%PDF-1.4 %туЯг 1 0 obj << /OPM 1 /SM 0.001 /Type/ExtGState >> endobj 2 0 obj << /OP true /Type/ExtGState >> endobj 3 0 obj << /OP false /Type/ExtGState >> endobj 4 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[255] /FunctionType 0 /Range[0 1 0 1 0 1 0 1] /Length 699 >> stream X… ФА б{^lлЖmл6lлЖm'kлЖm›Е{Лъ4ЪSГФ6СБРЯ_B"‰=H$ѕ!@6ЩbфœFЎ#ЗфI0ђJО#Ѓ€Ь†QH gЧ(’ЃЈЫ‰Q\JфТ,™Г””ЮƒYFЪцХ,—ГМTШYQ*РЌ\ГŠT-„YMЊЦЌQЋІд*ŠU[ъУЊ[Ћžд/е@–ФjT ЋБ4)еTš•Сj^Ћ…Д,‡нJZ—ЧnSЛ­ДЋˆн^:TТюXЛ“tЎ‚нEКVХюV ЛЛєЈŽнSzеРщ]Їє­…гЏ6NPg  Њ‹3ИЮZg˜ o€3Ђ!ЮHеwДŒiŒ;Ж ю8пw‚Ll†;Љ9юd™вwЊdЕФж wКЬh;SfЕС›нoŽЬm‡7OцЗЧ[аoЁ,ъˆЗX–tТ[кo™,я‚ЗBVvХ[е ЕЌщŽПVжѕР_пƒlь…ПI6їЦпвЋlы‹П]vєУпй—ь@АGі$и7ˆ`ПLpP !8<”рˆFpLŽ'81‚рЄœIpZЮŒ"<;š№œœCxa,сEЙ4Ž№В\Oxuс5Й>‘№†мœDxk2сmrћЂ;фЮЉDweнEtЯ4Ђ{хОщDїЯ z@œIє<<‹ш‘йDЪcsˆ—'ц?9ј)yz>ё3ђьтч?//,"~Q^ZLќђтWфеЅФЏЩыЫˆпXNђІМЕ‚фmyg%ЩЛЋHо“їW“| Ў!љh-ЩЧђЩ:’OхГѕ$Ÿo љBОмHњ•|Н‰є›ЭЄпЪw[HП—Ж’ўИє'љy;щ/ђывпv’ў.ь"§SўкMця=dў‘ї’љo™џ/9бX endstream endobj 5 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[2] /FunctionType 0 /Range[0 1 0 0.6 0 0 0 0.06] /Length 20 >> stream X… С@ џOЃ˜ ў§ endstream endobj 6 0 obj << /SA true /Type/ExtGState >> endobj 7 0 obj << /Width 1216 /ColorSpace/DeviceGray /Height 1323 /Subtype/Image /Type/XObject /Length 1608768 /BitsPerComponent 8 >> stream џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџи~_UrpQ<=IEFJCXT>JP_T=AR>HAKAKBNJKQe[6\E666B6>==6@;;;5A<8;4A6B8>>A==5A5>;KA8CAEBQEEEIEIEPJPNBLFBBEQVURCPHNNLNQNZ_^RUFRQVKAQPPJJRNPLQRXWP^\^UUd_eaggN@CUN^jcimydz{|n€rtŽ”‚‚‚•—‘„‘”™”ˆ…ƒ‰АИЋЅЏЃЇ­Ј˜ЅЁЈЉЄ­ЛМИГВЏ‘АЈЊЊЇЈ­ЏЋЗПБИ­ДОДИЗЏЙОЅЁЖИЄАЋЏЊБЏЏЏАГБГИИЋВЋЁЏЉВЛЂЁ““Š™œ›ššš–ЂЃЁЏЃšŸЇЃЄЄЇЋББ­ГЋЇЈВЖЛДЏЌЏАДОГОДГЋДДПГЗОВО­РССЛПБСДЦЙДМЙРККЙПЗЗЙЉДДЋЃВЏТЗГГКДЋЏЗЗЌЌВЌЌЄЏЏЌГГЖОЖВГЉЊИЉЈГЙД­ДЖВИЖЂЅЇЈŸ­АЄЄŸЁЅЅ ЋЁЇЂЈ”ЋЂЈЈЋЃЃмџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџm`ihoKXZHTRWZUUVZXUWTUQQPPRCRVURQPQCUXJTRPRUUFTUUHTQPRV[^XCPPBRRRRWRQPPPPQPPNPPNNLNNNLPRPNPNPLPLNNPPNPNNNPNAPBBPATECEREBAPAPAPAQA>BBQCCAAREECCQ8>8@ET<;A>8CCC==I>>;>;=C=>;;3@@<@@==6>C==<<=EAI488@/;H==>@@;>)CJ8B>@AFE5PIJFC5A@c^PVPZ[HPXJ@AVQCT^gZ`R[-_IXXNP;LQQIJTP[`gjXfWL^=CXZPH=CEIHCHPcP@T^FZ\E\ZTx@PI@/C=3>Q83W8A5C<38C;;==CBBW;>>3<3>I>E3H>@FE=CHC26=8;=)0)*=A5I>H>;=;>>;>>;>46XPCCCEA;AEAEABCEE=EE=6CH>>@<=H@><@>>6>@EHFBNiPPPBAT>CLL6>B6=A3LAE@6=@NAJ854=56B===AA54<=A56B63==@<4@W>86>B^8@>6`ƒ‚tpH@CPak‡ьџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ’hggvIPNNNNPPPPNPNLLNLNLKKLNPPNNPNPPNNNLLLLKNLNLKNNLKNNNKLKKKKNNKPLKNKKKLKLKJKJJKKKKKLLKKJKXKKKJKJJKKLKJKJJIJKKJIKLJLKKJJJJJIJKIJJJJIJJKJIKIIJJJIIJKJJIKJJJJJJKKIIJJIHIIIJIIJIJJKJJJKIKLJIJJJILJJLLLJLKIKLKJJKJHJKJKIJJKLKJJJJIJIJJJIIKJIIIJJJJJKJKKKKJJKJJKJJJJ;›RKIKLNNKLLLLLKKKKNNNKNKPPPNNNLKPKJLNLJJKKKN^…PKLP=LKLLNKKKLLLKLNNJKLJNKLJJJNLNKKLKJKLNKKLKNPNLLJLPNNLNNLKLNLPNNPLPNNNPNNPQUUVWV>HTRTRRPPPPPPQPPPPQQPQBPQPPQCQQRQP@PPPPPPNPPNNPPN@PN>NNPQPNPNNNNLLPNNPLNPPNNNPPNNPPNNNLKNNPQPPP=EZIXUQPQBCLmВџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџДhgetUPPPNPPPPNPPPNKPNNNLNLNNPPLNNNNLPPPLLKLLNLLLNLLNLNLLNLKNPPNKLLLJLKLLJLKKLKJJLLKKKLKKKKLLKKKJJKJKJKIIKKJKKKJKLLKLJLKKJJKIKKKJJJIJJJJKKJHJJJJJIJKIIJKKJJJJJIIIIJHHIIFIIIIJJJJJKKJJILJJKJJJJKJJLJLLKKILKKIJKHHHJKIJIHJIIHIIIJHIIIJJJJIJHIIJIHIJJJIJJJIJHIHIKII4>@AAA@AAAA@@@>AB@>@>@@@@A>>>BA@@>@>>=>@>>>@>>>>@>>>@>>>A>A-@>>>>>>>@>>@@@>A@A@>>>A@@A>@>/>@>>@>>@@=>>=>A@@@AA@@@@@A@@>>@@>>==>>=@>>>@>AA>>A@>>>AA@>@>@A>>@@>@>>>>>AA>BBA@@ABAAAA@>@AAAABBEBBBAAACCAAAACCABACBFchyIFFBBBCCCFRFEEEBCCCECEEECEEEFECEEHFEE\FHEEFHIFEHZIFTFFFFFFHFJJIJ\IIHJHHIFE^HFHIHCFEREFFEFFHIHIFFHFFRHIIIIIREEFHHFFEEF\HQEZ[IFI^IIIHJUUIJITIRFHHITIHIIIJIJIJKJKkLJJIIJKJJJKKLLKKIJJJKKKKKKJUJJKJVKKLKKVWWKLLKWLLJKVJJKKJHIJJUKKVJVVJJKWKKKKVLKKJKJJJKLKLKJKJVKKKKLKWKLXKLLKLLLKKNKNPP>™џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџpjjqAB>>@>@>==@=@=====<=;<<=<>==<><==>><>><<<=<<>><<=<=<<<<<<<<<<=<><;<<><<===<==>===<<<;<>>>=>g;;===<=<><<=<==<<===>@<<><==<=<<<=;===<<<<<=<=;;;=;;=<<<<<<;<;<<<;;88;;<<<<<<<;;;<==<><<====<<>>>>==<<>@<==<=><<=<>-)%0/=<====A*>>>>><>>===>=<=>>=@>><=>>>>>B0B>@>AA@>>AA@A>@@@>>AABCBBCA@AA@@B>>P/@>A>=>@=>>=>>=>A@AAA@>@A>>@@@@@@=>BB@@>@>A@=>BBA@AA@AA@BBABBA>@>@>ABA@@AABBBEABCAFmFBBBBBCCCECECFCECCBCCEECCCCBACCECEFEECCCECEFEFHFFFCEECFCBCEECCFFCEFEEHXEFFEEHRFEFEEFFFIZFHHEHHTIFHHIHJ[JJIHHIFHJUK\LP8Дџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ…kjrP3>>>>>>==@=<==>>=;<<<=><====<<<>=;;=><<><=J<=<=<<=>>===<<;<<8<=<<;<<<<<<<<=<><<<=<;<<<=<<<<<;<<;<=J<<<<;<<;<<<<<<<<<;<<<;;<;;;;;;<<;<<<;<;8;8;8888;;8;8;88;;868888<;;888;;;8;&<8;88;8==<<8;=;;;8;<<;;8<<;<<;;<=<=<<;;=<<;;=;<<<<<;<;<;;;;=<<<;<><<;<;<=<><>=<;<=;=<=;<<>=@<<<><<;;8<;88;;8<;;;=<=<><8;;;<;;<<;;8<<<;;;;<8>;;<<<<<;<<;<<<<<<;;;;;;=;;<;;;;<<;<<><@A><=<>===>>>>>><==*===@<=><>===<<@<>>=>=>f>=@@>>>@>=>><><>=>>=>>>>@>>>>@=>>==>@>>>==>A>@@>=@=@>>>@A@A@ABABAA@A@C@AACE8зџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ›mmxU2@@>>>>>>=<>===><<=<<<><=<=>=====;<=<=>=;=<;<<<;<==<;<<=<<<8=<>=<<<<<;<;=<<<<<<<;<<<=<;<;<;<<88=<;<<<;<@=<<<<<>R>;=<>=8;;;;;;;<===@<<8==><<<=8<=<<<;<=8;=;;<<<<;<<<8<<;;<;<==<=<===<==>===>@ACщџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЎnnX3@>A=>===><;<<>>=<=><<<>=<<==<<<;J=<<;;<==><<===<<;;<<<<<<;;;;<<<><<<==<<<<<<<;<<<<;;;;;;8888<;;8888;<;<;8;;868;;8;;;8;;66568888856;868688=;;;;<;;;<;8<;8888;8<;;8;88;=8;;;;8;;;<;<<;;<8<=<;;;<;;;<8;;;8;<<;<<<==>;<>@>>@=@>;8;8;=;<<>=>=><;;<<>;J=<;<;<8I88;8;;8888;;;<<;<8866688;6888566888868886668<;;88;888;;;;8;8;;888;66;;;;<;;<;<;<;;;8<<<<<<8;<<;;<;;<<;<;<8;88;88;<8;;;8<<<<<<<<<8;;<;<<<8;;<;8<;<;;<8<;88;<<;<;;8;;;;;;;8;888;;<<<;;<<;<;;<;><;<=>4ћџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџУon{^5>@>@@@>===<><;<==><=<>=><=>====;=<<<>=<><=<<===<<=<<<===;<=<<;<<<<<<===<<<<<=;<;<;<<<=;=<<;;=;;=;;;;I;;;<;<=;8<;<;<<;;;8<;;<888;;;;;88688;<8;;<;8;;;;;88;;868888868868;8<88;8;8;<<=<8;;;;;8<888;8;;<;;8;;8;;8;;8;=<<8;;;;<;><<<;;<88;<;;=;;8;;<;;=RL=;J<==<<=<>B><;;=<=J;;>><<;;;==;>K;;<;;<88;8;688;86;8886;=6888;88888;8686688888868688;8;<8;;888;88;88;8;8868;888<68;;;;;;8<<<;;8;;<;;<<<;<;<;;;<;;8;88;8<<;;88<<;;8;<;<;;8<;<;;<<<8;;;<;<;<8;;8<88<;88;8;B>@=<>=<>>>><>>><=><<<><=<===<<<=@>@<===<=<<<<=<<<=<<<<;<;<><<<=<=<=<;=>====<<<=<=;;;=;;=>=><<;;;8;<<;<;<;<<<;=<<;;;;;8<;;;<<;;8;88;8;;;;<8;;88;<;86;;888;88;88;8888;<;;8;;<8;;8;88;8;<<8<8<;8<8;<888;888;888;;;;;<;;;<=>;<;<;;<;=<<;;;<<;==;=A>>-@;<<<<<=>BL<<>>;;P<;;<<><>;<<><<<=;<;<<<<;<688866868;8;88;8;;888888<;;<8666;8686866F5588;8;8888;;;;;;66;8;685668;6888;;;<<<;;;8;<;<<;<<<;;<<;;;;<8<;;6;;;<;;;;8<88<8;=;;;<<<<;<;8<<6<;;<;8<<<8;;;8;;;;8;;8;;;;8;;88;8;;8<8;;;8;=<;;;<8<;;=;<>>cџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџыromz><>=<<=<==>>===>>==>=<>==<=<<=@>L>><<<=K<==<<=<=<><=<<<;=<<=<<<=<=<==<=>====<<<=;;;<8;;<=J;<<=8<<;;<<;<<<=<<<<<;;=;;;;;<8;;;<888;;<8<<8<;<8<;<;<88;;8;;8888888688688<<;<;8;88<88;;;<;<8<;;;;;8;<8;;;;8<88868;8;;;<;<<>=T><=>=Ai@=<=<>=<<=8;<<;;=<=<<<;<<;<-><=<<<<<;8666868;8;;8868;86;8<86;86<8;88;<68868888688;6;<88;8;;;<<;6;;6;688886688888;8;;<;8;;88;<;;<;<<<;;<<8<<;<88;;;;<<<;;;868868;;;;<;<<<<;;<;;<<;<8;;<;;<<}<;<;8;;8<;<<6;;;<;;886;88<;;;<;;;88;<<<<<;<=>A&–џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџќtpn@3@>@A@@=@==>>>===<=>>>==@><==>=>===>>>A@>==<===<><>==<<<=<<=<====<<===>><<==>==><<<;<>=<=<;;<==<<<<;<<<<<=<<===<<<<<<<;<<<;;;;<;;;;8;8;8;;;;8;8;<<<;8=;;8;8<88688886;6;688888;;;;<8;8;;;;=88888;8<;8<;8;;<<<;8;8<;;8;;;<<<;;;><<<8;;<<<<<<>>A2iA>=<>AA>>A<>@A>@V>=><<;8<<;;8<<;=>J<=@Лџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ…qB4@AAPAA@>=><>><==<<>=>>>>@>=>=>><>>@>>@>>>>>>=>>=====<=<<<<<=<<><<=<<<=<>====<;<=<<;8=<===;<;;=<;=<<;<<<<<<=<<>;=<<<<;<<=8<<<8;<6;;;;;;88;<<<;;<;8<;;I;688;;;8;;888;688888888;868;8;;8;;;<;;888<8;<8=;6;;8<;;8;6;8;;<<<<<><8;=<;<;;<<===>>@AB5V3A>=@ABBBA@@BA=>@=;J;8<8;;8;<<>;<=<><;<-<*;<<;<<<;888;88;8;;;888;;<88;8;8886H6;;H8868686;86888;;8<;;<;88;;<;;;;<<8;8888;<8;6<<<;<<;;<<;;8<;;<;;<=;<;<===><>>=>=<=<<>>>>@>@@@=>@@>>>@A@=>>=@>==<<<=>><<>>=<<<===<=<<<<<<=====>=;<<;<<<;<<<;<<<=<<<<=;<==<<<=====;<<<=;<;;;;;;<;;<;;88;;;<<8;<;;I=8I<;8<;;;88<88886686;88;8;;868;;88888;88;6<8;<;<<;6<;8<;;<<8888;<<<=<;<;8<=<<;;;<===LABBE/x6EC@BCFCCBA@BC@<=>;<;;88;;8;<=<;<<=<<=;@>;;<<;<;8;888;686;;;<;86;888;;;;8688868688;8;88888<8;<8<;8<8;8;88888<;;;888<8;;;;;<;;;;;;;88<<<;;<;<<<=;=<;;<;<<<<;;;<888<;;;8;;<8;;<;<;<<<<;<<8;<<;<;8;;;<<;88<<;;;;<;<;<;;<;<<8;=;8;;;;;;;<;;;<8;<<;;<<;=@BюџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЌstw^0C@EEEEB@>@>@>@@>>@>=>>>==<=>=>AA@A@@AABCA@@=>>@@>@==<=<<;<==<<><>=<>=>=<<===;=<<<=<<=;<<<<>8=<=<==<=<<;<<=<<<=<=<=<<<==<<<;<<<=;;<;;;;;8;;<<<<<;;;<<<8;;;<;<;;<8888888;;;8886;;<8;;;8<<;;;88;;8<8<;<<;;;;=;<>A>AABC*Я6FBKsJFFFCCRHP>=<<<<8;;<<;;<=>>>>==<===@<;;<6<<;;8;888;;;;;<<86<;<;;;<6888886;8668;;8888;8;8;;;;<;8;888;<;8;;;8;8;8;88<;;;8<;;;;;<<;<=<;<<;;;;;=;<<;<<;;<;;8;;;;;;;<8;;<<=<<<<<=@BќџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџСvvzq2ECHFFFEA>>@@>>>=>>>>>>>>>=>@@>@>@BB540/33*33A>>>=<>===<===>><=<>=>>>=>><>==><=<=<<><=<<=<<<<<<><<<<===<<<<>=>>=<<<<><=<<<=<<<<<<=<<<<88;;<;<<<<;<<;;<;=;;8;<;8;8888;86;8;;<88;<<<<<;;;;;;<;;;<;8<;8<88;;<<<;8=;8;;;;<;;;888668;8;8;>@A@@@>>B)Д_;E6=Ѓ03EIFEHTFC@=;<;8;8;;<;=<;==K>>>><>><=;;<<;<><;;;;;8;;;<888;88;<;;<868;88;8888;;;;86;86;;;;<<<<;88;;<<<88;8;;;6;8;<8;;8;;<<<<;;c<;<<<;<;;<;;><<<<=<;<<;<<<;;;;<;;;<;;;<;;8;;=<<<<;<;;8;=<<;8<<;8<<@K<<>==<<;=;<;<<<<;=<;<;;<<;;;;;;<<;8<=<<<=>@2/џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџгvw€5IFHFEFCA>@@>@>@>A@@>>>>>@@>@@@@A58**)30863-#4>>=>>><<=<=>>Q==>=@>@<=><>=<>=>>==>>>=<>>===;=><<<<>==><<<=>><>=>==><>>><><=<;<;<<<><88;;<;<===<<;;;<;;<;=88;;;6;8;;8;88;8<;;<;8;<<<=;<88;8;8;;X;;;8;;;;;;;;;;<;8;8<<<<<;8668888=<;<<@B<ж5IHJ2а0ICHJHIEB@@>><;<<;<;==<=<<<=;><<=;;I;<;<<<8<=<;8;;;;;;;<8;;;<<<<<8<<;<;<<8;<;;=<=;;<<<<>>@>@>===<<<;;;;<<<;<8;<=;8<<<<<<<;=;<<<;==>-Zџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџцsv}x8JHHFECC@@@@>>>>>@@@>@=@>>@>>>>C<=<===<=>=>>==@>==>=>===><>>=>>>>=@<<<==<=>==<>=>=<<<<<<<>@=<=<==>==<<<=<<<<<<<<;<<;;<<<==<<;<;;<<;<;;;<;;<;;;8;;;<8;I;<88<<<;;;;;<;;8888<8<<8<8;;88<<<<<;8;<;;;;;<;;88886;<<88;=>@>>==@A3‡3HFKAџKKFHKKFAAA@><<<=<8<>=<>=>=<<<>==;<;;><B3#!