯ⧻ڻǿƹ߼ѻʫثi 's~l{ivrrqpjjljHGfvH'pigdbacgij]^ɑlu}}}{{xxuuwwydhpgxH?s۱ĹͭͥʮӾ߽ѥ֟š̬? +n~yutrtqpqnuW>M;IoV ysft^\\`^aRyQu⫒iutisippocijoq`nҰƧſڮһڻɽƨϼƞ̰ƿ' szvuvrssoijn`]C?WufbOMZ[MOcfls~khxћ֫ԟ˜ƵÿȨϮƷɪŽӻƾƯeLE @nq}xxxsronU*2=Ri< Hon^MXXMSeqyi{y~ƹӲ׼Ζ꿲ҧԼèĮʸخ;ڿǾ˾ڲȫ^ Vr{nvic +,K?CT{{DDDNej`axpͷ˞ȶբν྾Ѭӱ¯Ʊʻճڲĕ׿̭Yux F#M=>5)%,TlUxwHZVes[pvrnfy̛ķʜȾϥϼŻõԲѼպ±خ巸ޗns <}o=UVvMJHM31}uiiWftgxxx~Zc]Ι̻úƻϾһťֳǯ̰ӹѪѱ÷ֺHX, hvfM;Nd}kuut]yzvҹѷŨȶպű޾Ѿ˧ٿ˻ɺɬ޳g f 4puvtuspjhLR`cpghgeec`^=C?sc~hd\tux~thwˬ̙ײӿȻ̻ι»;̶̔vt wvitq~kigft]jzgcTabqcJVNshkxXZ}ouѥˬʽ۹˿ؾ׫ֻŵѽ߿ͷ㳨&r ya^{nkxoxnx{hdacacbeUCOLa~{l{znŹҾضѯǟѼѰܾλֵ̻ҺDi [eqpnonn~edfcdigdefeOMJ^wijigl}Wh~rqÙѽǬȽѧޯhՈFU }qapolhihzishrgwede?EJetb}}k{g{ww^wyrö֬Ǹξܑ\ xq~snliiiikJfiiihfpepfUIEZqrk}}xbwy[{qj῱ŨީҷˁlG w~oqqokhiiljkhrfehwij`JOiшnin{xuiiiyxYһʾ̨̭˭ڔԳuM fx{n~llol]jhhZggkkiloJ]frkolYuvc{u\pŻç;ƬՒİ͙ɻϸ)f hqlnplk\ij\ji[jlljZVOajzitzzxƻսٗض࿸־͡Cv Vnrroonnolllopznonlqscj]lRzjwyųӲʤõßŶʵ Mcsqrssst~rposspobfZapiu^\^j~£ֺʥS( ?surwdsqdpa``pn`~tsgxypzvťŪʬԼƾj: 4~~tyvtr{p{proo}sSaed~~ΩŻĵҿԿ޶ӽҽ(P 4wutsspe~qpbz^psxqj{ũzʭµξȺ׾ߌȷjY >vxqopsstseqlXlcnlo^fwytlǾǤʹ֯nk @ougsgft}atrfruyvx}}~ɻź฾~( S~wyiuuwxvxzwvxxnqox{{w¯òºQ5 eexkz{{yk{{xyyww}̷w~o`? lx{z}{~{j{ɶtxvljH Z}~sivڽYi{tP a}}}qjux~ztddy~oh緷]Pwposn˨xv~ji̪Ut{uqv~lg`l׻+^,h}zz{vitr[?;Ipuiuyړug;z}otstckihc``28> stream XُduHsFnY]]$N&؆6/j-H"7,Zl/ 2lqy˷w~{s,)/i.rܱ:j4^՛8F~۶L}ryU=8r>WLJՇ>|T?]>- 4˫ tm/y^w/㪏l9}[={0mNN'!/)wF([e[!O})t.KD5#)w_^y?Ck%.qCB4lBbNa]\)tڰ/G,5/@C$Su^u%XZ.غnJ\Rư2RSW>lkU~9Uɼ ;!'K^]^~ݲ1%"ױ2?)^ 9brń74"eeW:6:  %d l jX(|:K>AپkVL,wo~V1\IF'-ȥcB4eG02G6#S12:xӸ67"ѐlbr) $e7~[0;!U~2$e1Y9}jƲ|&I-Flܷ˄ NH\5ְH>OH&T6 7|*By,¦*$ۀ%|XR%bCv39M l} vXfS):r0,.n .nWdHv9倭 RW! EĎE(B1_'NlU-+.GH򷲈+}' ,3㄃`X\&n(8Q꩖y=`ݛ5 ›D>/=mźap;$˶UӓCR VعQ,MH"$ bSbr1#ީRxST'grJaB7P"CJdWU8I(P!