&#-'3/<;;<;=;=<<8<;8;;<<<=;<<<;<;=<<==>‰џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџјsvƒ@LJFHFFEA@@@AA<>>@@>AA@A>A@AAAB;[p—гтщїњќ№чіїЙsI=<===>>><>>>@>@=>=><>>>>>=>><<>=>>>=<<=<<<==>>>==>=<<=>AW><===<<>==<=<<=<<===;=<;<;;<;<<;=<;8;;<;<=<<;<<;;;8;888;;;;;;<8;8<<<;<=;8;;<6;;8<<8;;;;8;8<<;;<8;;;<;8<;;;;;888;;<;8;<<@/IFFHH)m0JFJLJB@ABA>=^<=<<>@===<<<<>>=<=;=@><<;<<;<<;;<;;;68<;<;8;<;;8;;<8;;<<<;;;;;;;;8;;888;<;<<<=;<<8;<<<;;;;;;<;;<;;;8;<<<<;;;;;<<;<<<;<<=;<<<<<<;;<=<<;<><@2%)5ICWBR=-/&>;8;=;=;;8;<8;<<8<;<8;<;;=<<===AЙџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‚tHJIHHFCCBAAA@AA@>@@>@A@>@@@@>@FWЌКпђфйђяхстєёЅiiJ-<<<==>>=<>>>>>>>>=@>=>>@@=>@>=>=<=>>>>>===>===>>>>=>@<=>@=>===>==<<==><=<=<;<;<;<;;<;<<;;<<<@>><@CFHH8HIFJKFB=@PB>=@<<<<>><>>><;<=<><<<>><<<;<<;;<;;;<;<;<;8<<<;I<;;8<=;;8=<;<;;<;;;;;;<<;8<;8;<<<<<<<8;;;<;<;<<<=<<<<8=;<<;<<<>==;<8<;<;;<;<=;<<<;<<<<<<<<<8<8;;;<;<;<==<;<;;<=;;;<<<<8;<>3#!XwЂКйитСЭвЋ‡qB-><<<;;;;8;;<<;;<;;<;=;<<<<==>>Aйџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ•vwƒL0FHHFEE@CAAAA>>BP@@AABB@@AAACJW™›ДЮАЃидеспфу f`J><<<=<>>=@>=>>>>>>>=>>>@@>=>>>>==>=>>>>>>>>>=>>=>=>>>=>===<@A@=><<>=<<>===><=>@<==;<<<<<;<;<8;;;<;<8;;;<<<;;8;<<<;;;8;88;8;6;8;<<<<=;8;;<<<;;8;;<;88<;8;<;;<;;8;88;8<;;<<>;<;;<<><<86=<<@A>;8BQEA>@>K=<=><>A><<<=<;==>K<<==<;<<<<<;;;;8<;<;<=;;=;<8<==;<;<<<=;8;;<;;;;<;8;8<>;;<<8;<;<;=;<;<;;8;;8;<;<<;=;;<;;<=<;<<;;=<<;;;<=<<==<<<==<<<=<;<;<<=<=<;;<<<<<<<<<==<8;<<<<;J>;;;;;<<<<;<;===<>>A№џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЉvv…\-CBCEC@CVPBBN@AP@A@BAABCBAABFPAFfWxj/kgš ”aHI6/@L<>@@A@>@>>>=<=>>>@@=@>==<=>>==>>>>>==>@>>>@==><><=>>>=<<>=<=>><<=>=@>=@<==<=<<;;;<;<;;<<<;<<;;<;88;;;;<<<;88888;8;;;<<;<<<;<<;;<;;<;<8<;;;886;;8<<8P;<8;<8<<8<<<=86;>@@AJ64@>>><>==<=>A====<=<>><=>><=<<<;<<;8<<<;;<;<;;<<<;;8<><<;<;===<<<;<=;;I<<@-o­Й№хплълйЪЧзйнъДdN><8<<<<<<==<<<8<<=;;<;;<<<<>>A§џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЛxs‰m3AA@AA@A@@AAA@@@AAAACAqCABBEI[RVX8N^&g;#@2#2&*>>>>N>AA>A=@@RA>=>>@>>A@>=>=>@A=>>>===>>>@W@>>>>><=@V>>==@@>=<<<<==K<==>=<<<<;;<<<<<<<=<<<<<<8<8<;<;=;;88P<<<888;<8;;<<<8;;<;;;;8<88;;<;<<;<<;8;;;<;;8<;<8;8<<;<<<==;<<;<<>><865;WB<<33;PIHUC@ABC@B>AA`A@N@>>=>>>>=>>=K>=<@=>>><=<;=;<<<<<<;<;=<<<<<;;<<<<><<<=;<<=<===<<=<<<;<<<<;<=<;<<<=A@szŸфхпхъсьуомтйЮЁA->>;<8===;<<<;<;<;;<=<<<<<;==>4/џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЮwe‰v&C@@AAAA@A@AAA@A@@@A@@@A@@BFLPRRRTRR@>>><@;KJIIHIIQ=<==>@=@>A@B@@@@T=>>L@@@B`@@T@@@==>AA>AA>>>>@AA@>>=>>=>@A>A@=>-K>=>=<<@K<==K>=><=<<;<<<<<<;;;8<<;<<<<=<;<<;;8;;;;;)8;;88;;;8;<<;<<<;;;;;;;;;<<8>><<;<<@_A@AC>@>>A>AL>>=>==@@>=@=<><>===<<<;<=;<<<=<;<<<<=<<<=;<;=<<=;<=<<<<<<=<<<;<==<<<=<<<=;<=<<<<<=<;<<===>>>===<<==<=>===;<<=<<;;<@@En^N_ВРЩжазЪЫДU534AN;;;;<;<<=<=<<;<;<;<<<>==>>@4Tџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџтzx„ƒ5BCBAB@A@A@>ABAAABBA@A@ABABH^NPPPPNNNIKKJIIJIIHUKJC>==@>@>>@>>@@@=>A>>@>=@@A>@@@@=>=>>BA>B>AA@>AA@TB>>>>L@>==@A>e>=>@=>=R>>==>>><><<=<<<=<<;;<<;<<<<;<<<>;<8<<=;<<<>Uz<;;8;<<;<;<=<<<<;8;;<;<;;;<8;<88;<<<<<<=<;@=;<><==>L>;566;P;55!;QJNgEAA>>@@@@@A@BBP>>>@A>@@@>>@>>><=A>===;=>=K;=<<=;<8;;<;;<<;;=;=<<<<<=<;<<<<<<<<<<<<;<<=<<;==<<=<<=<<===<=;<<<<=<<<;<;<<<<<<=<<<<<<=<<<<=<<<<=<==<<<=;<<<<<=<<<=>=><<<>>======<<=<=<><=<8<;=><=@AA%†џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџђ{zˆ‹/5BBAA>AAA>@A@A@A@B@AAAAABBEVKKLKLLJKJKLIIHFFHHIFHCAA>@>@A@>>@>AA>>=>>@>>@>A@@@@>>@@=@@@B@B@@@@A@>>@>>=<=>=>>===@>=AA><>>@=>==>@=>@=>K>==<<=<><<;<<<<<=<=<===>;8<=>)<<;<<;=<;;;;<=<<;;;;<<;=<<<<;<;<;><<<;<;<<>=<===>>=<<=<=<>><84455686E4;R^PNF@=>>@>>AA>>=@A@AA=>>@@=@>R@=<>>@<<=><<><<;<;<<<;<=;;<=;;<<<<=<<<;<<;=<<<;;<<<<<<=<<<<<>=<<<;<=>=<<<<=;<<<<<;==<=<<<<=<>=>><=<><=<=<==;<=<=<=<<=<<====J<=<<=@<;<===><<=<><==>BC5ZQTUXzH=ABЖџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџƒ|Š–A6AA@AA@A@@AB@A@BA@A@BAABCCCEIIKKKLJKP>ZJJHEEFFHECCCA=A@@@@=@A@@>>@>>>@@>>@@@@@A>>=>>>>@>>=>@@@>>>=@@>=>>>@<>=>>>=>>><==>>=<==<=>>====<=<<<<<<<;<<<<<=<;<<=;<<<<;;<;;;;8<<<<=8<<<;<<<>=<=;@;<<8<<<<><8;;<<=<<=;;<<>=>><=<<>><<====<;5424434584@@@>>L=<>@>>=@>@@@==@@@B@A>A=><>>>U>;><><;<<<<<=<<==;<=<;<<=<<<<<<;=<<==<<<<<>==<<<<<<===>==<=<<><==<<<>@<<;;<<<<=><;<=<==<<>><<=>=>=<=<==>=>==<=<=<<==>><=<<=<=<=>=<>=====>><<=<<;=>CFEJNQPRTTRRWRQLKLKIJIIFA<;=<<<;<<<=;<;<<<<<<;<=>>@Bкџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ—‹‹CHBAAA@@BBAAA@A@AAAA@ABBCBBBCEFIJJKKPjURLLKHFCECCCBCA@@AAA>@>>>W>>>>>>=@@@@A@@@@>@>@>==@>@>@@>>>>A>>>>>>=>>>>L@==>>>=><=<>>>><=>=<>=><==<=<><<<=;<;<=;<<<<=;<;;<=<<<8;<<;<<8<<;<<<<<<<<<==m<==<<=;;=;;<<<>==<<<<<>=<=<<=<<=>>>>=@><54202202366=[PPNCAA>@@>A>=N@8==>>>>@@AAA>=A@AA>@@>>>===><<<==<;<;;<<<>;==<==<=>=<==;><<<;<8<=<=<<===><<;==<=><@>==>>><<;<<<<@A>><;<<<=<=<<==<<<<==<=><>==>><=<>><><=<;==<<><>=>===>>=<====<<=<=<=<><<=<<<>BFHHILNNPPQPQNKKJJKHFFEA><=<=<;;<==<=<<;<<<<<===>A>BяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЉ}‘P0BBBAABBA@AABAAB@A@AABCA@C@BCCEHHHJP˜zRNZjKIIFEBCC@AAA@@@A@A@>@>@@>@>@@AA>A@@@@>>>@A@@@@@>@@>>@>>@@>@>@>>@>>@@@@@=>@>==>>=====>======<==<;<====>======<<<<<;<<<=<;<8P==<<<<=<<<<<=>==;<=<<<<<<;;<<<<;8;>====;===><<=>=@K=>>>>>AAJ40000000/033A@>>=A@>B@@B@@@>>=>=>===<<<=P<<<<<<<====<======<=<=>==<==<>>===<===><<==<==>>>@=<=><=><<==>AW>==<>=<<<<=>=>>=<=><=>>>======>>@=<>=>><<<<====><<==><=<<<=<=<>>>>=<===<=<>=AEHEHHHJKLPNNJIHIHIHECA=;<;<<;;<==<<<>=<=<><=<<=A>ACўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЛŒa/CAABBACBBAABAABB@A@AAAB@AABACBCFFHJQRKKKLIHFEFCCA@A@@A@@A@>@@A@>@@>@A@@@aB@A@@@@>@@A@A@@@A>>>@@>>A@@>@L@>>>>A@@>=>>>=>>@@=><>>@=>==<<<=<=<<<>=<><<<<>====<;<<<><<<<====;<=><=<<==<<>>@<==<<<;<;<><><;;;=>=<<=<>@>===>>>=>@=;4202/000/-/0*_QRPFAA@ABBT>6АЏ);==>N>A>>ABXAABCB@A@<>=>>><>>=<<=;<=>===<<<@===@=<<;@=;<=<<=<>=<<>=<@><>><<=>==>>>====><<<<>>>>======<==>><>=<=>><=>=<=<>>==>@>@>>=>=<<>=>>===<>===<><<<=<=>=<>=>>=><=><<>AAEFEFEFJKP\NNJHIHFBC@>><<;<<=<;<<=<=<<<=<<<====L@AE4џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЯ‚€Šq)ECA@AAABBBBBABBCABABAABCBAAAABABFCEHIHHFEFEECBBBB@AAA@@>A@A@@@@@>@@@AAAAAAAB@@A>@@>@@>@A@@>@>>>>AA>@@A>>>>>AA@@>>A@>>>>>@A>==>>>@=>===<=<=<=>==<<==><=<<<><<<=<<<=<====<<====<>>>=>>L<==<=<<=;=;<<===<<==<=<==@>@=>===<<<=A>==54//0/0/-0-//0*fRR[FA@>ABA@>H‹);<<@@AAAAA@BA@B@=>==>>>K<>>==<=><<=>=====QA=>>===<==>>==>>==>>=<>=<<=<<=>=><=<=>>><==<==>==>>==><===<====@>>=<>=>>==<==>K=<=>==>>>>=<====><=<==>>===<==>==>>=>>><=<=<<<=>>@AACCCCFHKcXKHFHEBA@=><==<<=<<<<<===<===>;><<==L>B'[џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџкŽ‚…„!CCBABCBAACCBBCBCCBBBBBBBBAAAABABCBBCBFECCCBCCBABAC@AA@A@AABAA>>@@AAABB@B@BBAA@A@>@=@@@AAA@@AA@AA@@AA@A@@@A>A@@@A@>>@@>@=>@>>>=@>><>=<<<=<====<><<<==<==<==<<<<=====<=<=>==>><<=>=>>=>><>>===<<<=<<<;<<<<<<<=><>=@><<<==<===@=;23/0/0---/0//2-oRT[FEAAABAAA4R0<<;;<>>>AA@AAA>AB@@^B>=><>><@><>=>><=<<<=>>>==<>@=>==<===><>@>=>>>=<>===<=<==<=>=<>>>>=>>=<><><=>>=<=>><>;><>>>=<<===>><===>=>>=<==>>=<<<<==<>=<=>>=@=>==>>>K==>A==>=>>====>=>=>>@A@ABBCEHHEBB@B>>==<<<<<<<<<<<=>=<===>=><<==@@>B-}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџю‚‚Œ8CBCABABCACBBBCAAEC@ABAABABBAAABACBBBCECCBBBCBAAA@AAAA@@AA@A@A@@@@@AAAA@AAAA@A>>@@@>AAA@AB@AA@A@A@>B@@@@>@AAA>@@@>@>@>>@=>>@===>>>=>====<<<<>=><>==<=<=====<;<<==>=<<=<==<==><=>===@>=><>=<=><<<<==>=<=<<<;<<@>=<=>=<=>=542--/00/0//-//2-aTUPFBCA@@BAABA@=;;;=>>@>>@A@>>@A@@B@>>>>@@>=>==>=>==>>===><=>>>====>><=@==>=>>>>=<><=<=>>;===>==>=>@>>><>=>><>>>=<>===<<>>><>=>=>>==>>==>=>=>=>>>>>>>>>==<<><===<==>>@>>>@><@=>>>>>>><<8>=<<>===@@>@AAABCBB@@>><=><=<==<<=<<<>@>=>>=><<>><>>A@ABГџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ„v‰)6CABACBCABBBBABBCACBCAAABBAABA@AA@AAACBBAAACBCAAB@BCB@BBB@@@B@AAABA@A@AABAAAAA@@AAA@@@@ABA@@A@A>A>AA@AA@@@@@@@@AAA>@@@@>@>@>>@>>>@@>><===<=>=>=>===>>=<>=<=<=>=>>=<<<<<><>>>>==>=><>=>=>=>@=>><>==<<>>=<<<<>>@>=<=>><>=><<<;42/0/0/000/0/0-0*^UV^IE>AA@BAABPU>><=<<<><>A@A>>B@A@AB>A@>>>>>>==>@A@<>>@=>K>=@@=<><<>>=>>>@==<><@><==>>==>>=<>>=@>>>@>>>>>==<<>>@>>>=>=<>>>@==>@=>=L=>>=>>=>>>@@=@==>>>===>=<<>==<>>>>>@@@@>>@>>>>>>>>==>>=<<====>>=@>>>@@@>>>><===>=<=<;<<;<<==>=>@>>=>@@===@AACеџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ—‚’™E5CBBBCBCCCCBBCBBABCCABCABABACBA@ABCAAACBABBCBBABAAAAACCBA@BBAAACBPAABCAAACBAB@@AABAA@BAABA@B@@@ABA>>A@@@A@@A@A>=@>AAAA@>>>>@@>>=>@>>=<<====Q>@=>>=@=>>==>[>=<<=>>=<<<=>>>>>=><><>>==K=>>@>=><<>>==<>=><<==><><>=<<<=>=>=<;660/-/-///000////2*^`VdICABAABBACEA@===<;<<=>>@>>@@B@>A@@>>>@>>>=>>=@>A@>>>=>>>>>@@=>==>==>>>>>>==>>>=>>>=<>>>>>>@>@>>>==>>>@><=>K=>=>=>>==>>>>>==@A@=@@=>@>>@=@>>=>@@=>>>=<>>><==>==>>>=>@yA@>>>@>>@>>===<>>===>><>><=>>>@>>>>><>>><<=>==;=<<<=>==V>>@@@=>><=>@>@@BяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЊƒ‚œP2CAAABBCCBECCBCBBBACBBCEBBAACBBAAAAABAAAABBBCBABBACA@BBA>@AA@CBBAABBCBABEBBBAABABAAA@A@AAAB@Ag@@@A@AA@AAA@@A@@A@@@>A>>@>@@>>>>@>>>@>@=>><<==>><>>@@>>><>=@<<==>><====>>@>===<>>>==@=>=>>=>=<===<===<===<>@><<<>><=>>=<>@=853////*/0-0-000--3*X`W_NECBCCCBCCFX=<<<;;;8;<@@@AA@AA@@@B@@@>>>>>@>>@A@>=<>>=><==@>>>=>=>>===>>>A>>>>>>==>@>=>=>>A>>>>>>>>>=>K><>>>@>>=<>>><==>>=>@@>=>>=>===>==>>>@A>@>>><=@@=>;>>>=>>>@@@B@A>@A@>@>>>><<=>=<>>=@>=>><>==@>@>=@==>>=>=><==<=><<<=>>>=>=>>=>>@@>>@AEџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџГ„‚˜e0BACABCABEBCCBACBACCABCCBABCBBCBA@BBABCC@BAABCCAABCAABBBAAAABBA@ABBACCABECBBBA@@ABB@ABAAA@BAA@BAAAA@BAAAABAA@A@@>A@A>A>@@@@@>@>>=>@@>==>=>@<=>@>L=>><@>>>>====<><=><=<>>>=>>=>A>><>>=>==>>===<>=<<=>;<<=>>>=><>=>=>>@=@=;420---//-/0>0//0002<;;;<;8;<=>@AB@A@@>AB@>>A@>>>A>@>A@@>>=>=>>>>A>=>@L><>>>>>@>@@>>A>@>>>>>>>>>>>>@>>>>>@>>==>>>>>=>>>@>@==<>>>@A>@>>>>>>>>>>=>=>>>>@@A@@==@=>>==>==>@>>>>>@@@@@A@>=@==>=====@>>>>>@>>>>>>><>>=>==>>>>=<=<<>>=;<==>>>>@=<>>=>@@@AA5<џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЫ„ƒ•z*CCCCBBBECCCCCCEEECBBCCBBCBAABBABA@ACACBABBBCBBACAAABAAAACBBBBBABBBBBAABBBABB@ABBABBBAAAA@A@ABA@AB@AAABBBBAABA@A@@AAAT>@@>A@>>@==>>@@><>>>>=>>A@@>A>>>==@>@>>><=>=<===>>>>>>>>>>>@>@>>>=>===>=<<>==><<=>>=><=<===<>=>===E20/**-*////20///023&^fVUPCCBBABAAEHP=>==<<88;<<>@AN@A@A@@@>@@@>>>@>>A>@@>@@@>>>>>>N>>>>>K<>>>>>@>@>@>>@@>>>>>>>==\>>@=>A@>>=>=><>>>@==>>@>>=>>>@@@A@@@>>>=>>A><@>==@>>@>BA@>=>=>><@@>=>@@>>@>A>@@@>@@@>>>@=<===>=>@f>>>>A>>>><=====<<<=>=;=;<=>===>>>K==>>=>>>=@AAAAH^џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџз„…˜nCFCCCBBBBCACEBCCFFEECFBABCABBEBB>ABBACABBBCCBBCBBBPBCCBABA@AAABCCCABBBEBABBAABA@ABAA@CABBAABBB@ABAAAA@BAAAAUBAB@AB@AB>@>>>@>@@@@=W@>>==@>=A>=@>A@>A=>@>>=>>=<<==>>@=>=>>>>>>>==>=>>>@==>=>>>>>==>=@<><>===>=><==><8640*-))*)/-0/0000/-/3&^VX`LEBA@AA@BFIF@@>@>>8;<;<=>AA>^PVU>A@A@A@>@AA@@=@>@A@A=>>=>@A>>>>=>=@>>>>AB@A>>>@@>A>>>>@>>>>>=>>A@>@>@@=>@@=>=@>>L=>>>@=>@A@@A@>@@>@@>>>@>@=>@A@A@@@>>@>===>>@>@@@>@A@A>AA@@>AA><@@>@>=><>>>A>>N>@>=>>>>>>=<====<>>====>=@==>==>=>@>>>>@A@ACE8}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџщ‡…—‘/FECCCCCCBCCCFECCCCCCECBCCBBBBBBCAABBABBBBCCCCABBCCBBACBBCBABAABCBCCBBBBBBABABCCACABABBCBBBAB@BBA@A@B@AB@BBABA@AAA@@@N@@A>>>@A>@=>@@>=>>@@>@@@@>@A@@@@>>>>@=<>=><=>==>=<<>@<>==>>>=<<==>>A=@<>>>==@@>>=>>>>==>@@>=>=<6542/**)')-0/2/000-/--0&`VWfKEA@BBA@BFRCEA@3cB<AA@@@@@>@>>A>@A>>>>>>@>AA>>>>>>@>>>>>=>A=@@@@A@>>>>>>@>>>A>@@@>A@>@@>>>>@>@@>>>>@>@>=>>@@@@@>>@A@@@>>>>>>@=A@@>A>@>@@=>@@@@>@@@@>>@@AAB@AA>A@@A@@@@>=>=<>>@>@N>@@@=>>=====<>>@@>@@==>>>>>>>>>@>>>=@>>AAAAAC2 џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџњˆ‡„™-4FCCBECCBBEFEECCECECCCACCBBBBCCBBACCCBAAACBCCBBCCBABBBCBBBCABABBCCBBAABCBBCBCBBBABBABBBBA@@AAABA@ABAA@BBBABBAAAAABAAB@@AA@A>>@@A>>>A@@>AA@AA>@AA@>@@>@==>>>=<<>=>><=<>=<=>=>>>=<><>>>>>@>>@>>>>==>=>>>=>>><>=@@@<<=;400/*-***'-=2000/0/*--0)`VWiJC@ABBABBBF/cC>2 E=;<=<>=>@>@@A@XBAAA@@A>@A@@@@=>@@=>@>=@@>>>@=@>>>>>>@>>@@@@>N>>@>==@A=>@@>>B@@@AL=@>@>>@>@>A>AA@>@=>>@>A@BA>@A@=>>@>@@>>@@@AAA@@@@A@>@>>>@A@@>AA@@@@A>@AA@A@@@@>@=@@>>>>=>>>@@@@@@A@==<===<<=>@>>=>>@>@>>@@@>>@>=>>A@@@>AC!вџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ–ˆЄ65EECEEEEECEEFFFECCECFCCCABBCCCCCBAPCCBCCCBBBEBBFEBBBBBABBCBBB@ABCCBBABBECBCBACBBBACBBBCABBAAAA@BA@AAAAAAAAABBBAA@@AAA>@A@>A@@@>@L>>A@@>@@@@A@@@A>>@A>>@>=>@=><<>>===>==>>=>>><>>=U=@>A=>@><@>>>>>>>R@=>=>>=>>>>===;400--*)**)))/-000///-*-#&aUWiKBAACAABBCEACBA!t3=;<<>K<>L@@AA>AABAA@@>>B@A@>>>>>@A>@>>>A>@@@>A@>@@>@>>@@>>@>@AA@>>@>>A>>@>@@A>A>@>@A>>=>>@AA@>@>>>>>>@@A@@@AAA>=@@>@>@@>>>@@AA@@@@A@A@>A>@@@A@@A>AA@@A>@@A@@@>>@>@@>>>>=>@@@>>>>>@>>>=<>==>;=@=@>=>@@@@@>@>>@@@>@@@AB@AACE№џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџІˆˆЂ@>@@B@NA@@A@@@@@A@>>L>A@>@@@>@>>==>><<>===>=><==>=>>=>>>@A>==>><===@>>>>=>===>==>=;530---****))**-=//-/-/-/0L=>>@>;;;==K<=<>>>@@A@AAABB>@AA@A>@>>@@@@>A>>@AA@A@A@>>T>A@A@@>>@>>A>@A@@@A>>@@>@>>AA@@A@>>>@@>A@@>AN>=@>@AANAAABAAA>>@A@@@@@>>@@@A@A@@@@>A@@@>@>@>A@@>>AAA@@AA@AAA@AA>A@A>@>@>=@>>AL@>>>@=>===>>>@>A>>>>@=A@>>>>>@>>AABBEџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЏ‡’ЄT'EECCHECEEFEFCECCBCBEECEBCCCCCCCCECCCCCCBEBCBBCCBCCCCBCABBAABBCBCABBCBBBCBCCCBBBBBBBABCCBCBABACBBABABBBACCABCBBBBBAA@@AA@U@@AA@^AABB@AAA@@@AAA@@@@>>>>@@>@>>@@>>@>@>>>>>>=>><>>>=@@<>=>>>=>==>>=>=A>>@>>=@>=><><;64/****)****)/**--0//-//02'`X\jKEBACBA@UBA<=<>=><<;;J<<;=;=>@>@@AAABBBAAA@>@>>>@>@AB@>@A@@NA@@A>>@A>A@>>A>>>@@@N@A@@@@A@>@@@@@@>@=>>>@>@>A@>@@B@@>@>@@>A@AA@A@>@>@@>>@@@>>@@@AA@>>A@@AA@AA@@A@A@>@@A@>A@B>@A-@@@A@@>>>>=@@@AA>@>>>@>==<>=>=<>@>=>>@@@=>@>>@>A>@>@@>@>AA@ABHAџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџТ‰ˆЄj&ECEFEECCCECEFCCCCEEECCCCECEECBEECEEEBCCECCCECECBCEBEBCCCBBACCBCBBBCBCEBBCBBBBCBAAABAECEBCEBABCBBPCEBBBCCBBABCBBAAAAA@AAAAABAAABCBBABB@>@AA>@A@@>A@@>>>A@@@>@=>>@>>>>A@>>>>>>=>>>@>@=><>>>>>@>>=>>@@>@@A>><>>=>;630/--***--)**/***-/--//0/3)ie\cKEE@B@>>CPA<<<>A><<=<<<<;<8><>@@@>AACBA@@B>@>@>=>>ABAB@@BA@@A@A@@@@A>@@AAA@>@@@AA>>>>A@@A>@A@>ANA>A@@>>>>A>>@@AA@>@A>>>@B@>ABA@AA>@>@@A@>{>@>>>>@A>A@@AAABA@>>AAB@>@ACA@B@>>@>@=@A>A>@>=@A@>A>>@@V>>>=>=>>>>>>@>@>>@>>@>>=>@>>>A@>A>@>@A>AE;^џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџе‹ˆš}*EFEEFFCFEECEFECBCCECCCBCCCECCCCCECEEFCBCCCCEBBBECCBEEBBCECCCCBEBCBCECCBBBBBBBBBBCBBBBCECBBCBBCBEECEBCACCCB@BBEBBBBBB@AAAA@AAAABBAAA@A@BAA@>A@@@>A>=@>>@@@@@>@>=>@>>>=@>@@>@=>>@>>>>>@@@>@>>@A@>>>>>>@>@==>>==<840/-**-**-)*)))-)/----/-022)e\^kKBBA>>@>A@>>=<@LA=;>=<;=<=;>=<=@>>ABPAAAAB@>A@>>@A@AA@A@BA>@A@@@@A@A@@@A>@A@@A@@AA@@@A@>A>@@@A>@@@>@AA@A@@>>A@A@AAA@@AABAAPCAA@A@>@@@@>=@@@@@A@AA@@@A>A>AA@@B@A@A>AAAABAA@A@@@@@@@>>A>>>>AA@@@>@>@@><>>=>>>>=>>>>><>>>@>=>>>>>>@@@@AA@BAAEE2†џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџф{ˆ™‹'HFFEFFECCCEEEFFCECECCEEECEBEEFECECCRECCCCFCCCCCCECCEEBCFEFBEBBFCCBCBECCBABBBCBCAAECBCCCCCBCCBBBCEBCBBBBCCBCBBCsACBB@BAA@A@BBABAAABAAAA@ABAAB@@A>@>@@>>@@@@@>>>>=@>@@=>>@@@A>>>>>>L>>@L>@>>A>>>@=>>@>@@@>>A@<<840//**-***-*)**)))-*/-/*2303)e\^mLB@@>>@>AA@=>==@>=<==<;<<=<<<8;>>>>AA@AAAB@A@AA@@@>A@>>@B@@@@@@@A@AAA@>A@@AA@AA@A>@@@@@>>@BAA@>@AA>@@A@>A@@>@>>@BA@@AABBAA@AAAA@>>@@@>@@@>@A@A@AAAA@@ABA>@AB@@@A@AAA@BB@AA@>A@@A@>>@@AAA>@@@@>>@@@N@>>>==>==>>>>>=>=>=@>>==>>>ABA@AAAABAACC)Јџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџј‹‰—“'IHEFEEEECCECEFEEEEEFCEFECCEECEECEEECCCEBEEEFCCEEEECFCCCCCFCFBEECCACBCEBBBBCBCBBCCCABCBBBCCCECCBCABCAACBEBECBAREBBEABA@ABAAAB@BBBBBABB>AA@AA@>AA>@@>`>T@AAA>@@@@@@@B@@@AA@@@>=>@>>>@@@>=>=A@@A@>>@A>>ABAAA@>=853/)-*)--*//))*)))****//*0202)j\_[N3>@@=CCABA@<<==>=<<<=<;;=<;;;8>@>@@A@AA@A@@BAB@>A@@@@@AAA@A>>AAAA@@@@>A>@A>AAA@A@@@>A@>A>AAAAABAA@@@B@>AAB@A>A@A@A>@ABAAA>>@A@@A@>@AA@AAAAA@AA@AA@@CAAAAB@A@A@AA@AAAAAA@A@@A>>A@@AA@>>@@@>@@A@@AATA@><@>=<><>@><>=>>>>>=>>@>@ABA@@@A@AABEF#аџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџˆŠˆ™26FEFECEFCCECBEEEEECEEcFECCCCCCEECCECFECCEHHECBFECFBCCBBCEFFFECCCCCCCEEBBBBCACEBCBCCCCBBECBCCCCCCEECCBCECEECBCEABBCBEBBBAB@CAABBBBABAA@>A@ABA@A@AAA@BAB@@@A@=>@@>>@@@A>@@A>>>>>@>@>L>A>@@>>>@A>>@>@>@@ABAB>;8430-)*-)*-**))*-)*))**-----/03#f^iiPB@A@>VCBCB=<=<><=;<=<;<AAA@BABA@AA@A@A@AAA@@@A@@AAA@@@@>@>BABAAVB@@@>@@AA@@BAABBBAAABAAA@@A@@A@@AAB@ABBBBAB@@AAA@@@AAAA>@@A@@AB@BBABABBAA@@C@>A@AABB@B@@@@AA>@A@>@AA>A@@A@@>ABA@@@>>>=<=>=>@>><@=>>>>>>>@=@@AA@@@@A@ABBCBEѓџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЇ•‰ЉH3FEFFCCEECEEEEEFEEFEFEFEEFCFEECEEFEEEECECFIECEEEEEECCCCFEEFFCEECBCCCCEECCCCCCCCCCBCEBBCEECCBCBBCEBEBCEBECCEBBBCBACCCCBAB@BCBABABBABB@@@AABBBA@ABBAA@A@@@>AA>@@>@>>>@@@@@>>>>@@>>>>>>>>>@A@@AB@>=A=>@@>AB>=<64F**-***-)***-)-)))**)****)-03#gq^dNBBAA>ZCAA@=<>=>>==<<>;<;;<<<;;<;<>>>=A@AABBBAAAAA@@@A@A@AA@AA@A>ABA@A@@@AAAABAA[CB@BA>@A@>@ABABC@BBAAAAAA@AA@AA@@ABAABBABAA>@A@AA@AAAA@@A@NA@AAABCBBBBCBABBBAAA>ABBBAABABAAA@@>>@A@@@>>>@>@@>@A>@@A>>>>>=>>@@>>=>>>@>>=>A>@BAANA@ABBBAACCFџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЌˆЂU5HEFFEFEFFEECCEEFHBEEEFEEFCFEEEECCEEFFBEEEHEECCFEFCCBCECCECFEEEECCCFECEEEFCFECEEECBEFBCCCCBBCB[CCECBBECCCCBCACBBBBBCECABACBBBCABBABBABABAABBAA@BAB@@@>>@AAA@>@@@>@@A@>>@@@@@>A=>@>>>A>@>@@@@A@>=A@A@ABBA>=630-*)))*-*'*)))**)*))*-----//242mn^iLCAAAABAX@>=====>=<<<==<<;<<;<=<;;>=>>A@@AAAB@AAAA@@B@AAAA@@AB@@@>A@A@A@@A@AABAFFCA@@@AA@>AA@ABBCBABBCAA@BAAA>AAAABA@ABBABBA@AAAABA@AAA@@@AA@@AAAACABAABAABCAA@B@@AAAABAAABB@@A>@@A@AB@@@>@B@>@AA>@>>@@>@@==>>=@@>>=@>>>>A>@BAAA@AABABABCE;OџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџПŠЂi0JFHHFHEEFEEECFFEFECEFFCCECFCFFFCECERCECEEFFCFCCEEFECCEECCFECBEFECCCCCEECECCCEEFBECCCCBBCBBBBCECCCCBCCCCCECEEBBBAEBABBBBBCBBBBABBBAACBBAABBEAA@@AAAA@BAB@@@@AA@AAA>@A@@>>@@>>=>>>>>>@>@>>>@A@AA@A@AABBA@>;52--**))'**))'***)-*)A)-***--/24gh^ePCAAB@@A>>>>@@>==<=;;<==>=<<;<=>=>@@A@BACAAB@B@B@@@AA>>BBA@@@@A@A@@A@@@B@BAACBAAAA@AA>@BABABPEABABAC>ABA@AA@ABA@BAAAABBCB>AABAB>A@@@@>>AAA>ABABAACBBABAABAAABAAAAABBAAABAA@@AAA@>BAA@@AAB@@AAA>@>@>>@A@><@>>@>>>@>>>@A@@AA@AAAABAABAABF8hџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџдŽЈq4JHJFEFFHFEEECEHHEFFEEFEEEEECFHEFEFCEFFFFFEECCECCFEEECECCCECEEEFEEBCCEEEEEBCEFCECFXCEEEBBECCCEECCEEEECCCCCCBCCCCECBCCBCABCBABBABCBBABCBBPCCCB@AAAABBAAAAAA@>A@ABBAAAA@@@=@@>>@@@>@@@>@@@>@A@@@@@A@@AAAB@<64/*--/-*-)*****)*-*-*-))****/-03*go`jPC@BBA>@><@@A@@>===<>=J;<<>@=<><8;<;>A@@@AAAABA>AAA@A@@A@A@AAA@@AA@@@@>@@@ABBABBBCBAAAB@BBABAABACBBA>BAACBACBA@@AB@>AACABCBABBBABAB@AA@>@@AABBABAAAABBCBBBBBB@AA@BABBBABAAB@AAA>@@A@@A@AA@AAA@@B@@@@<@>@A>@A@@A>@>>>@@A@A@@A>>@ABB@AA@A@BF>ŠџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџтŽ™/KIJFEFHFEEFFFEFHFFFEFFFEFCEFFFFFFEFFEHHEFEECEHFCFEEEEEBCECEFEEFECEECCEEEFCFCEEECFEFBBCCCCFBCEECCEEECCECCCCCCCECCCBBBCBBAEBBBBBBBBACBBCBABAACBBBBAABB@@AAAAA@A@UBAAAA@A@@>A@@@>@@>@AAA@>>@>@@>@@BA@@@AA>842/-*-*)*))*)))*-*/--/*-B*****//2)do`ePCAABANA=>>@L>>=<>=@@<=;<<<;<<<=<<<<<==>@AAB@A@@@AABA@AA@A@AA@B@@A@AT@@@>BABABCBAABBBAAAABBBBAABCAACCAAAABAPAAAACAA>AAABBBBBBBBAA@B@BA@@@@ABACAABB@BBBBBAABCBACBACAABABBABAA@AAAA@@AA>>AA@@BAAAB@A>@>@@B>L>B@>>>>>>=>@>>>@AAA>AB@@BAAAABBF5Вџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџђ“Œ™Ѕ%JHHEFFFFFEFEFFFIECFEEFHFHEEFFFFCCEFFCEFFEFHFEHEFECCEFECECFEEFEEFECEEFHFEFFCEFCEEEEECCCCEECEFCEEFCCCCCCCEBBBECECCCBCBCAAAABABBBAACBCCBBBBBBCBCBA@CBBABAAABABB@@A@AA>A@>>@@@AAAA@@>AA>AA@A@>@>BB@B@BA>>K;42--*'**)))**)-**<-0-***-/*--*-)/0)fn_nNFAAA@A@>>@>>===<<>=><<=<<=<<><<>>@@BAAA@AAAAAAAAA@AA>ABA@BABA@A@@BBAABBBBBBCBABAACPBCABCBCBBBBBCBBBB@AAAAAAAABBACBBCAAACCAAAAA>A@@@@A@BBAAABAABBAAABABCAC@ABABCBBBABAAAAA@BBBAAAA@@ABAAABB@A@>AA>@@B>L>A>>>>>>@>@@A>@@@ABABBBABCCF/Ыџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ—–Ј%=UHFEEFFFEFCEFFFFFFFEEHHEFEHFFCFFEFFFFFFCCEFEFEFEECCEFECFFFCCEEEFEECFEFFEEEEECEEECFEECFEBCCEEECCCCCBCCCCCCEBCCFFBABBAB@BBCACACBABACBCCBABAABABAUABBUBBBABBBBABBA@BAB@@AA@BAA@@ABAAB@AA@>A>A@B>AT@@@>=;52/--)-)*-*)*)*)*----)*--0=-/-*--/2)fg^sNEBAB@@AA@A>>=>>=>>@@=><=<>^<@K<=<<<;<<=>@@ABAB@AAAACABAA>@@@CBAABABAA@AA@BACBABBEBABBBABCACCBBBBABBBBBBCBABABAA@@AACCBAEBACAAAPBBBBABAA@A@@AA@A@AAAAABPCBA@CBCBBC@AACBBBAAABABA@AAABA@N@@A@@ABA@@A@AA>@@A>@@>>@@>@>@@@>@AAA@A>BAABABABBEFєџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЅ‘˜­8>FFFHEEEHFEFHFZFFFEFFFEFFECECFFCHFFHEFFFECEFCFEEEECFEFCFFFFFCFCEEFEFEEECHFFFFCFFECCEECEECCCECECFCBBBCBECCCBECCCCCCCEBBABBECBCBAABBBCBCCBAAAABAB@>AA@AAAAAA@BABB@@@AA>@A>A@BBAAAA@@AA@@A@B>@@@@@A@>=<84`0/-**))'))'6*)*-**--/**-/2*--*)*/!)e\_sPCABC@AB@AA=>=@<=>W@A@><<<>=>@=@>=<;;8;<==@@@A@@AB@BCABBCAACECBAAA@ABAAABBECBBABCBCCAABCPCAABAAAAABABBBBCCBABABCA@@UBBAABBABAABCBBABB@AAAAA@BA@ABBBAAA@AABABBABBBBBABBBBBBBBCBAABAAABAAA@@@ABAAAA@@AA@@AA@>@@@>@A@@A0A@AA>BAAAB@@BCCBCACEF&џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЖ’ЏF4HHFHEHFHHEHFFHFHHFEFFEEERHFEFFFFFFHFFFFFEFFEEFEFFFFFFEEFFEFFFFEFFEECEFCHZEEEFFEFCCCCCCCAECCECCCECCBBBECCCCCCCECECCBBABABBBBCBCBBBBBBABECCABAABA>ABABBBCAAAABAAAA@@A@@A@AA@BBAAAAAAA@A@BAAAB@AAA>>=84300---**--)**)))*--*---**-/---/-)//0!j^_fPEBCBC@@>>>=>>>@V>AABA@><<==>>==>>=;;;88;<>>@AA@AAABABAAAAAEEAA@BBA@ABBABCABBACBCAABBABBCCABBCCCPBACAAEBCCBCBBBABA@AA@BBBABABABBBBAAAAAA>AABBAABBBABABBACABBAABBAAABBCBBBBBBBBAABBAABBAAAB@ABB@AAAAA@>@A@@@>@@=>ABmrVA@A>@A@BAA@AABEBBCCEIIџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџН‘ЃT-HHEFFHFHHIFEEFHFFFHHFFHIEEFEFEFEEIFFHFFFEFFFEEFECEFFFCEHEEFECFEEFEFEFCEFEEECFFFECEEECCCCCEECBEEEEEBFECCECCCCCECECCBBCBCBCBCCBBBCCBBBCCCBCAABBABBAA@BAAAAAAACBBCAA@A@>A@@A@BACAAA>@A@ABBA@A@PB>A>=8832/--******)-)*)-)-***--**/--)---*N-0)f^`oN4AAAC@@>=>==>AA>>@><>L@>===>;;;8<868;=>AA@AA@@@ABBAABABBBAABBBBBAAAABBCBCCBBBABBBBCCBCBBABBBECABBCCB@ABCCBBABABBBBBBBACBBAABABABBABAABACCAABAABBABBABBBBABBAABACCCABBBCBBABAB@A@BB@@>@@BAABA@BB@AAAB>A@@@>@@A22@@UC>BBAA@A@AA@ACBCEH@A@@B>ACCBAB@@@@A@@BBAAAAAA@>=;650/0-***)***))*--))*--*-**---**-*-*-*0!f^aoPC@AABAB@>>>=>=@<=>A>>>=>>=N>=<==<<8;88;8;<>>=>A>@@A@@CAABBACCCAB@BAABAACACBBCBCBBACAA@BCBAAAA@AAAB@BCBEBBBABCBCCAABBBABBBABCCABCCABABBABBB>CAABAABCBBBACC@BCABBBBCABEBCBBBABCABAAA@ABA@>AA@A@AAAAB@@>AA@@A@>>@@ABBAAA@AB@B@BBABAABAABBCI=Žџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџм“’Ђˆ*IIIIHIIHHFFIEHIFHFHHFHFFHHFCEFFEFEFFECEFHIFFECFFFEEEFHEEFECCFCEEECCHFFEEFEEFFEEFFFEECEBBECCCCCEFEFECFEECCCCBCCBCECABBBBBBCCBABABBBBBACBAAAABAAABBAAABBAABAAABCBBA@@A@ABA@BCAABA@AAA@>@BBBAA@@@<;6420*---****))*)))))******-*--))-*-/)*-0/k^`mPEAAAA@AA@@>>>>====>>>>====V@>>><<;<;<8888;<>@@@@A@A@BAAABBBBBAAAABA@BAAAAAAAEPCBBABBAABABCABCBA@A@ABCACCCCCABABBBBAABBAAABBCBBAABBCBCCBABCAAA@A@BBBABBBBBAABACABAABACCBBBAACCAA@BABUA@A@>@AA@ABA@@@A@@AA@A@@@@>@ABA>@>@N@AACBAABAC@BCCCH4Вџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџэˆ”Ѓš*A@@@@A@AAA>>=<853//--*-)*)*'))'*))))))**-*-*-W***//---0)f_amPCBB@A@A@A@A@@A@=@@>@A@>>==>@>>><8<;;;;6;<;<<=>@@>A@ACAABBABABBBABBB@@@@CBBCBCBACB@AAABBBCBBBBABBBBBBAABBCCBABBEBBBBAAABBBBACCAABAABBCEAABCBBBBBAACAAABBBBACCCABABAAABABBABBBCCBAAAACBA@A=AAA@@AA@AAAAA@A@A@A@A@@AA=A@@@AAAABBBBBAABBABEH'дџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§Š•ŸЈ'JHHIHHFIHHHIIHHFHEHFIFFHFIFFFFFEFEFFEFEFFFHHEHEFFFEFHFHFFFECEEEHEFEFFFEEFEEEEFFFEHEFBEFECBCCFFF^CEFFFEECEBEFBECCBBBCBBBCCCAABBBBBCCEBBABBAABBACBCPCCBBPBBAAABAAB@ABABBCBAABACBA@AAAAAAAA@B>>>=85320**-****)))))*'))*))--*-**--0-**--***/)g_avP5BBBA@@>A@@@@A>@A@@AA>>=<@>@===;<;;;8<;;88;<<=@>>A@AAAACBCCBAAAABBB@AAABAABBBBB@BABABBBCCBCBEBAAAAACCABCCECCBCCBCBAA@BAA@CBCBABBBBBAAA@BCBABBBBBABBBBCBCBCBBBBAABBAAAAABBBBCBCBBBBBAAAAA@AAA>@@@@AB@@@AA@>@>@@@AA@BBA>@@B@AAABBCBB@BBCCI'јџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ™ŸЁЇ=IIIFHFHHIHHJFFHFHHFFFHIHIFFIFFFFFHFEFEFFFFHEFEEFFFFHFHFHFFFHFEFEHFFIFEFFEEFEFCFFFHEFEEEEECEECHFCEFCCEECECEECEBCBBBCECEBCECBBCABCBBCBBBBAAACBCCCBCBEBBBBBCC@BBAABABBABAECBCBBA@AA@AAA@@@AAA><643//-*-***)))))*****'*)'*)--*---**-*-----0)mjavPFB@BAA@@@A@>A@ABA@>@@@===@>=>=><<;<;<88<8;;;<>>A@AA@ABABCCBCBAABABABBBBBCEEBBBBAB@@AACBABBhBBAABABABBCBCBCCCCCBCABBBABABA@AACCBBBBA>AAABCABCCBCABBCBBBACBCBBCBBBBBBABABBBBCBBCBABAAAB@@@@AABA@@BA>AAB@>@B>@A@>A>@>A@@AAA@AAAAABAABAAABEI7џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЉ–Ѓ­6@HJIHFHIIIHKJHFFFFFFFHIJHHHIFHHFHFHFFFHFFEFFFFFFFFFFEFHIFFEFHIHFFEFIFHCFECEECCECFFHFEFFEEEEEFFECECCEEEFCEEEBEECCCB@CCBBCBBCCBBBBCCBBBBBBABBBBBACBCEEEBBABBCBAVBBACAAAAACCABBBBAAA@A@AAAA@A><644//---*----**))*'****)-*)*)**--------*--02#m`dqB5AA@AAABAAAACBPA@>@>@>@>=@>===><;<<>*<;;<<<<<>=@@@>@ABABACBBBBAB@ACCBABACCBBCCEAAAACBACBBCAACABACACBABABCABABBBCCBBCBAABB@BABBBCBBBCBBBBBCBBCCCBBBBBC@BBBCACBCCCABABBBABBABBBBBABAAB@AA>AA@@AA>@@@AB@@@@@@A>@@@@@A@@@AAA@A@BABPBBBACBEEJNџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЙ”“АP;JLIHHFFHHHIJFHHFHIHIHHIHIFHFFHFHHHFFFFEFFIHHFHHFFFFFEHHFCEEFHHFHEFHFFEEEFFFCFEFEEEEFFCECEFCEFFFEEECECEECECCEECBBBBBCCCCCBCCCBBCCECCBBEBCCBABACCCEBCBCCBABBCCB@BBBCBBABAABBBBAB@AAAAABA@A><8632/---*)***)**))*)**)))***--))**--)---*/*02#q_crRFB@@ACCBABBABBAA@>>>>@>>=>>>>>><<=@<*•><;<;<;==>>>AAABCBBCABEABABCCBBBBBCEBECBCCBAABEBBBCBBBABA@AEBB@BBCCACBCBBBABAABA@B@CBBBBBBCBCBBAAABCBCECBCCCBBBBBCCCBBEBBCCBBACAAB@BBBBBABBABBBA@ABN>@BA@@A@AA@AAA>>@@@A@BA@@A@@>@@ABUACQCBABACCFKpџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЪ’‘Ћc;LNJIVIHHFIIHIHIHHFFFFHIHIHFHFHHHIIHEIFHIFFFIHEIFEFFEFEFEFFCEFFEFFFFFEFFEFHHEEHECFEBEHCEBCFEFBCECFEECEECCCFCQEBCCBAEBEFCCCBPCCBBCCCCBBCCCBBBBBCCBECBBBBCCA@PBBBBBBABABBBCAABBBA@A@AAAAB@>><5240-/--*-***'***)*)))**'*)**'-*--*--//--/-/2-hkdyR6CA@BPEEBBCBACB>AA>>>@=>>>>>>A>=<===**&<<<8<<<<<>=@ABBABBCACABBBACBCBCBBEFBCCCCBBBECEEBCEBBBCBBBCCBAABCBEACABCBBBCBBBBBB@BAABBBCBCECAXBBBCCECEECECCBCCCBFCBECBCBCBBBCCCABBABBBBBBBBBAA@>AA>@AB@BBBAA@>@@@AA>>AB@ABAAAA@>ABAEABFCABBBECE>“џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџи’“Љˆ-KKKJKIIHFHIIIHFFHHHHFHFHIHHEJIFHFUIHHFFFHHHFHHFFEEFEFHFFFEEFFCEFHFHFHHEEHFEFEFCCEFEFEECBCFFFECEFEFECECCCCEBEFEFECCBEEECCBBCBCCEACBPBBBCBBBBBCCCCCBCBBABBBBBAABBB@BABCACCAAAABAB@AAAAAA==<6332//--****))')*-*-)****--***--*--//0////--03-ocezQ6FCABCCEBBCBAAB@@@>>AA>>@>L=>B>>@>=<=<<<<<<;J===<=>AAAABCBAACECCCABCBCCCCCEEABCBBCEEBBCBBCBWCBBBBBECBCBECBBBBBACBCBBCBBCAABBABBBBBFCABACBCCCBECBBCBBABBCCCBCCEBCCBCBBBCBBBABCBCCBBBBABA@AA>A@AAAAA@@AA>@A@A@AAAA@A@A@@A@@@ACAABBBCBACCH=Еџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъˆ”ЉAB@A@A@@=<862/0/-/**)*-**)*****-'--***-*-**/--/02-@0/2233%ireoA@>@B@A=><><>=<<<<;<<<===>>A@BCCABBCQCBBBCCBBCBBCCECCECABBEBCBABCBCCCBCCBBBBBBBCACBCCBCBBCBBAAACBAAAABACBCBBCBBBACCECCBCCCBCBBCBCCECCEBCCCBCCBBCAABCBCABABB@@@AAABCA@>AABAAAAAABA@@@AA@AA@@A>@ABA@ABAAABBCBBEH;мџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџљ–”Ѓ”/>KIJHIHFHIIHHIHHCFHFFFFFFFFFFIHIFIHHIHFFHFIHHFFFEFFFFFEEFFEHFEEFFFFHHFFHFFFEFEHFFEEEEEFCFEEECEEEFFEEEECCCCEEECCCCBCEECCCCBCCCCBCEEECBCCCCCCCCECCCBBCBBCCE@BBCABCBBCBECABAACAB@ABABAB@><853000/*/--**---***-*-***-****-*---*-///0A32588%&jrcxHQNJIHFCCBCA@@>BBPB@@@BAPA>B>AA=>@@=<=<==<<<<<<<<<<>>@ACABAABCCEBCBBBCCCCCCCCBBCCBCBECCBCCCCBBBCBCBACBBCEECCECBBAECBBBBABBBBABABBBACCBBBBCBBBEFFEBPCQCCPBCBCCCCECEBCECBCCBBBBBCBBABA^A@BAA@@ABBBB@A@@@BA@AAAA@@@BAA>AAB@ABAABAAABAABBCCF8ћџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ•™)>JJIIFHIIHHJHIFHCFFFEHEFFFHFIFIFHHFIFFFFEFHIFHFFHEFFFEEEFFHHCFFHFFFFHEFFECCFFCHFFFCEFFEECEEFCECEFFCEECFECFEBCECEEEECCCCEBCCBCBBCEBCBBCECBBCCCBCCACCCCCCCCBACCCCCCBCBCCCBVABABAA@AAAA=<;5340/0***-*)**/*-*-*-)/-*---*/-----/-/-004236>>=><<=>=<<<<<<<;;>AACCBAAABBCECCABCCBBCFECCEBCCCCCCBCCCBCABCCBACBBBCCBCCCBBBBBBBBBCACBBAABACABBCBCCCCBABBCBCEEBCBBBCBCBCBBCBCFCECCBACABBBBBBACBABAAABAAA@ABAAABCBAB@@@A@>A@@ACB@AA@@A@@A@BBAAABCBBBEEHIџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЄœЁЋ;=8542/2/00--*--***-**-/<-***---*--/***--//032235F6%&pccs@@@><==>=<==<=<<<;<<<<==>ACCCBCBBBCCBCACCBCCFCnEEBCBBCCBCECEBBCABCBCBBBBBCECCEBCECBBBABBACCCCBBBBBCCCBCAABBCCBCCEBCCBBCBCBCBBBBBBBBBBBECCECAACBAC@@AABCA@BB@AAAAAAAACBABB@@AA@@AA@ABB@AAA@AABAABBBBCABCBCC5bџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЕ‘ŽЊR4IHIHIHIIHHHFFFHHHHEFIEHFFFHHHFFFHFFFFEEFEZHEFEHEFHIEFFEFHEHFFHFFFHIFFFFEHFEEEFFFFFFEECFFFCCECECCCECECFEECCECCECEECEBCBBBCBCCCBBCBEBBCECCCBBCBCECBCBBCCCBBCBBCEBCCBBCBBBCCBACAABA@==;6400//-/---*-/)**-///-/)**-----///-/-*/-0322204644!pmdx=BQLIIJILKEEEFECCFEBAAAAB@CA@@A>@>====<===P=>===<=<>>@BBECCABCBCCBBBCCCCCCCCFCBBBCCCACCECBCBBCCBBBABBCBCCCQFCBBCABAABBCEBBBBBABBBEBBBBBBCCCBCEECCCBBBCBBBACBBBCECBBCCABBCBCBB@BBABBABBACAABAABAABBA@A@A@@B@A@@BAAB@ABA@@@B@ABA>BCABCBCEJuџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЬš­p%KIHHIIIIHFFFFIFFFHHIIFEHHFFFHHIHHHHHFFFFEFEHHEEHHEEEEEEFFFFFHHHFEEHFFFFEFEEFFFCFFEEEEEFCFEBCEECCEECFFFCECEFCEECECEECCCCCECECCBBBBBCBACCBCCCCBCCBBCCCCECCBBBCCBBCCCCCCBBBABBAABC>>=864200///0---)-*-*--/-/-/**--//--/----/>2032200202332omdrR=LIIIHJLaKFCHCBBQECAAAC>>T@>>@=>>>>=>>>>=<<>=<<<<<=>@ABCCBCCCBCCPBCCEECFCCEBBEECCCEBBCEEBCACCCAAACCBCCECCEECCCBECBACBBBBBBBBAABBCCBCCABEBCCCACBBCEBECECBBABCCCCCCBACBBCCCBABBCBBCCAA@BABBCABCCAB@@AAAN@@AAAABACBAAAAA>@@AAABAABBBECBCE=›џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџг’‘Љƒ&KJJIJIHHHFFHHHHHFEHFHFHHFEHIHHIFHHFEFHFEEFHFFFFHFFECEFFHFFFCFFHHHEREFfEEFE5EFFHFFEEECCBEECBEFCEEEEEBCEECECEBBCCCEEEECCECBCCCEBACEEBBCECCEECCBCBECBCBCEBCBBBCQBAECEEPBBVBAAAAAA@=<853000/0/0--*---*--*----**---*--/---*---30322/222303!amdsEIHIIIIJLNJFCHEECFCC>@AP@>>>>>>@>@@@>@=;===<==<<>>=<=>AACCCCEEEEBBCBECCCCBCCCBBCBCECEECFCCA@ACBABBBABCBCCCCCBBBBCBBBABAACABCABBCABCCBAABBBBACCCBBCEBBCBCCCBCBBACCCCBCBBBCCBBBCBCCBAAABAABBACCCA>AA@@@AAA@AABBAA@A@BA>@>@@@AACBABBBCBCEFNОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџу“’ЉKIIJHHIHFFFEHHHHEIFFFHFFFEHFIIHFFIHEHFHFCFFFFEFFFFEEHHFFFEHCFFFHFEFFFFHHFHEEFFFFFEECCEECCECEEEECBCEFFECCCCCCCCCCCECFECBEFCBECCCBBCECBBBCCECBCCCBBACBBCCCCCCCCCCCCECBBCCBBAAAAB@@<863020//-//-*--)**--****-***--*)--/-//*--200202222224&psgyQIFHJIIHJKIHECEECCB@AAAA@>@>@@@@>@@=>>=<=>=><<==<=><>>@ACBCCEFFBCCBCCBCECBECBBCBBCEBCCECCBABABCBABBCCCABEBECABCCA@@BABACBBBBBBABABBCCCCABBBBBCCBBABABBCCBBBBBABEBCCBCBCBCBCBABABBABCBAAAA@@BA@@@@A@A@A@A@AAAABA@AB@@A@@@@ABABBCBBBCCEEFBмџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџє‡“ЋЄ'LJHJJHHHFHFFFHFHIHIFEFEFHHFFFHHHIHIEFHHCFFEFEHHHEFFFEHFFFFEFFCFHHEFHFFHEHFFFECECCCECEEBCCEEEEEFCBCEEE-88FCBCBECCCFEFCCCCECBEEBCCCCCCBACEEBBCBCCBEBBBCCEBCCCCECCEBECBCCCBBAA@@A>>;64402//-/*/*-)'--****---/-----***--*--/-*00//02202323&pnfsQ5JHIHHHIJHIBBFECCBACCEBA>@@@@AP@>>>>@=>@=>=>=>==<===>>ACACCBECBCCBFCCCCCBCCCCBEECEEBCCEABCAABECCCBBCEBCCBCBACBBACBBAAPABBABBBAAABBBBABACBCABCCCCBABCBCCBCCBBCCCBBABCBCCBECB@@BCAAB@AA@AAA@BAAAAA@AAAAA@@>AAA@@BAA@AA@A@AA@BBBBCBBCCCEHFњџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‹™Ћ*;IIIHHIHFHFIHFFEHIHIEFFFHFFFEEHHHHHFEEFHFFEFFFFFFFFEEFEHFEEEHHFHFFEFFFFHEEFFFFEEEFEFECCFCCECFCEBCBFEE-з8CBBCBCBBEEHEECCCFCBEECCECCCCCAEBCCBBBCEECBBCCBCEEECCCECBCBCBABCABBB@A@=;8542//-0---/-*-)*--***--//-s*)*/-*)//-**-/0-/020002405&gserQIIHHHHHJJIFEBFEBEB0ACPBBUCAA@@X>@@>=>@>@=<>><>>=>>>>>@@BBCCCBCBCEFEECCBCBCCECECEEEECFCCCBBBABBBBBCBBECCBBCBCBBCCBABABABABAABCBAACCACECCAABCBCCCAABBEBBCECBCCBCCBBCBCCCECBEBABCBBCBBhBA@ABABA@A@AAAA>A@A@@@>@AABAA>@BAABABAABBAABABBCFIEџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЇ“™Џ;;6430-///---****/-)--)**//---**-*--------/-/0002//002H2!3pdeoRJHEHIFHIIFIFEEECEFEAFB@AACAA@BC@@A@N@>A@>>=>=K>>>>=>>@@ABECCBABCCFCFCBCPCCECCEECBCCCCCBBBCBBBBACACAEEBBCEAABBBCECBEBBCAABBCCBBBBBBABBABACBBCACECACCCCCBCBCBCBACBBABBCEEEBBABBBBBBBC@BABBBCA>@A@@AAAAAABAAB@@@ABBBCA@AABBAAABBBA@ABCCEHgџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЏ‘‘АP3HIIFHFIFFIJFFFFHHHFIFFFFHFFFFHHHIEHIEHHFFHHHIEHHHFEEEFEFFFFFFHEFFHCEFECFRFFEEHFFFEEFCCEEEECECFCCECEEEEECCCECCCCBEEECBCCEQCECECBCCBCCCCBECCECBBCCCCBBBCBBECCCECBBCCEBBCBAA@A><85330///-**----**--***-***-)*-/*)----*----*--00//0/00424/kdfpR8FFHHFFIJHIECCECH\CCPEABBBBABABA@ABCBAA>>@>>>>>=>><>>>ABACCCCCBCEFECCECCBCFHEECEECCCEECCBCCBBBAAACBBBBAACBBCBBEFBCCBBCBCBCABBBCCCCBCABCBACCBBCCBFCCCBCCCACBCACCABBBCBECBCBBCBBBBBBAAAB@@AAB@@A@A@BAAABAAAAAA@@AB@ABAACBBA@AABABBCCCBFJ}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЧ’ЂВ^*JHIFHHIIFIKFFEHIHFFFHHCEIHHFEFHFFFFFEHHIFFFZHFFFFHHHEEEEEHFFHHECFFEFFCFEFCFEEFFEEFFECCEEECECCBCCCCCEECECCCECCEEBBCCEBCEEFCBBCECECACBBECBCCBBBBBBBCCBBBCCCECEBBABACBBBCBBC@@<;54200///----*---*)**--******)---**---*-H---*0022200/0223/kowqQHFHIHHEFJJFFBCCBEHBC@B@BABBCBCBA>ABEQAAAA>@W>>==>===>@@AABBFCCECCCCCECEEECHIFFEEEECFFXBBBBAABACCBCBAAACABBCCBBECCCEBBCCCBBCBBEBBBECEEACBCCBCCCBCFEBECFEBACBBBECBBBCEBBBBBACABACCCCBCCA@AAABBABAAAAABAA@BAAAABBABAAAABBA@AA>BBACABCBCE; џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЭ”•Бt0IIHFHHIIEIVHFEFHHHFFFHFHHHHFHHHIFFEEFHFEFFFEFFEFFHFFFFEFCFEFFHFHECFEHFEFFFCEEEEEFFEFCEEFCCCCCCECECCCCEECECCCCEECCECCCBCECCBPCCECCBCABCCCABCBECCCABBBCCPACCCBCBACCCCCBBBBB@=;55320-///---*****))-/---')--******---/-/-**--002220//023!&qfrtRIFFHHFHFKJEEBEFCFHECB@@BAAPBABC>@ABCjBA@A@@@>>=<>=>>@>ABCCCFCCBCCEBFCEFFECCFFFCFHECECEEECBBBBCBCBACCBBBBABCBBBCCACEBCEEBACCBCBBEBBBECCBBCCECECFCEBCCFECCBBBCCEBBBACABCBBBBBCB@CACCBCAAB@AABACBAAAAAA@AAABBBAABBB@BCBA@@AA@ACBABBCBCBE;Оџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџс–ŸЄŒ&IHIHHFIIFHJIFEEHHHHFFFFFFFFHIHFHHHFFHEEFEFIFFFFEEHFFECEECCEEFFFHFECEFHHHIHFFHECCFHFFECEFCCCBCCEQCEEBCCCCBECCCCCBCBCEECBCCEBCEEEBCCA@ABCECBCBBABABBCCBCCBCCCCCBABCBCBCBAA@=>>@><;>>@@B@ABBEEFCBCBCEFCEEEECEFEEIWEFEHFEECCBBCBCCACAABBBCABAEBCBEBCEBCFFCBCABECCCBACFCCACBBCBCEECBECCCCCCCCBCCBCBBBBACACABCCCBBABBAABBBB@A@BBEBBBBBBAA@AA>BA@@BBACBABAA@AAABCBCBAABCEE0сџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџя–”ЂŽ!IHFHIIFIIJHIIIFFHFHFFFFEEHFHKIHHHIFFFHCFFFFHHFFFFFFHFCECECFFFEEEFFEEHFEHHFEEEFFCFFEEEECFCECBCBEEBCECCCCBCCCBEBCCECEBBCCCECABCECBBBBAABBBCABABABAC@CBBBCBCCCCBBBABABCCBAC@<;6432-//---*-----**---)*-*)6)))*)**-*)--//00-*0/2202-000003'm}hzUIEEHFHHIKJHIHCII^FBCA@ABABBBBBA>A@AA>@>@@>@>@>>=>@>>>>B@BBCEEECEBCCEEBCECECCCEFcz8CHJFFHFCCBBABABBBAFECBBCCCECBEECCCFHEBBBCCECBCCBCCBBABBBBCFCCCCBBCBCCCBBCBBCCCEB@ACBCBBBBBCBACAPC@BACABABBEBAA@A@@ABA>@@BAABBABAABAABAAAABCPABBBCCC:џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ˜’– 