/t\dYmU \"}#]3oR$*HTF@\,!!IZ%O_ JUH_j.dkjGQc_[,5Pr̄\YK#D$Ɠư2 b=` $/ʇ2f'ɢ2jT#f oSoEjMa1(U 9q!TF%U !VYGrm)4AVIvYHY/mLp=#*8qNMv۞Jܓ-z?fr8B{ۥIufAWC˭! KqtLH5ʲ)~WsYM,ЅD#fY*c5gjV!54UP1zZRh2o6QH"+LmD[[(B"Ĩؐ~"k?C6-LZ5}%ítUZ{o`2[}bd/@QIjJ>UnY > *Zo) oҐm<ȷm T1~v vǬ cɶ1 azIg[V{jJnBYd>dԊ '4"ĞT |σLJYžHȬX9.5q`ƶz_^I}TױyQ I]nYߦeF]s>G$0uɣm"IUQwpZSB"i:Tj1eY܂ U+*=[R(#vlO;.J,d5\ߝb]E@[{_ #mʟ3"]Afe3eM1 05R]sK,C6?ښTVᇬ/8cƬ"GLsa)Ŭt2+cd:G=m+ZVI) 꾎e,zbft SҸq '.( I)Q%K,G(n~ccmT"wlu"N]Yqw\ '?bA$̐\9d9rC8襯*xG9.)T3LY2* `H_7IuUľ(軍/up2(BE.sNCf G8WB 30:.I`buL$5fgLMwE] ̃T@e#bQL+5l7!&bŘPɂeȇdD/)oUDEߑ6qFRcJH1FFU ZVM & 23̋LbbŪpߊieA(~ϵ;2@!;XP1BR/URep+95 +BE;}^rAk)XWy@۽Ulf-/^[=m[q{b\ԷXSh'a0VbML̐C@W,i]yFY"C^_kLLj kyosvm(̪n;P9fBUYUhY~*zBxI\FQ/  Z ;e%dt%.N4nH3+:lGKylHBmYG ij0tL|H*署 ݗ,'ejp6+ 'YȵB^gw)twvjSLheni*Udu(,׻`T6nI{s.w잜LD)`nqQd nP(\BozBcN/R2JR6X)X`@G Id>B\pۅGwz%(2!1<6O ("dhkk!"ATS$~`a ȜŗNM"xBTGYh@;Ԁf+1l8UT{v(Y{ĥ֨u{Xq*}R4AL=Tlsݑz|c4@KʅdmʩRUSXշR;*$`&Ozo4!W3FEJW ` bg249eZlbѴ`PyRl↥ג}b,Sarf,B*lhdih%:'̏l?1. FZ8+黂،exz30rk7nì`n.+&7~hUƉ҂ j`߉}ycst%rod.1CL^)ڦGa %|p l"=ìmrOl:kŨdZ! p'ZPEVI.x'nD/2_7ux `ͨ+qf_>6cynG0}:bxp,9Z16dk6 'B e6H( mkH¸'i!λ܁G?c*1GYoM\2!W=D}UNRw@djZ B8W#mH.H$F ϘSCByExG8'1[DZ>Ǵ!΢e]m/H|߰V4M*85_lz1XZش)dbAM.Yn+bŀFAp00*<,%W36}1ɐu;kت66MnD&\ҥBWjD)IǪ8Mr0'~Q +ɉj wLng?wijGuձ\Q*۹惬NЦL'ڦVlFp C<bH+PF=u;[ :}$`3_I>TUl}Ǥ zIM`KZ,$ǙňAd:"U}RCsV=i+꾊QR j^8b!Ma:5sGzUujgBu">g:bt;N7*zrJ^: f{m )UVrcH- axVZd{ѿ{Pk$R0CHr;RHbu@ X(I#T>T cc {o`0NhbE ;W`9r\5 uf齃i[ګ|X7!ڎBERT5DgAivgR (߈Cf!FrqбA\(eYMl{ #WwtLJ&C9(,,m8A8Ѹh<:*Bv<ƽ2W%`'?# 74\ *cv5ؘ-6g_8 ( =ЌVՎ18R06б!u ϥ& Mw+ :Ke;#slxL+>1ѬR$rTC47e%9kNPlﰊ.)dGdVF 8M8ʐI !C 3pZyД9T}g]<踹K Q㚼s٬yUr$F'Mry*|uo+rS U !$RPBbYhf"WuAh&6j0s2$Dc^;{[$w60S:RS1:y@<FT r;c}8S$=%pf@+':B؊V(+uaO݇ЇWpe[MF1v#T5݉nN r ^$Ow=%#C<^ۻ}O {E/]0`U3/WwYۻ_}?~NJ.Il._Kg?}n?>?7Կ9]y _i~>ԟ>e)nlu__=Kg/߶Oqa>~"~yV\[$/:Yۥހ27E652D,5]u.6G]O.yt]ǕCC>?û71e$ϰO\I-1hƁ\'cJlg׎ϥr=nzv1 MwF¤r{JF Ms'3ݛn>AK}DߟOe:ɚ&vFY ll՜|dYe JH}蔼m) mﰍt4gok"6Es>| 2Q{^p?}PC~ڇ(e@v4]aUThckӮ"ƕ^fD }@~MhslShJ{T{M7tAHm_ĥ FjuO^}gȅdX/Fe=HWI%1aH~i <go7gS*NR}'Ye!_Z˱zΕ۳L1+ǬҞ(SNB'M_l 5L}ߕRB0Gs f FW#c?Q"ZO<4nr~ft8Yj̞מ&FvH>aW n1:gs-u 2 vv=^0L>{^H64[y͹ ]oޏT u!|ОԞ\ Ξ#~TYɻ4[=LWU9#{7N[iR=ߤUnZ|ru+ 串~ɚ]1(qFuZf/OhbC)HׄǦn8492S`@j.Z$ͧ4wS>V?f?}(\_5 K:l?w*堤Y-맼`qD<_U?ְ7wJliLgLJcH?}9|cug/3 M4r,$!gv=R?D.NUkS2bײtwsYTBHe[O١_\ck[3ߡ|-=&Μdz;kCj6بwN]hH&Y*.]A{bwr߲Xlԝ]?VcP_ {LL=v(;g;)i鉱{ly>yH.l#`sxzIݮ7=c=iZ-8(6x;F7QS8җafj aN{K,\QeN/%nzn2єv˻oZͰ^ }7f0Gߦ_~[΅zGvl2hWGeUUqȭz$/~hw"Գ.3OR<:|⵰1tTtӗښi>LˁG"zCMǚӾnZ<`QoeZB0I<ҴnLuuUhUxUy[HNZ)'=`UbwiVJCwR>1y }sӱnh܇nm\CjRÃiZ۩cgZ7&佝Qox{欯]R_>+iָ9DGvwg `H_c C:;79܋rˬyZ'_>HS|JZ1z^}T<:Ϥ-/1/サ`.<3@2V B.l̼0?D @Gx (&OEk4QX80pSfs٧В+C1{~dމgM+}r$9Ji^Ў=Hg[& &d\#(U̙$b ǫ #"f 2/gaGӊts"D-[B+0YQm0rRB)O%]#(gX]$D]YעU4pȈHpt ,8B&~!tIfIƐ(,EH*SÀH_c_}109tH#!4C/ :.|wySNӃ7T"@#k^uI&,rLb F-q,[)-b633d !IQG4!>ILWU3]щKqfؚ1 C&Y5GmCաy |3 Ӣ<?&Ԗ AWZ8WɶC#/꼌JxA.lZ'l wDNGGCSʟh7Pkto%+po_${x辪1Q\QegnĢi6]1-HZ[e"֦w@ނA CR QԂ0bp3x2pCf9Yl_}Aqt_S{{Oq)=Ž?(Q,<_ O]A -hWwW(?SXT*~vgjyDB7V&[M#j}0ݴ^ :QCQ1 :қ!x KW=oNi;JÀZp]S/O/<4 Di} LX|D7ƜqIItƊ<- @q6<7׌#ͭ;0m C<67o𝜰Kwòs:XVEmYY#tX>P!?w= ?78?NtxMGN÷'9[]`f%y{ Hs85mu[yYK Kӂ/ޭ]Osrar=%?3CsDzcXws9Di;jQ?1TRljumnN-v9"ܟĂ"nOEQm]mސwΔA ӎ񟿌拥wX TJJ~#iղP~3a(m+ھWW:Qx*lhyJSU/>MU;2rmH4#ӏzrp~r:1N7 =ffÖrŎ(E'*F==Q^_]#'((>:M(} c]K^ДuwCRe1_ $\d `Lz[x zF ֪Lq$NB*89?xn)GzPSRls00cz~[tX<*$ŀBhGxe#Q[cqĪnUSAе齃G(DT]@z"J Hm Pz2N4k>Q'򦄍hAVH / sIm@FULv}3$ItEu$I}">30IwdQZ 62-di fT3Ei"73EH 4YAi0JUtuۨiH0M$".JaYB n@1E> مIPרޅ3SL`]1b } iHSwFQBm#hQ׼.["m[TCG[ * I"^&mgi-d:kAskvE 30m+ [, mFha"Gx#n×n1xl)K`L `z8>>*+kd flUIH("y^xdA'1M3` +.b&?Bj*EdN(T0ZУ^m0hE{zXuODoB 7@վ_"TUi 1|_' 鋐u:y!