2>==@@>@>A@@>@>@@>>=@CFFBCEEECBCCCCCCFFEEFEFELj6FUUIHHECABBBBABCCEaEBCCCCEBBBBEEECEFEBCEECECCBCBCBBBCEBAABCCBBCCCBEEEECBCBBCBECFECCCFFFFCBBBABBBABAABCWCCBBCB@@BAA@ABBA>AAACE@A@B@BACBABBABECBABBBENџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџš›Ђ2=FHHIHHIFKKIIJKWIHHFFHJHIIIHIHIHHFHEFFFFEFFEHEFFFFEHHFFHHFFEFEEFECCEFHFFHFFFFEEFHEFCEECCECCECBBBBCFBCCCCCBBCCAECBCBCFCECBBCBCCABCABCBCBCBCCCCBCCBBACECBBCEECBBCEBCBBBBBC@;65020/-----**--/--**)*-)))-*--*)))*/------*---/-/23202020/3'rpgpCFCEEFFIIJJJFHEFIFECECCACCABCAA@AAA@>>=A>>>AAA>=>@>>@<@@CFXCCEFHECCEEBEBCEEFFEFCEIFCIFFFCBACABAACBACB\ECBCFECCCCCFEEEBCECCECCECCEFCBAAABABACBECECCCCCBBFCCBEBCCCFFRFECEHHFWBCCBABCAABA>BB[EABBCBA@>AAAAABBAA@BCCAAAB@ACCBCBCCBCBCCCBCF^џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЎ‘™ЌK;542200-*-*--*--/-*--)*)-))***)***)*--//--//-*)//02//0000/2!'vpgyQFEFFFHJKJIIFCFHHEFCECCCCEBABCAAA@AA>>@AA@@AA@@>@@>A@>@ACFHFCFCEECBCFEEECFHFCFFFEIEHFHFECBAAAAABBAABABCBBCXCCCBCEEEFCECCEEQCEEABEREABABAABBBCCBBCECEEFCEFCBCBCABCEHEFEECFBCAACEACBC@AABBAEBAACAC@>AAAB>ABAAAAAACEAA@BABCEECECBABBCBCEF‚џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЕ‘ЂЏN3FIEIHFFFFJHHHKLPNJIHHIHHFFFIHFIIFJFIIHFFHFFIHFEFFEHIIIFIHIFFFFHEEFEEFFFEEEEHFEEEEEEFCECCCCEBBCCCFTEEECBBBBBBCBCBCBAECEEEBCBB@A@@ABCCABCBBBBBAA@BCCEEFFFHCEFFEEHEBEBCEB@<65302J/--*/-***---)**)**-)-*-'*-))--/-2-/-/-----020/0/0-//24#vvgsQHEEHIKNLNHHFECCEFFFFEECFCE2EEB@@BAA@AC@A@>>B@@=@AA@@>@CEEFHFFCEECCEHCEEFCFFCIFFFIHHJHIEBBB@ABABBABAACBABCCEFEBBCCCBCBBCECFEECBBEFCAA@BBEEABBAACBECFFIHJJFEECCCBBEEBEECCF3EBBCABCCCCBB@AACBAABPA@AA@ACCBCABACABECEBACBABCEBFCBCEABECCF џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџШ“‘Єi4IFFHFHFFHHIJIJJN[KJJHIHIFFIHIHHHIeHUIFFFFHHFIFHIFFHHHFHHHIHEHFFFFFFHIHHFHECHFFFEFFHIFECCCECCBCEBEIFCFEECCECCBBCBBBBCBBECBAB@ABA@BBBBABBBECCCBABBBEHIHJIFFFHIJHJHHBEFCB@<<540000--*=/--*-0*/-)*-*--)--*-*)*-////0/-/0/0-00222020/0004#toepRHFFIIKZNLKHFIEECCHFCHFHFFE5eIBBABBBBCVA@A@AA>@@AB@A@>ACCFHII\FCEFHHHHEFFEFHFHIJKKJHUHHECBBBAAAAAA@ABBAACEEEHHBCCCCCECEECEEFCEEBEEECBACCUICCBCCBCBFINgKKXLHCECECEFECEEF4XEEFECBBCBBCAABCBCBAAAAA@@AABECBA@AABBCBFCB@CBCBEREEBBFCCBCCCFЧџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџз“‘Њn%IFFHHHHIHHJKJKKKdKJKJHIHHIJIIIIJHfIHJIIHHEHFIFHIHHKHFHIIFHIJJHIFFFFHFHFHFCCFCFFFEFHJIFEECEEEEECBEEFEECECCCCBBBCCEBCEBAEEBABBBA@@ACCBAACCEBBCBCCCFFJJIKVHIEIJIIJHIHHEFB@<8LZ52200-/----0-0*---*)--/)*-/-*)--/-/20/0000A22032200002003&kofsRICTIIIZPLLKK\HHEH\HHECFEFE5}PEAA>ACECV@@ABPBAA@@AA@ABBCCFFJ=qPPNPNLPNLJKJJIIILIJKJLIKIHJIJIHEEHIHIJII^IHFIJIHI^JJJIFHHFFHHHEECFFHFEHFEIFFFHEFFEFEEBBEECEECCCCABBCAACBCBABCCABAAA@AABABCCBCFCBECCCEFEINLKKLIIFJIJLKIJJKHHBA<554J200/0/0/-/0/2-//-*/----*//0*-//0/002/3023643343/03200002&kof{R8FTFFINLPLPLNIUEItBBA@AABABAACCEFFIFCCCBCCCFCCFFTFECBEFEBABACUHCCCCBPCCCIHIHHLNJICEHFCFFFKKHFFBBHCCABABBAABBBBAAAAAACPACABBCCCBABCCCBECCBCEECERECBCCEQFCEFFџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџќ„Žš-JJHHJNP@XVcU_RQR^PNJLJKKKLLJKKNXJKKHILZLJIHFKLIJIINLHHKXKL;LIJKJHKIHIHFIFHEFFFFFJFHHFFJJIFCFFFE@FFEECCECBEBAACCCBCCCABBBAAAA@ABBCCBECCCFCFFEFFFFJNLPLNZJKJILKPLJJNLJIB@<844322200-0--/-020////0//00//03/0/-/-03224345N<6864223/2222!&vvftEFCFEHHJJN>aQKIJI;H8832022302!'vpgqT8CFFFHJJXLaQLLJKKRfKFHHJHH8`JFBAECCEAEBBABCRFCFEC@ECBCHHHIJKKKLJJLHJNJJJJIL^IIXHHIHIIUHEEBBABZcBAABAA@BBHFFFFECFCCAECCCBCEZECCBBBCBBCBPCEBCCBCBBETHHHIFKNPRTXa‡\ZXVVRRRRRTVFQQQPNPPPPPPPPPPQRQNNPLPPPPPrVPPRQQPPPLLLNNLNNNPPQPPNNKIJPLLLKJKPNHCBEFEEFqFEHFCFEBBBCXECCECHCEBCBBABACCFFECFCEIHILKKNPNNfiVWVT_QPNPPPTdQLNPNJCA<<656432002323A30322343225`<56EL866545688;=J<8;=;<;[5303320040vpgtU8EEIFHHKNKLNKLJLKPdIFHIHIIHWKECCFFCFEQC@ECFTICCECEFFEHIIKKKNLNLLJKLKLKLKNLP`BITCC@BBABBCREFFCCCFTCFFECCCC3FFFHHCECCBAABEEECFFCFEHJIJJJJ>vQJ;QPLJIFIIIJJIIHJJIH<=>>;66;888;8202400/30redpU4HFHFFEILIKKKJJIILJIFJFHFFILJFCFFIHFFFFCFEHIFECFEEFHFHJNLKNNPNPNPNPPPPPPPPQTNLPQPJJHIH8XfCCAACBEECBAABEAFEEEFCCIhFEECEECCCHTF`KHFCBBBBCFEFHVFFIIJKKLPPQQRQN&`CLLNKNKNJJLNKLPL)Œ[@KKL>^RLNLLXKKJKKJLNLJNKKLPBUUP@QPLNRQNNLLLKKKKIIJБџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџсноммЪиузЏ• Ÿ•ŸЏЕЎДГЋІЕВВЊКЪХЪХЩЩЩУТУЩеснпстшђћќ§ћџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЛyŒ\2FJNVJtdQ^[VUVVfKJJJEЛД;UTUTRURRRRRTVTTUcVRQQPRRTRVZTQQTTRPQPRQQCQRRRTVК^=URQPPQPQRTPBePJHHJJJHFKHUHEFECECECCEEEFFHFEFEBBCCECCFFHEIHIKLPRfPPQTTNkCTTUUVUFRQQRURQPNKKLFA=>84334422//202200225430338E356<=@<5448;=;PhTUPPPQQPPNKЯџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџУЄЏŸЈœ‘ЇЉ ‰‚€€€‚€}}|||{z{zwvzwwxtsttfeca_r™ЏЫбдвбЬзЬЪЫЧРЦЫЭгШЫЯЦППСССбжбнйаиЯЯЭЯепфсоонутппфыђяђђёёѓђяяђџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџРHBom0BFLWP‰Cc\XVXZkPRCFtШпZIXZZ[\ZKHTTUWWVXZZWTVFWK[WHTRRRQRTPRTVQcNITVZWZ'џЯ=NVRQPRXVRTREjQLWHIK^JJJHIFCEHFECEEEECCFHEEFEFCBEEEEFIIJKLLPR^NJ_LNUX6<=5W[`C_RFL@IWXVFQPPNH@><654446422032240343643005642248;>;&5;=@@_63386H<68423333030vee|W;FJHFFFJKKaINaNJIIIKJHFVJIJKKKH88HIHFEFFIIIHEHXNLIIK3_*QRPPPCVUCEVUTVVBRUo_L_LFQQJJPPPLLKECAAABBAAABABECECCEEEFEIFFCECcECCEH6KHEEFEFEBFHHJLi3FLPPPR8;N-‘oI[Мj0[BUQPUcV>A8CIs„;PBЮџŸWCPPQ;8—B5R=\FTUQPђџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџˆp€}x…v‡‚}}}}}z{{{zzzzyzzxywtvxyzik{z‰Ž™‰‚|zywyvootsrkhrmiiejdcagffef^eV^gh_`eV_^fggga_kg`hh_e^pp`_^fairŒ…‡ˆ‰†€Šƒ‡ŽІІЉЈІІЏЄЌЉЕУУФФЩШХШЩЩШксттфтфуфусщџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЮ&#Tq/3F=WP{Ѓ‰6JZXZPZ;Џg“i}EPTeZgQ…PkIEWL_IeH^K[[JTgkNEIVVEPRRQTWEsЁm6A^q^^џь\U[ZTQBfaBTQUwWPPHFKLKKIHFFFFHECCEFEECCEHBCFFFFCFFFHHJJNPRUWpdJ0IHP[…<щ}PNŠQqxN€cHVCKHBXCJEA==<'6;>6223;&6!345&;'8##8854358-)@#<>@3zC)65846;65403443052mtqvV6FfIHIIIKKJKQeALKIHLLHIKN=@PQQ<=IIJIHJJJJ@N8H=hFV65E2џ0_68\2_q@2sBE[fFT>‚xˆƒ2TQ;H`RcNKEEEAA@BA@AAA@CCCCBCEBBCCFEBEEEpFQCCFHEEFCFCCCCFFLNPJ/CIPRWPЯ0џvKœoKx\2KTW^3)kЉ…\zeTTQ8peaEQPPUXJPHjFdH\qЏ6CAџџР4H;QBŸџocВ`IRA™ЬЮЮММаСйцсэтэюхщщхяущюшфффнчснсчушэхыыэяухцыычьфышюцячэрц№яяёяёяёёяѓїѕ№юыяьѓяю№ээіјііїѓііїїјїјіљњїїїјјљїѕ§џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџiy‡z……„ƒ„t}}}|}|||z|{|}‡{||zz„zyzzz{zz{[T^ZX_LHA<854386*6*55@--43*36*2)55))440430'40403'4)2%)22%)0#0305)'0'0000##0'#4)''%2#0))))&***&&%)*3*&*&'4-*&3'*'''//-!/))4')**-*0LWQWYYYW[Y][Ž…………‰†ˆ“­Џ­ЏЏЌЏББГЎЫжижжжжйздЯиџџџџџє&0\oH3IJZm\ЇџK@P\_[@ZџџpEVB˜QŸs›wЯ`i€IER•`ЁeCjgdaoАqЙK)^z[UTUVV[AЊџћ&5fЂ4Fge™|QeUR*­ЉR;eyXP^HEFVKJIFFHFFFBBCCBECBCCECBCEEFFHEEHECIL\_rXo`A>B6P^ЄZ2џџnsЅБkЈŠџNm@ˆnВzT›0@KE35h3#T_0&6;^2V'5BB-<56<4CЮiC)0N6Es*;5623446832342055knerX@A;m'Nџ@б@Ж>nЅ2џE;Hf;X2eЂмЧ'V\H6XR^PKFCBAAAA@@@@@@ABAAABA@BAABCBCBE\EAACFCBCQEECAPCFI\^hF=AIKRdŸџџЙџ^Aџv@џ§m24CPPЯлџџ0џ /ѓXhA4‹|ŠEET3NPRqWˆ@3ЃРI‡=Iџџџеџ[šTPeJ0HK3„Ј‹џВcQQgЄkyџџfEJaNХV•p“ˆИ_€ЗtK‚А_ЗъjД_}cnВ‘џЦ)^ ^WVUUW[>чџ˜'XйPPXyДЙLWURлџTRzieN\EBVFFFFF[IFFPAALL@>A@@B@A@ACCECWECPA>CRIX`PgE%8L5iHjЮEџџL}…эdБЏџД­ƒЮЂџЖgѕCT^Z8Cбg'aЄK==>=>>K>>>A@@K=>@L@@@AA@@>LBAABPCCCACEFWm\^>#>FJQeЖџџЩ€6џГ’џџе;6L‰ўџџџџXџЃ™џ2NP_4RzД[^_>СМСi­z!јџ4„6{ОџџџХџšй6XIџџ‰џџџAU\i_`C>BBFC==<#H@A@5F5JAF@3;@A@38C>3>=8=6*;/@5;6C=B8B866B65556F66C@652553634@48448@@5846*53/<@/8%B82=38==;<@00240<45652@0>3=;;;82;=-2;3338<<62/>/8<<5;;)68!24&;=AAEJLRVVUURTTXVWUUWVVUUVTUUUVTUVVTUUVVVVWVVWTWVWWHWWVXPџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџo{€€}{}}}}{{|}Š‰||{||}|}||zzz{zyrkigged`^VAK5IH8HH88IFFFHFEFFCCEECEE4CEFEF5EFFEC4EEE5EEFEEE5CC4EEECC4C4ECCBCCBBBEB3BABCBCBBAAB3BBBACBBAAA2BBAAAB2AAABAAA@0A2AAA0A@@@AA0@0@0@0@0@@A@@0>>000>>>/>///>--=='<*<*;8&445558>CIXXI2XN2_џLџ”{UJmВЛWџџoPPte‡L^@ejgKiЉxAˆBWџ‡СC`^HV^џо&Jh[XaWTUUIELЉо!EˆcTŽџ/p™=URR6ЅџQ@`K\EP><=<<@>@mWANR<8888666;I;=;;>K<=66=<;>ABB83@BW>%лAќџFQx)ЄIЩ|џqЄ˜ГiхŠBыgU_mIAЈN%0J>8<<<8;8655655;;;<88<<<688<=<<<888<<=;K@EaFA4!BFFCFJLPQVUUUVVVWWVVVVRT`UUTRTUUUVVUUTVVXVXZVWUVUXXUVVWVJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџћnxƒ€}}|||}}||{|}|}‰‚||z{{}|{}|zzyz{xrqnonheda^WTPPPPPPQRPPPPNPPPPLNLPKPNNNNPPPPPPPNZNKPPPPPPPPPPPNLPNPLNPNZPPNLNPLNLLNLWKLNLXNNKKKJWKKJJKLKLKKKKKKKJKKKKJJJJJIUJKKIJJJJIIIJJITIIIZTHIHIHHHHFHRFFFHFEEEECECECBCBBAAL>@>K>@BBCJIF'jf@/яШ8qgEgUЁ3vЃJQX\^IXWIJXXXJ\N@cc>-‹eeBVWHJ3yv=UUXTRUUQRQC83Œ8EW^RpџJ=[HRRRAH‚-PHB#@%%4!!4!368Q;!65420200#0232533443!454204224%62!2=BHK%c˜8;6X>K2‡-VPmRPA*cJPPXE2C*'#>;;5458632/0I%326<8;3224*&64z&<#4/235CUj844230%5hcPШ=PFFUIJNPNPQTUTRTVTUWTUTUTRURVTRRTTUVWTTTVUVWVkUTVUVXUUUVURX&џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџћfq€€|||}{|{|{ˆ|€€}|}}z|}|||z{yxz{{xssr|{ymfda^^ZZcXWVXXXcaVVVWaaVVV`UVVUV`VVV`UVVV_RRUUVaWVU`VVV`_UVeUTUUTUU_TdTdT^QQRRRQ^RRRR^QQ\QaPPQQPQcR\QQQPPPPPQ\PPZZNPNNPPPPPNNZNZNNNXLNLLNLLXXNKLKLKKKKVKJ[IUIIIFHIFRHFEHECBCVCABBACFF8ckZ3‹5o@TvJZILPBURWURVVUVTRQPTQQRUf…IIXLUTRRQPCKZVTTRPPQPNNLPQERTRRRIEd^ARQPPPRTVPLF><;453234224!4433223/0///000022200222322034224435653<@FJLP;X<@PPNRFI6W=ANLIIB><;54332200220/)*-20////#20/--/24;620#6&20/00023}W&24232%%xRKў&4K2N8HW8IHIILmF'R@JEE;Ih*CV2Л)6TTFTB<5c/C5Pa34K@ANNP3r|P<;==>>@@AABANBABABABCBBNCCBBCBBABBAABBCAABBBPCACPCBAANBBBBNBABBAL@AAA@@@AAA@A@>@LB@@@@@@A@@A@A@AA@L>@ALA@K>@K>@BA@@LAABABABBBBATBBBBA@A@@@@A@@AAAAL@<@AAA@@@A@AA@@BA>@@@@<@AFIIILL[\NLPQQTTUUUVURVUVURRRRUTR_RTVUUURRRUWUWUUUUVVaRUTVRUXџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџњex|||}||{}||z||ˆ|z{|}||{{z{zzzzxz|{ystsrqqnkhed`^[\\ZZ\\Z[XWWXXZXZXWXXZWZXXWZXVWmWWUWVTVWXWWWZWVUXVVVVVVUVUUUTVTTTURRRQRRURTTTRRPRQQRRTQRPQRRRQQPPPPPPQPQPPNPPPPNPNPPPPNPPNNNLNKNNKLNLNLKLKLKKJKKKJIIKJIIIHHHHFHFJHFCEFCECCBCFFHPVc[aUed`\WVWZ[^oFRQPPQTRQPP\PPNNNQiQPPNNNLNNKLKLNLPLLNLLKKKKLKLKPPPNPPNLKLJKNZKLHCA>;;8664455565545554644555455444444454544365656566;86;=ACFIZLNNLNLJNNPQLKLKLKNIWIHFC@=;54320-//-0-/*-***--***//--/*))-00////-/-//022!