<Lgl!ɢh r"iA s"A Hgïd^ ץ':(T\4ܼpXI0mIBdpl--a/[҆L]m 6ZNrb lEe|#kPlj1g PFPy0҈Cdf&-D A> Vvd^3s1H1iJsEf  yZG˨4zPMxj13SV|UGugl_it-ē ڄbQfQOR/hO!W է21qP^&uTLor dH0ARGO#jXET^gcU{ DK8Y VdSERfB\&ZOՙN !Qh q՚+h섐az온2Z)?g\[CuaX.)LÚ@X4~p@Id}>nlidk6ͻJHjH9c)f!r]HkKc@IeY1MߔHm@vMJm9n[$!w\X%SV#wuST=yOEST=yOEST=yOESߧymQlAj_u~.+eg SbbyP74Ӏc}/i LSx#5ä|ȏl&4{Re;Uy".Of2#z)N=jtllUKd,5ʇ-:~>|TV:dIvݕ,՝ᒃL0Qǎ|yMq22u|>Ѽ!쬿3m͌nzXڏ:ojZc|H+h·G8;P렫Skpu}j6G=X7V_z[8NɳRfMcHH̃Ҥ!%%u '_<]htюnUo($w[EFFăv,^3%" K6ou ghH ɬulh@_L@Ո})ꎐn KŨz" hD !*RÓԗwMAf:ÀhFgUNC1!_ MWxܨ.(APT1Т+4k,D"*AD*h^DP~:TT f# ۘjd p;>h6&. YPc'M%@pARܪK5x 4_#61fbVDՋ5 {Đ(0쬠Ĕil1cXX>ۍ nlN-h2E7<_aX?:|ҋd-}s0ה&t*FR2kFMPO_mCaZGjfutPu`1X=.A g{τ@p ֈ-8I~F~u^)9bӄ:)îy"'1K)1;QU/^4 t $;Qӏ\+fwǧqe1wvu5c.1&yK[ .z.c$9h -6 _!6k4z{j7v! H[1v6~]Ϟ<)x<)Ʈ?i)˅|01ژygw~Wӈ,ZF4Xw8$ޕY`?|! P|y0lSiJ]:ösl?.~g^{Y5ؿoo__zdzl 8ަ ՍD_Vd0zL׎ua(QABmTM"ERŷ/jĶKk LQ}+fy{^lw8. &WY<8ppT[On7$V2u7ewx[İ-㳣MUڦ܎|y[mDy%ӓϢoJ'!'|>>5fy~*?y^/*~ԓvv Ϯ)dnvE'bM= ڝMH?GL zyzq5klt|t!wi'ߛL4v]ãD]<ņou)@Ƒ۩[G,CQm7K gqį">iOϬO9L ڣ8"*7+&O{jq5\+5xƓ$OӕoK}l%^"eM'>1q T[mEw} *mB?CuBb4,:]~׼ݯ\;I3?p*٦8o?\Ho܅/ P*DkL!"PfHæ;>o /oFɺ]TL쥎S ]~@Mwpܣ!͊-UmN-{4yǝYAfԔiHrKh!çH)D883Z }E(KT"}kj\s44P3 ]+IQ&i'n'#lF \u1ׂ`>lKU,."N7,DtY&xt-}Vaw,4U5.gGqrd_ou557ٴT25bȮX'Xw&9疫HSʦ#14u5 }c[hBvrBօ^ۓZ<$ UDxYVћ=TT:g^˟2&aKPnqI)FBBHLbf%*>7U-$WErՋH HbQ~@#W|a; E#ϴ4Wx,m#;â~PGts:a.80-APhd*;ۑ5UP򡝢~UE7:3:Ӈ᠎:I'uϬas ȊRy j@$;\Rz#ٴqtlB$} &v91퐝#Gbs&V"[HSf Ap``x 6U['"n[,C f]~B[Qg1@ݟm",+7nq!. v:@ƴCtT/+xlRN-)ʊC:_4@NL;Q{,D%)E("abg ipN?B, wRѸf X~:Ԩ4zZDG}I:t AoSg @9h< +R+pE@㜜y$xR_싼Ry66`=I1mxSKO(co'p=FלhQ+HGxԩvwLK1zV:/[ILD:(XqƒQ"NFyݿkM1ǁhtaņؓā (Fe05E09ڐk¡T1?wL#qѫwp S}/82m U0(*QUg^ғY4H(155 Ƴk*C N"r0 XQQ@aU9" d,`HR)EiJa /8kc5%kkk *k'&^F  !/R)BY>猡Gb5jrODc%rsބ]M2 1HW`sMG&_a8V5j:FK ͜cUwKM}A}OyfąR~8!GpgP6M k_e>gCf9/hOp񘄯)pxIT9:di/#$޹$Jl_G?~ۅBpe/w3 e|R)| Z qnfٚ2_䃺tPoF W1]+ٖm+c+y\ځmymϣFWcX-3moC qQ²~^OAʎste)Mc#9QyvӖ]xgÜ)=d~ xi>Cǃ9򄇹:((f~fO_}v.H5b4\H?C 5#(mp³"22gHN 0Eׄϵ,CfҐn3ѷE\#4ۘ! WA5MrАyM(gz7,Ж]j& G 2@b:BS,\1>(XXd 籰)>X] gZv&,j,,3aΎg Pao.>r2XȨلoP̩ endstream endobj 13 0 obj << /Nums[0<>] >> endobj 14 0 obj << /BaseEncoding/MacRomanEncoding /Differences[1/space/ampersand/parenleft/parenright/comma/hyphen/period/slash/zero/one/two/three/four/five/six/seven/eight/nine/colon/A/B/C/E/F/G/H/I/L/M/N/O/P/R/S/T/U/V/W/Y/a/b/c/d/e/f/g/h/i/l/m/n/o/p/q/r/s/t/u/v/w/x/y/z/bullet/Oslash/emdash/quotedblright] /Type/Encoding >> endobj 15 0 obj << /Filter/FlateDecode /Subtype/Type1C /Length 5233 /Length1 6016 >> stream XMX TW{DEP"" "&2hp_vM45bk0w5(.QkIgjLy9=ݷ֭권1d2ĔHMihLFFǙIHjdG7s|;LV |By~[=ֿ_`5{˅_ 490jUuu vP +mڸ,`sܦůކ!jO3jRX]1G{b-i=xB~-g;ԖJJ '9)HrHejV'3LxӏV0}y, !V"r(&$,SXh/ 8'U}7\~x+0;l\nxtt%x`,&Hc 2c$>F ,+TS뵒VjxY)A'Rz k}3he]7hS\Z&;栌?8KO/DK\-lF+`8~\xg /~uM:9mﱦ.O^s.OA6 ! C?RZu<JY' .RSɾ[}M_9Gx]FN4 *k%bݡe-Jm:g`~,FҘ,~=<%́]7|صs/_>*p(zfIؐROW@Bf%w\-8r}#yKb65A '9ƌ), X-O,+R9?5϶lr\'nuzr PKЙxh"'N_IIͺ 54WA TGk4ih9b剺.R Stak780@5υs >#@|05*8b=`4D}t rUf]b[+Sp48`6c p1:Hk•9ıP@ MtrdŢ saPNh5iZ9]7hJmvoJ4Q4q0,cOW6: ^/Cx~hfȍV*O>{ !hry&,#}gwz}ȶvΖ} t,55M(]rN"%cYjdatǿ>\z_ɚ+sq箙J[pX ~wJ8RTXG"۷rѶΆ_&?'HVU/ܕ f$=# {UH-^B8*DE#,'9:a1^9|^z"ڭXbWR[UxGc%ǾXݦo[@ïCsX4R`R jT;eU~So]kX=GVaQJ<>_7VK~ w4텝vs`0BoqU$ϝ:+2/ MNf\tBǯ1+DbL1X+*L ({"~ ;va,+Ewʸ&rUX˅:˔un%p oAeMeQ7G/oAW?6~1^hd9Ija^ϘO# 9 PZR!<660p膎i8ӕXyCi"BV yFfP4CKvu{xa#(yzY :|O;R-6&9.O]Նq,xRvQYyVLj4 餱 Ij;<;:{D| 0A} Y}X1'5U?tLpь! mP1]s]45:yt?ixd*J=Maj%[ߩˤ\b(vax6lA<&eNҧQޱ({Ǻ!3˽ҥܿqtS[7Wes* bi(>_^n9#6|ꗫLn;:eAB mr"C HyY3-A`[X6M=o#W8ngu©C/P 8,!