>z>303200!РNFў'LIIJK5A3HFFHJIHIIHHIIIIJJKJIJKLLLPQPQQQQT8cJ/VQPNPPI^%>E6LIC><<86K44443443444323333446553444445585545534433222233346;F;>EHJLLNPNLKKLLCLC6LNPPBAKKJLKJPQRPPP;E6LLKLKKNQQNNPPN>dPKKLNLNQR8RaQLPQUJ3dXL\ZVV_TQLNICA@@>>@ABBBCFECBEFECECEFFFEEEFEECQECEECBEECQEEFECECFEFEBCEECCBECFCBBCBEECCBBBCCPEABECBPCCBCBCBBACECBCBABPCCCAABCBBPECCECEBECEBEFBECCCEECAECBCABBBPFECCBBABCABBBBBACECQCCBEBCCCCEHJJJ_PQ\NNPNQ`TUVTVUUUTTVTUTTTRRTRTV|RTRQTURVUTTVVVTTRVVUTXW!џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџћdw|Ž}{}|}{|||z}||{z|z{zzzz||}z||{zyzzz{zzzzŠzyvsrpoomnkhca_^^^^`_^[\^\\[\[Z\\[[\\^Z[\[[[ZZZZZXZZXX[ZZ[\\ZWWXZZZXXWVXWWXWXUVUUTVVWVUVTWVVTUVUTTVTUTTVTTTTVTQRTRUTVTRRRTRQRTQQQRPRQPRPPQPPPRQPNRPPPNPPLNNLLLLLKIKLLKKKJJJJIIIIJIIJIIFFFFFHHKNTUZ[^rvWUTTVXXzCPLKL>Q>LNLKKJKLIIKIIIIEFIFIHEHFFFHFHFHHHJJIIIKJJKIJIIFFEFIJIHHEB@@A><;<<<;8<8;;;;;;;<=<;<=;;;;;;;;;8;;;;8;;;;<;<;;;<<;<=>CCCEHJJJIHIKHIKJIHHIFIFHFEBB@<;542/02E-*---'**')*)))*)'***')&))****/*---/03P%LџTXџe4KIIFFFI8;2IFEEEFFEFEBCEFHFEEEEBEEEIIECEHHFHHJJJKPNPNPPRRPPLKLLPPPLKKJHCA>>=;8I8866646856664668;88<8<;8;8888;;<866658866668688888;<>@BEFHHHHHIIIIIKNP3KIJJIHJHFHIHIHJJKJJIIKJIJIIIIKLIIILIJIIJIHVJIJPLLQPKKNPTRCRC_TUPNNPKJHICBBBABCBCEEFEEFEEEEEEEFFFEIFFFCFEFFEEECEFFEFEFFHFHHFEFEFBFFCEECEEEECEFHFCFCBBBCFCBCBEEBFCEECBCECACBEEBCCEBBEEECCABEEEEEFIHCEFCEEEEECFFEECFFECECEEEFEEFEECCBCBEEFCECCBEFFCEECECEFEHJJLPPPLKKPNP`WTTVTUTRTUTTVTTRRURRTUUUURAQUTTUVTTUTRTRUUVUWX!џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџњV‚}|}}}}{{|{z{|{{|{|{zzz{{{{||zzzzz{{xz|z|zxvrponrssjeeca`ccaca``aaca_`aaa`_^``a__a``a^_^^\^_^_`^____^^_^^^\\^\\\[^^[[\[[\Z[XZXWZX[Z[[Z[[XXXXZXXXXWWXZZWXXWXXWXWXWWVXVVVWVVVWVVTTTUUVTUVVUUUUTRTUTRRRRPQQQPNQPNPPPPPNPLLLPPNLLJJJKLKIIJKLPPP@UWETQQRQBRNJJNIKk@@@>@@@@@@>>>>A@A>@@@@>>@>>@=>=@>>>=@>>AA@>>>=><>>@>BBCCEHIFFHVHHIFHFFEHFEEB@B@=<86432/0/-***-*))*%&&'')'%)-'''''&'*'')''*--05v84520////0'џQHЄ;6IфXЊџq&NIFFEFCBBAA@@@CBBABBAABBABBAB@A>BBACCBABCFHHFHIIKKLKKJLKLKHKIIKIIFECECBAB>==<>@<=;><=<>=<<=<@>====<>>>=;=>;;<=>>==>>@ABBCEEEECEECFEFHFFFECEEHCEFFFHFHHFIEFIHIFEFTFIHHFFFFCFFEEFEHFFIKJLJIIJLP\PKLNPLKIJIFFEFEEEEECCEFHFFHFHIIIFIFHIJFIHJFIIHIIIHFIIFHIHIHHIIHJHIFFIHHHHFHIEFHFFHFHHFHFFEFEFIEECFHFFFHFFFFFFCEEEFEFECEFFFHHFFHEEHEHHHIJJIHHHIHJFHHFHHFHHFFFIIHHEFFIFEIFFCFEFFIHHFFHFFHFEFHFEIHIJJKNNNKKJLNPP`VTTUTVQTRVTUTTQPRTQRRRVRUTTUUTUTTTVVURTTWUUVcX5џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџњU€}‰}|}}}}{|zzy{}z{|}|zzz{zz{|zzzz{zzzzzzz}||{ytqponrtvqojihgfhhghhhfhfihfffegeehffdffdfgfdffccoddefededfedddeca`cd`dcna``aacaaa`^_`a`_^__^___^^`^_^^^^\^_^__^^^_\^[^^^^\[Z^[[\[[\\X[[ZZZXX[ZZZXXX[W[ZXWXWXUVVWVUWWUUTTTTUURRRTTRRPPNPQPNLKLKKLLNPRAQPNPNLJJJIJXLPKIKJJKJKWJKLNKIHHFHHFIJKJFIIHHIIIFIIIJHJIIHIHIFFFIFJJHHFEFFFECBBCCCCCCCCECCCCCCCBCECECCEEEBBBCACBBBACBBCBBBBCCBABCCABBCBEEEFEFKHEHFEEEB3CCAAAAC@>=8630-----*)-''))))&''''&'''&''&)'')*A))***/0X4000*0*//36ўNVvH5E[Vџ36NIHCFEAA@=@>>@CAABAAA>>>=>>=@=>@>@>@@>@BBEFFEFFIIIIHFEEEHHFEEFECCCBACBABBA@AA>AA>@>A>>>B@@>@>>>AAABBCABBA@@ABA@>AB@A>B>AAAAA@AAAA@AAABBCCCBCECBEEFFFHEFHEHCHCEFEEFCEEEEECFFCIFEFHCEFFCBEBBCCBEECBBEFI8fIHHJPNNLJHII6HFFEEEHFFHFHHHIIIJJJJJJKLLJKJKJKJJJLJLLKKJJLLKJJLLJJIJKJLJNLKJKJJKKKKKKHJKKLJKJJKIJJHJIKIJKJIJKJJJIJHHKJHIIJJJIIHHIJJJJJIKJIJJKJJLKKJKJJKIJJKJKJIILKWKKKJJJJJKKJJKIJIIKJKJKJIIJJJKIIJFHKIJJLPPPNKKKNLPNTVRTVReTRTUCTTRTPTTTTRTT`TTTVTRUTTUVVURRTVaTTVXџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџњW€€}z}}|{z{zz{{{||zz{zzwz{{zzzy{{{zzzzzŠ|{yxwvsnorwwtpnnnmnnmkmoom}nmmjkmmkkmmkjjhjjijiihghiihjvmkhjjijihhhifghggghfgeeecgfgedeeqfdddffeeddcdcdeccacdddcddd`dccccaccm`a``a```a^^^^^``^_^`_^^^_^_\^_^^\^[\Z\[[\[[\Z\\[ZXZZZXWXXWTTTR_TRPPNLNLPPPPPPPPPPLLNKKKLNLKLKLKKKLNJLNNNKKJKJJIKNKJJWKKNXJKIKLJKJJKJIJKJJIHJJKJIIHIJJIIHIHHFHEHIHIIFHIHEHIHHHIIFHIIIFHFEFFEFEFFFFHFEEFFFFFFFFCEFHFEJJHFKJHHIFFFEFFFCCECBABA><6532-/--*/-)))'*'''&'&)')''''*'-)'*-*))-*'-0-/0-=--/224ŒVQ^RIEFK6#^*=IFFCCBBCB@@@>BP@@BA@A>>>>A@@AA@A>>A>BAABCEFHFFEFFFHHHEFFIFEFEHECCCCCBCCCCBCBCCCACBABBACECBCEBCACFEEFFCCECBFFCFCBCECEBQCBEBCCEBBECECCQCEXEFBFEFHFFIIHEFHEHFFFEBRFFECEFEEECHEFTHECEEFEFCCCBCFBEFEEEFFHHH^I5IJPNNLKHIIEFHIIIFHIIJKKKPLPNPPPPNNPPPPPQPNPPPeNNNPPPPPPNPPNPNPPNLNPPPPQPPPNPNNPQPNPNPPPPPLPNNLLNNNLLNNLPNNPNNNPLLNLKNLNLNNLNZNNL`NNKNLNPLPLPPPPPLZNP[NP[NPLPPPPLPPPPPNPNLLLNZKKPPPPPPPNNLLLLPPLKLLLLNNNRQQPPLPPPNNTWVTTTRQPQRR_TUTRRTQRTTTUVRRTQQTTTTUTTUUUUUVUVZ!џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџњWv€{|}|}}}}{{|zz||z{m{|zyz…{zyyz{{zzyzzzzzzxsqtsroqtwtsrrrqqrqrqspop{qqoppooqppopoo}nkmmjkmkmkmkookknmnmmkmmmmjjkmmjjiiisijihihggiiihitjhghggfggggffdfehhgeedeefffedefdddddddedadcacddcdad``a`aa``a_`a``^_^^^^^_^_^i_\^^^^Z[^\\\XWVUVURRPPPNLPPPNRQQNPPNLNNNPLNNLNPPNNNPNNNNPLLLJKLJJLNKJKNNJN_LLKKKKKKNLKWKKILKJKJJKJJJJJKKJJIIIIJIIJJKJIIIIIIJJIKKKJJIJIIJJFIHHFIIIHIJHHHIHHJIIIIHIHIHIJIVJJKKJIIIJFFIHFIEEECECB@<8643//--*-**))*)))**))*)**)*))-'**0-*-/**--*--*)-*020!#o\^f`KHEII5;8FFEFBCCCEBC@ABBBBCBABB@ABAAABABBPAAAABAECECIHHHFFIIIIIFIFIFHFHHFHFFFHEEFRFHFEFFFEFEEFECFFFHFHFEFEFFEHHIHHHIIFFHHFFHFHFFIFFFFFFEEHEFIHFFHHHHHHHFFFHHIHFFHII[HIFEIHFFIFFHHIHHFFIFFFHHIFFIFFHHIEFFIHHFIHHIJHKK[[NNNLIIHIHIIJKKKNNPPP^RQTPQUTPRRTTURRRTRTTTRTRTRRRTTR^QPQTTTT^QPTTRTTUPTPRRRQQRRPQPQRQRPRTPRP^QPQQPQQTRRQT^PPPPPQQQPPRQRPRRQPRRTRRRPPQRQPRRTQRQPPRRQ^QP^TQRQRRRRPRQQQQQPPPPPQQPRQPQQRRQQPPQQQPPPPPPPQRQPPNPNTRNNTcWUVQU_TRRRTRQQRRQTTVRRRUQTTRTTRRTRQTTUVUUTUUJ/џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџњ^rˆ|{}}}{|||}|{{}}{{|{zzzzyz{zzzyw{zzyzzyzzxxwsonppqqsvwtrttqrttsvtssqsrqrrqqsrr|prqpqoopomnknnomoononoonpkpooknmonnmmkkkjjjjjjkjihhjijikjkhgjhhshhighfghhhhggfgghhgfgeeedgfefffeefffdepdedddcdcccccac`acc^__`a__a_``a^_____^^^_\\[XWVUVTRRPPPNPQPQPPPQPPPNNPLNNNNPPPPPPNPPNNNPPLLLLNKLLNLKKLNKNNLKJKLJKKJKJJNLJKK^LLKKNKIKKNPLKKLKKJKKKLJJILKKIJLKKLNKLJJKIJJHIJIJIJIIJIJIJJJIIIIJIIKJJIJIKJIJKKKJJIJJHHHHIIHHFFFEFC@<85430/--/-*)))**)*))*)****))*/-*//-*-/**-**----*/0033#e[[ZTKJFJFFFEFFHIFEEFHHECBCCABCCCECBACBABBABBBBABBCCEHEFHIIIFIHJHIJHHHIFHIHIIIIHHIIFHFIHHFHFIFHFFEEEHFIHIHEHHFFIIFHIIJIJJKIIIFHJFHHIFIIIHHIHIIIIIIJIJIIJIHJHIIFHFIIHIJIJJJIHUHIHIIHFHHIFIHJHFHJIIFHHIIHJJHIIIIHIIJIKJLL[PPLJKNJKKJIJKKLNPPRRUTTVT`TUR`TTUTUVTUVUaVVVVWUUVUWaWUUTUTTVUTVVUVWWUWUVVTTTVTUVRVTVVTTRTRTTURRRRRQR_`RTUURTRTTQTRTRTTRTTQTTRRTRRRTQQQTPU_RT_QRRQRRRRRRPRRTTTTTRRQURRRRTQQRQQQRRQRRRRRQQRQ_R^QQQQRPPTQPPQPPNRkWPPQd[WRQTTTTRRRTRT_TU_RVTTRRTRURUTTTUTRRRTTUVWVTW'џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџљim}|{|}||{}}||||{}||z{{}{{zyzyzz{zyyzyzzzzzzwvvto`koostvvr‡tstwtttvtvvwtrrststtsrsqprppopooknzoooqooqponpoqnonkonpnnnmnmknkkjjjmnijjjhijkijmkkjhhhhhghhiivjhghXgfgihfhggfefgfhffegdffdefeezddcdfedfccda`_ca`_aaacm`aaa___`_a__`_^^[[[ZVUUTRQPPPPQPPQQTTPPPPPPNNNPPPQPNPPPPPPPPLNLNLNLLNLNNKLNNNLPKKKKLLNLJKLLKNKJLLLLLLLNKKKLPNNNKKKKLJLJJKLKKKKJKJKKKNKKKJJJJKIKIJJIIJJHJJJKKKIIIIIKJIIJIJKJKKNLLKKJJIIIJFHJHIHHEEFFB>;653200///***----)****-**---*-/--/**-----)-/**/200204/_cWWPIJIIFECEHEHFFEFIHFEE@ABBCCFECCBBCBBBBCBCBCBCECFEIHHHHIIHJIJIIIIIIHHIIIHIIIIIIHFHFIIJFHIIFHFIFFFIIIHIIHHHHHIHHJIHIJJJIIJVJIIHHUHJHIIFIHIIJJHHIIIIIIKHIIIIJHIIIIJKJIIIHHJIHHIIIIIJFIFIJIHJIIIIHIJHIJJKJHIIIJKHJJJILNPPLJJJNLK^KKJKLNNPPRUUVTVVWVVVVWWWVUVWWVXWVVTWUXVUVUXVVWaUWTUWWWVTVVVWWVVVUVWUVWVUVVTVVUTURUURTURRRRRUTTWXXUVTUfRTVVVTUTVURTURRTURTRTTTURVUTTURUUUUVRUVRTRUUTT`QTQTUTTTRRTQQQQQTTQRUR_RRRTTTTRRRQTRPRRTRQPPPPXkZQ@QZ^ZRTRUTQQQRTUT_QTRQTTRTTTTRTRUTVQ_TTRUUVUTVTV'џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџљfr}{{{}}|{{ˆ|||{{{|}z{{{{|zz|{hz|zzxˆzwxwzzzzzwwwvqppqtvxttsstssxxttwvvwxtsstttsvssrqqqpnpppzopopqopnqpqnoooppqonoopnppnmjkmjmjjmnkkjjiijhwkjkkkmijjghjjhhjkmhhhihihjhhghggfhffffgffffhedeeedefdfeeeeecdecaa`caaaacaaacaa`aa`a```_^^^\\WVVVTRQQRQQPPPQQVVTPPQPPPPPRPNPPPPPNNNNLPNPNPLKLNNLLLKKKKPLLKLNLLNKNJLLKLKJLLLLLNNLLNLKNLNLLKJKKKKKLKLKNLLKLKLKLLLIKLKKKJKJJIKJJJJIJKJJJJJJJIJIJKJKKIJKJJJJKJJKKKIIIIHIHIIHHHHFECA>;6432/-/0-/*)-**-**--)*-*)---*-0/**---*------220/--2-^VUfP8FIEHIIFHEFIIEIFFHHFA@BBBBEEBBBCCEBBCBFQCBBBEHHFIHHKKIIIIIIJIJIIHIIIIIIJJIIIFIFFFIKIHIHIFHFHHZIFFIIJIFHFHHIIFHFHHIIIHJJKJIIIIHIIIKJIFJHIIJIJJJKIHJJIIIIIHIIIIJIKIIIJHIHIHJHJJIHIIJHHFHIJKIIIIIIJJIIJHVJJJIIJJJIJJLLZKKKLKLPLKKJKNPPPRUTUVVWUXXWcUVWWWZXVXZXXWUWVVWWVWUVVWVVVUWTUXVUUVVWUXVXUVXWXTWVVVVTVVVVVUUaUUTTUTTUVWXX”IVVVTVUUUTaUVUTUURTUVVURTUUUVTTURUVURTVWVRUUTTTTTTTVTUTTTVUTTUQTRTQQRRTTTUTTVTRTQRRRTQPRRPQRRRRPPNQVffVNQrgXTTP^RPRQRRVRRRQRT_QTQUTTC_QRUVTRTTTTTTUTVRW-џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџїe}}|zz|}|}{||{|||||{|z…z}zx{„xz{zxwzyiyxvzyxzxwwvxvvsvtxwtttvxv‚xttvwvxxvttvvtsrtssqqqqqqqqprqqpprqqrsrqrrprqpqnnopopmonnmkmmjmnnjikkjjkiiknmjjikhtjimkhhjjkjiiihjiihggfggfihighffegghhffhfggeffggffcdddacccc`cddcccdaca`acaa```__^[ZXXXWURTRRTRQQQQUXVTQQRPPNPNQRPQPNPPPNPLNNLPPNPLPNPPLLKLNLNNLLvKLLLNLNKKLLNLLLKLLNLLLNNNLNLLJKLKJLLKKJNKLLKJNLLLKNKJJKLKLKKKKJKJKKKJJKJLLJJKKJKIJKKJJKKKKKKKKKJJLJKKJJIJJIJIHHIIHHBA>8543/0/---