(iħٟw49pT*1]~mhMyݚqt=jbƼqΑk`1ңN$XQo λ˜Z~] jFtbSp Z@O%qذr* `%Ṽi%5Ib٢yU%'[Ohqϲ~j+bGYa8mޕ#9~gq)\ &URktĮ9>@] eG ?}߁)! )6e'ȊeʊK˄y %%T2)k?>o؝-Ϯa`%z4v!8Y=^"i mOȻPi7{ L .`'n&$*% Yo;5 ї QփWq åaTqh2bSҲ)CgGވ6;yԀ`;*E(s/~+%wd)Uk]<| VQ0q0nn8K! >^ix,l;>`R1T=SpdW⡈&aOu to0ϤaS?Lu~-J;4C~q#a^#؛=. wRb2*b . R*uiهGC< VdK_ܺq5+ vL~V W' ll ѕxvǝ:/>x_}[BkkWױ8eE026b֠Oj8VH`,Ȗ¸TLD3[܌QiȚFޓL_0*]]LCKlX]LS1/xotw5Yi)vx/E7?U/2W=xՄ8Wz$~.zIԷBZ';WZr~/GPU-lY:FAj0v [[;r/\2A)KʝCD$/ȍo,AAw2EjcV's(fQ芡D6PZY)[k/7sTzh+:1\c9uKy=C}p{Z@~:6$X[xTw aOp RyBÃ1'@_+&cg:zJqJ< peJ~e47@Á{n36z#x`N"XDFt.i_Ѫ34)oWL )&-Wz KM{tA&)L%2pŨzOpR7u*XaRxM=^qNq*tt=W8)uƦ"fO0mgL`xOΰAzg9&^\ R7'" I m!=j> endobj 17 0 obj << /BaseFont/XTXFRX+Helvetica /Widths[278 667 333 333 278 333 278 278 556 556 556 556 556 556 556 556 556 556 278 667 667 722 667 611 778 722 278 556 833 722 778 667 722 667 611 722 667 944 667 556 556 500 556 556 278 556 556 222 222 833 556 556 556 556 333 500 278 556 500 722 500 500 500 350 778 1000 333] /Type/Font /LastChar 67 /FontDescriptor 16 0 R /Subtype/Type1 /Encoding 14 0 R /FirstChar 1 /Name/F0 >> endobj 18 0 obj << /BaseEncoding/MacRomanEncoding /Differences[1/space/parenleft/parenright/hyphen/period/zero/one/two/three/four/five/six/A/B/C/D/E/F/G/H/I/L/M/N/O/P/Q/R/S/T/U/V/W/X/Y/Z] /Type/Encoding >> endobj 19 0 obj << /Filter/FlateDecode /Subtype/Type1C /Length 2774 /Length1 3162 >> stream XMV Xe`gv-uETDVQ@ ((rQT(ٟf!菚&H_%{vvg;93y|s#1yBt N͞8ȋLe$Q$:N E8Q{0̯ζCPC3*1saļ~,N]dy~29ijĜ%"&[ ezn9yp{D^᯹ a@Ə10f(3 fQH& gь'33}Wg2& a1gfecfT`pw(83:ssZJrKL L y'oҎ9T(_?djKzx]`FmRX,3>PN5ϐIISw=TȇE=J8=#&[ pR4Ots9WZz ?mddstjRCd.$ jͨ2of9ϸMJ2&$qTnΣ=RkVpR%Ӝc)aadhq8HcF;DsHm9?hԵ#فc]#;$P8hBl!(#dR/d}ewm,%t+XKR_'a6uΫB™sͻB-ut]kVQͤO\_",eul? -1(5!0;eu|DzT+nQ:u;H8㚬0i*vy^gFj2ӢӸ[+j+6GqRZɢFInԴ6Nd$9Tݢ:O cN^Z6%r&HgeFgyDН@fj0|1b1ۢ5m}t;KqF$Ѯ;wdMS"4ڈ dŷY!9q7+9ZNe&-(pVQEV\4fޒjn?u؉5_7P( @}`%P:8r7G>9xBr./Hӎz/4-lqP!F"}$ROqxƤۡϴWkSXqpG4WX,mn T8'?klܡ]S)}OMzDxFaEGDt֙KcUV5-xb1*Dy{gDJHOX>(4\}Lr^@q=ofvƚJe+pE'+ͬ]ROڏdZۊ24|ӆ%k/X5'nҏh9yYNaGQ骊3{wvL-!#D9m/QŅ.LukCT֛Y=vKX]JǦdDJVTVnUf R {h)&@r LөDCnțB:荑HҢǯ=֟BmcqClxћr#Ji" Z 3W-w]z|J]L:Shi1%!*rPi\Pp\p`aD_DP4_BVI3’ >f,JҨ+}"Op(Խv}RS|<ŒK*gHA* z>&"JHsG_TQhȍoKQz$x!EruMD)vA M8pn~2ycPH -/)^p,qtǖxS F^ZFӉ>z#!R逆ߧ9F덀v>yYb UnX C@]+GH(jZ endstream endobj 20 0 obj << /XHeight 0 /StemV 0 /Type/FontDescriptor /Ascent 2118 /FontName/HFIAGS+Helvetica-Bold /Flags 262148 /CapHeight 2118 /FontBBox[-170 -448 1001 1034] /ItalicAngle 0 /StemH 0 /Descent -917 /FontFile3 19 0 R >> endobj 21 0 obj << /BaseFont/HFIAGS+Helvetica-Bold /Widths[278 333 333 333 278 556 556 556 556 556 556 556 722 722 722 722 667 611 778 722 278 611 833 722 778 667 778 722 667 611 722 667 944 667 667 611] /Type/Font /LastChar 36 /FontDescriptor 20 0 R /Subtype/Type1 /Encoding 18 0 R /FirstChar 1 /Name/F1 >> endobj 22 0 obj << /BaseEncoding/MacRomanEncoding /Differences[0/O/S/a/d/e/g/hyphen/i/m/n/r/space/u/y] /Type/Encoding >> endobj 23 0 obj << /Filter/FlateDecode /Subtype/Type1C /Length 1352 /Length1 1550 >> stream XmkPWwIȦdYhnmJZBLAQD, @X<U FDQ<Զ(h釶>ljghejw~sgϽs~8q1T4N\iD1?átIȸ E; A ?@} 4|u8ruuBmㆭbS^m@T".o5(L5JMzRH+!SVOE oLxB H@1BÐ:O\`ߑt(  G"7qH(A.Hji h_*)E ۙېػsFzMJy:-y0ni&G 24@zO 4ǻ•Tyw>p\: 2۴9yz>#TC& agz$HagVVxBuFME-"JghޥU?n uo•m AgˮmFyJ{4RvRo]JEv8- R`D>Hi',H'A=Pߎ$xi|T?ۮ=RvCmsαWwK e8Eby4dYa)ٶqπg ƭˇN3mbav쵸靮) i/W.4Ӽ:BʹD"`Q"mA'(X$WEg^B4B1وiTFB yz]e ]ή$DF$\[ӭ/w>x\cD &=/2[GWz߫ wR {9[ d]сVdI.M iϭ endstream endobj 24 0 obj << /XHeight 768 /StemV 159 /Type/FontDescriptor /Ascent 750 /FontName/FJLOTW+Helvetica-Condensed-Black /Flags 262178 /CapHeight 750 /FontBBox[-168 -232 1113 990] /ItalicAngle 0 /StemH 0 /Descent -18 /FontFile3 23 0 R >> endobj 25 0 obj << /BaseFont/FJLOTW+Helvetica-Condensed-Black /Widths[556 500 500 500 500 500 333 278 722 500 333 250 500 444] /Type/Font /LastChar 13 /FontDescriptor 24 0 R /Subtype/Type1 /Encoding 22 0 R /FirstChar 0 /Name/F2 >> endobj 26 0 obj << /Type/Pages /Kids[27 0 R] /Count 1 >> endobj 27 0 obj << /TrimBox[0 0 612 792] /MediaBox[0 0 612 792] /Type/Page /Contents 12 0 R /CropBox[0 0 612 792] /BleedBox[0 0 612 792] /Parent 26 0 R /Resources<>/ProcSet[/PDF/Text/ImageB]/Font<>/ExtGState<>>> >> endobj 28 0 obj << /Pages 26 0 R /PageLabels 13 0 R /Type/Catalog >> endobj 29 0 obj << /XPressPrivate(%%DocumentProcessColors: Cyan Magenta Yellow Black\n%%EndComments) /Creator(QuarkXPress(R) 7.5) /CreationDate(20090312151103) /ModDate(20090312151103) /Producer(QuarkXPress(R) 7.5) /Title >> endobj xref 0 30 0000000000 65535 f 0000000015 00000 n 0000000069 00000 n 0000000115 00000 n 0000000162 00000 n 0000001013 00000 n 0000001187 00000 n 0000001233 00000 n 0000001276 00000 n 0000433948 00000 n 0000433991 00000 n 0000678791 00000 n 0000953561 00000 n 0000971229 00000 n 0000971269 00000 n 0000971595 00000 n 0000976931 00000 n 0000977145 00000 n 0000977573 00000 n 0000977779 00000 n 0000980656 00000 n 0000980881 00000 n 0000981189 00000 n 0000981310 00000 n 0000982765 00000 n 0000983001 00000 n 0000983232 00000 n 0000983289 00000 n 0000983642 00000 n 0000983711 00000 n trailer << /Size 30 /Root 28 0 R /Info 29 0 R /ID[<018CB8810F203EF73B10D2FFFE21A3E7><018CB8810F203EF73B10D2FFFE21A3E7>] >> startxref 983974 %%EOF