***)-*-*-*---)*//**////-***--H----/200--2-X_ViPFFFEFIIFHEFHHFHIFEFCC=@ABBCFCCBCCCEEBBFCCAECFHJJHFHJIIJJJKKIJHJIIHHHIJJJIIIIFIIIIJIIHIFHHIHIFFFIIJKJHHIJHHHIHHJHHJHHHHIJHJJJJIIIKKIIHIHIKKJKKKJJKKKJKIJHKIJIJKKJKJJJJJIIHIJIIJIHIHIHJJIWJIJHIIHHJHJIIWJKJIKKJLJJJLNNJKKKKKLKLKJKKPPPU`VVcWWWWWXXWZWVXWXVWXXXXWZXWXXXUXXVVWVVWVVVUUVWXWVVWVXWVXWdWUXVWWWVVWWUUTVTTUVUVUUVWX\[VXWVUUUWUUWVUVUVVVRTUTWUVWVUWWVTVaUVVVWUUUWUT`TVURUURUUTVUVTWUTRTRUR_RUUVVVWVUUTVUTVVRQRURURRURRQPQU\fWA>XfZVRPRQQQQTRTVUTQTURRQBePT`RQTRU`TURUTQRRUUTW6џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџє_q{{}}‡||}z‡{{}}{{{z|}y{z|{zyz{zy{zyyxyyxwxxzyvyywz‚zyzttwxxvwxxwyxxwxwvwwywvsvwvtsrsvsrssrsrssspqqoqpqprsrq|rqrqqpqorpqonoqonjmmmnomjmjjjnnjnkkjjjjgijkkmmjjkhiihiijihghhghhhihiihhhhgeggggggfgedefffeedcddcdacadccdddcceac```a`a`ca_\Z\[XXVTUTTRRRQPRUhWRRTRPPPQQQPPPPPPPPP[NPNPNPPPPPNPNKNPNNNLPNLPKNNLKLPLLLPLNLNNLPNPLLNNNLLLKKLKNKKKLLKLJNKLKNLKLLLLLKLKJNKKKKLLJKLKLKJJLKKKJKHKLJJJJJKKKKKKLKLKLKLJJJJIIIIJIHJKKFFEB@=66330///---/-*-*----/0*-///--///*/**)*----*-/0//-3=^TUfPIHHFEFIFFFHHFHFHHHEFE>>BCCFFECCCCBFCBEHECBEFFIJIIUIIHJHJJKJJIJJJIJIJJIIJHJJJIIHIIKJJHHHIJHIIHHIIJJJIIIJIJHHHIIKIIHHIHIIIJIJKIIJILJIJJIJJKJKLLKKKJKIJJKKJJJLLLLJKJLKLKJIJJIIKKKHKIHIJHIIIJJJKIJJIKJJJJWJKKIKILK^JKLLLLKLLKKNLNKLLLPPQTUUVWXXXWWXXX[ZXXXXXWZXZZXX[X[WXVWWXXVWWVWZWWWWVXZXWWZXXXWWXVWXWcUVUWUVUWXVVUUVTUVVVWWWVUXWVUWVWVUWWVUWXXWTWUUWXUUaVWUVVUWVWVVVWWTaUVTVWTTUVVVRUaWWWTWTTRUVVRTVVWTVVVVVVWTTUVURUTURQTTPPPQQUd[TQPUZXTPQTTTQRTTTTTRRRTPRRTRQTTTTUVUTRTTURRURTTUI3џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџђ^{||z|}{}{{||}}zyz}‡zzzyz{zxzzzz{zzxvxywwyyyxvtwzzx™zsf€txvyxwwwvywwttvtwwvsvvttssvtstrqqssstrrrqropsqsrrrrponqqnppropooppmnnnmmnkmxmjknnnnmkjjjigihjknkkjjjkvjihhjiiggijhhggjhghhhhefgfgfgeeeefdefdddecedaacededfedcedcna``a`_ac`^^^^[XVXUTRTTTRRQQTVVUfRRQQPPPPQQQPPQPPLPNLPPPQPQTTQLNLNPLNNNLKPNNNNNNNLNLNNLLNLNNLPNPNPNNKLPNJJLKLPKLLLNNLKLKNKJNNLLLLLKKKLK^KKKLJKKKLJLLKKJIKJJKKKKKKJJKKJKNKKKJJLKLKJKJKKIIIIJIHHEEB>;54220-////--*)--------0--00/-///*-**--000/-//-*-3-^TUeLIFHIHFHHEHFIIIFFIIFEEB/AEEFEECECBCEEEEFCCCFFFIJJJHIIJIHJJJJJJKJJIIJJJIJJHIKKKJJIIKJIJIKHIHIHHIIJIJJJKIKIIHJIIHIIIFHIIJIJJJKIJJKIJKJLKJKJJLJLLJKKJIKKJJJJJKLKKKKWJLNLLJIIJJKJJJHJKJHHJIKIIKKJIJKJKIIJJJJKJJKKLILJKLLKNKLLNNJLLNPLNPP_UVVWXXXWZZZZZZVXZ[eXZXZ[ZZX[VX[WWVXWWWWXZXXZWXWWWXXXVVXXXXZdWVJZWUUXXWWXXXVTUTWVWTVWWVVVUVVWVWXWVUWVXXXXXWWVVVWVWVVTVVTUUUUUWWWVUUVWXVWVWWVUTTUUUUUVUUWVWVUWWWUVWVWXWUUUVTRTUUUQQRRRTRRPPQQTWWUTPRcXQQTQRTQTTRTTURRRTTQRRTTQQRRQUTVTTR_TUTUTTUV*џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџёZ}}{{z|z||{|}}|{zz|{z{zz|{zzzz{zz„zyyzxvvzxxyvxwxzyzxtt„vtyyzzxwvwvvwvwxvsttrstsrsrsttsssrstsrssqsppqsr|qr|rpmoqoqqpooonnonnnnmoonjmnmynommjkjigkkjijmkmjjjijjiiijiijhhhiijhghihhhhhhgfggffegfdegffeeddddccddedededacecacaca`r`cca^^\\[ZXVWUTTRUQPQPT`UTTTRPQQQPPPRQPNPPNLPPNNPNPPRTRRLNNNPPNLLLLNPPPLNNLNLLPPPKLLNLNNLLNNPNLNKLNLKNLNNKNKLLLXLLKKKKJLLKLLKKKLLIKKJLKJKKNKNJLLLKJJJLKKKJJKLKILKXKKKKKKLLKJJKJJJJJJJJIFHFEA=65320/2/0---/-***)///--//0////0/*-*---0//-0----*2>`QRTLFFIFEEFHFHHJJIIIJJHHHFAFHFEFFECCBEFCEFFCEFHFHJIIIJHJKIIJHIJJIIIJJHIIJJJLKJJJIJIIJJJIJJJJIIHJIIHJHJIIIJJIVJIIIJIIHIIIIJIJJJIKJIKJJJLKIJJKLKJJKLKKJJJKJVHJJKKLKKLJJLJJKIKIIJJJKIKIJKIHJJJIJJJKJJLJKJIJJKKJIHIKKJKKNKLKKLKNNLLLZNNLNPPTTVWZVX[XZ\ZZZZXXZW\XWZX[[[ZXWZZVVVVcXWWXWZUXWXXXW[[XWVXXZW[WJЃWXXVWZZVWWVXUUWWVVVTTVVVUVUaWUVXXUVWUWVWXXVVXWUUWUVUaVWUWVVWUXWUVVWWUVWUVWXWXUTVVaUTVVUTVUUVWVWVUVWTVVUUVTTTRUTT^5RQTeTRPPPPTUWVWUPQaVPNPRQPQQTTURURTURQQRTRRRPQRT`UVTRRTRTUURUUV=џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџёc}}}{}|||}|}||}zzzyz{zz{z{{{yzzzzyz{yyzzxwx‚xvtwy‚xwxwssvvxxxywvwtwvvvtttttttqtvvtsrsststsqrpstrporqppqqrqpp|oqoooqpqnpnnnnmonpnnkmmmjkknnnjkkkmijikjimjjjjjiijihhigighhhigjiiiihggghfhfggeehedefegfgeedadddcceddcddaacdccaa`__`a_``^_^^[ZXVVURRRRQRRQQTVRTRTQPPRPPQRQPPPQPNPNPLPNPRNPQPNNNPNNLKKLLLPPNNNPLLLNNNLNKLPKKLKNLNNNKKNNLKLNNNKKKKLKKLKNKKLKLKNNKNNLLKLJJJKKKKJKLKKKKJKKKJKLKLJJJJJJJKJKKKKXKJKJIJJJLJIIJJIIIHHHEB>=6532/0////---/**--/0/---0/00///---/-/0/-/--00--3@^QQ^L6EIHEEHHIHHHIHFIJIHIHTXFFFEFFCFCCCHECEFFFHFFIIJJJIIIJJIIIHIIJIIKJJIIIHLKJKJJJKJIJIHJIJKJIHIIIIIJHILKKJIJLJKIHIHIIJIJIIIIJKJIKIJJJJKLKIKKIJKJJKJJJJJIJJIHIKKLKJJLJKKIIIJIJJKLJIKJIHIIJJJKJJJJILKJKJKKJJJIJIKJJKKKKJLKKLKKLLNLKNNPPPPUVWZXXZX[[[XZZXXVXZZZZWXXZX[Z[WWZZXVTVZWWWcWVZVXXVZXWXZXXXVZVWWXWZVXWXXXWUVVTVVUVVUUWVTUWVTVVTVXVUXVXVVXVVVVVUTUVUVVUTWWVUVVUWVWUVVWVRVUVVWXTUVWUTVTUTTVWUVVUUVVVTURTRTRTQPUURTR4kTURPPTPPNQPRWURQRfUNLLRRNPRQRTTRQQRQRTRURQ@QTRRU`URPUT`TRTRTUW2џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџёe€}}}|||{{z}}||z|zzyz||{{zzz{yyzzwxxzzz{zyxyzwwvwvxxssrqpwxtxwvvtwtvtttsttttvssvttsrrstrtsrqrstspqprqpqrqsppprponpomppoononnnomnonmkkjkmkmjjjmijwjkiimmijiikiiiihghhhfghihhhihhghggieggfdffhffdfeefeefeddeefdaadccdaaacdadc`aa^``_`^^^^^Z[XWVTUURQQRRRRQUQRRRRPQRQNPQPPPPPNPNPPPPPPQNPPPLNPPLNNLNNNPNLLLLLNLKLKNLKLNKNNLLNNLLNNNLLKLLNPNNLKKNKLNNNLLLLNNLLLLNKNJLKKKLKLKLLLLKJKJKJKLJJKKKKKJKKJJKKKKKKKJKIIJKJKJJHKJJIIIHFHC@@;65202/0///C-*---*-/*-*--0/20000////-000/-/-/*0#BZQQR[JHIIHEIEFFFHEHFUIIHHHF4FEECECEECC\HECCFIHFHIIHIJKKIIJJIIIHIIIIJJIHJIHIHKIJJKJIIJIIJHIIIJIIIIJIJIIJJJJJJIJJKIIIJJIJIIHIIIJLKKVIJJJJLNNJJLJJKKJKLKJKKIKKJKJJJKJLJKJKLJIIJIIIKJIJIJHIHHIHJKJJIKHJKKKIKJJJIHKJJJJKLLKJLLLKLJKZPKNKLPQPPRTUWXXZWXXXXXVWWXXVZX[XZXWZZ\XWVZXXVUVWXWVVVX[ZnXZWWZVVXXXXXZWVXZVWWVWXVUVXTUUVVUUUUVVVXWUWTWTWUWWXVUUVWWUVUWUVUVVVWUTUTVTUUVVVVVWWUUVVUTTWWUURTTUVVUUTWUUUVTTUWWTURTVVTRRRTPTU^AQRTRRRTPNPQQTVVRNPUTQLPQPN^RQTUUU_RRR_VVURQ;fPQTRQRRQRTVTTUTUUWOџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџёdsˆ{{{zm{|}}{{{{zz}{zzz{zzzzxzyxxxzzyzzzxxyywvvvtqqpqsxwtvvxxstvsttstsvrsvwtssrrrstsqssttrqqppsqrrprrrqoopppmnnnonnnnjynmknkimkmkknkijhjjikmjhhijkhifiiijhifhhgihgfighijhfgegggeggfhfdgfgfggfeefededpcdacdcceccaac``a``aa_`a`^^^[[[\WXXUTRRQQQPRURRRRQQPQPRQPQPPPPPQPPPPNPPPRTRNNNPPNPNNLNLLNNNLNNLLNNLLNNNKLKLNNZLNNLLLNLLNKNLNNKLNKLLLLPLNNLNNLNLLLNNKKKJLKKKLKKLNNNLKJJJJJIJJLJJKKKLKJJKJKLLKJKJIJIJJIHIJIJIIJIFIFFCA=<632@00----*-*----*-///--////-0/0022022///-///&Z\QRRPNJHFIEHFCEEHEEHIIIFFBREFFFEBCEEBCFEEBCCHIHIJHJJJJLIIJJIIHHIJHJIIHIJIJIIJKIKIIIIHIIHHHHHIIJIIIIIHIIJJJIHIKIKIJJIIJIJJIHJIHJIJHJJJKJKNPIKKKKKLJKKJIJKIKJIJJKKILKJKIJKKJIHIHIIIIIKJIJIIHKJIIJKJIIJJJJVIIIKJLJKLJKKKLKLLKLNLNPLNLNNNPPQTTUUVWWWWWWXWXWWWZXZ[ZXXX[[XXXWWmXVWWVVWVWWXXXZXWWVVWVXWXWXVWVVWdXWWXWXdWWXVWUWUUTVVVUXWUTUgTUTVVUVUVVTVXUTWWVUUUURTRRVWWVWWUVWVVUUUVUVWWWTVUTRUTWVVVVUVU`UUTTUUUWTUTQVT`TTTTRVTRRQTRTTTRQPQTTVURPQTRRP^QPQQQRTVRQUTTRTTfRRP@^TTRRQQQRQRRRVTUTTIDџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџя_s{}}}}}}z{}|{{|z{z{ˆŒ{zzyzzx{zyzzzzyyzzzzwyzzzvvvvsprqpswxvxwvwwtwtwttvvsrrvtwsrsqsqsrtttrrtsrrdrrrqrrrqrpooomnpnnooonnopymmmmxkjikjkjikmmkikjkmmkhggijjhjihiiijjghhhghgihhhihgygehfggghgfgfddfegcfeeeefdccdddaccceaacdcc`a`_a```aa^^\^[Z[XVUUTRTRRQRTRRPTRQQQPQQQPRPPPQPQNPNN\PPPRcLLLPPPNPNNLNPLNNNNNNNLLLNLNPKLNLKNLLLKKNLLLNLKNKPNNNKLPLLLNNLNLNLLPNNKLKLKLLLLLKKLKKLLNLJ{JKKJJKKKKJKIIKJJJIKIIJLJLLIKIJIJIIIHJIIFHFIEFFCA=<4220/-/00//-*/--/*/-----*---/*--0/02@0>///00r^NL[JIIHI[HIFECFIEEFIHKHFCFFHHFEECBFECBCCCCBHIJIKILKJJJJHIJIHUHJJHJIJIIHIHHIIJIJIIIIJJIHHHHHJHKJIIIHIIJKKIJHJIJKIJJJIIHIHJJIJJJIKIJKIIJNsPJJKLKLKLKKKKJJJJIIIIJLKKJKIJIKIIIHKIJJJJKIJIIHHHIIHIJJIIIIJHIJIIKKLKKJIIKLKKNLKNLKKNNKNLKLLPPPQTTUXUXXZXWXZXWWXXWXXWXZZXWZWXWVVZXXWVaTUXWVXW[XUXWVXVXXVUWWVWWWXVUWVWVXXUVVWUVWVUVTcUUUUTVUUTWUUTVTRUUUVUVTVVUVVVUTRRUVUVVRVTVVVWVVVVVVVWEVTRQUVVWVUUURURTUUTUTUVTVTUTUTRUTUfTUQRPRRRQUPPQQT`WUQRUVURQQRQRPRPRTRTUUTTTRTPRPPQRTRRQQQPTTTTVVTUTVSџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџэ^}ˆ{|}|||{{‡||z{…{||{|zywzzyzzyyyyzzzzzzzyhwzz‚vwwssrrrrtvvxxxwwtvvwtvvwtstvtsvsssqrsrtrrqrsqrqrrrsrspoqqononmmpoqnnomomkmnmjjkmmkkkjjjihjjkkkjjjgjjkjhhhkihijigfhhhhghgjjijjjhhhhghggfgffgeedffgfffddeddcfdccdedccdecccda`a`a```_^^[^[XWWVVVUTTTRQTTRPQQQPPRQPRRPQQQPRPPPPNLQPPPPNPNPPPPPNKNNLLLLNP[PPZNNNKNLLLNLNNKLKNNNLNKPNLLNLLLLNNZNKNNLLKLKKPLPLNLLLLLKLLNLLKJLNLLNLKKJKKJLNKIKJJWLKLKLNJLKLNKKJKJJJKHIHJIJJHHIIIHHRCA>8402/-0----**-*---*--*/------0/0/--/2/0/-/-0{dLJ_KIIIIJJIHFEEHIIHHIJKFEFFIIIFECBEEEBEFEECFHJIKJKKIJJIIKJJJHHLLIIJJIJJJHIJJKIKJIIJJHHIHJKIJIJJIHJIIHKJIJJIKJIIKJKHIJIKJJJKHJfJJIKKIJJLP[KLKJKLLJKLJKJJKKIJIIJIJJKJKKJLIJIHJJJLJKJHJIHIHHIUFIIJJKIIJJJIJKKKLKLKKKJJKKKKLLNLKLKLNNLK[PQQTQUUWWVWVXVWXWXWWXWZXZXXZXZ[XWXVVXXVUUVUWXUXWWXZWVWVWWUWXVWUWVWVVUWXXUWUXTVWVWUUXVWUVXVUUVWUUWWTaVRVVUUVVXTTTVTTTRVUVRUUWWVVUUVWWWTWVWWVWTVUVTTUWVTTUUUUUVVVUU`RUURTTTRTVRUTTUUTTRR_RUTUPPPRPUTQ^RVTRQPQRRTUURRQTTTURTRRTeQRQTRRRR^PPQRTRRUTTTUHWџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџяhk}|z{||||zz}{yz|{z{{{zzyyzzzzzzzxyyzyxjzzwvxzzxvvwtstwtvvvwwyxwwwvvttwwvsstvtvrstrrrrtsrpqrtrqqsrtproqqnpqqnpnpomonopqoooopzpmmxmkkkjkjkijijjjjjhjijjiijkkjjiihgijhhiigggijjikig|tggggfggggghfggeegfeddccdceffeedacdd`ecacddcaa_`_q`\\^\ZWWUVTUTTQRRQRRQRRRPPRRQQQQQPPPPPPPPNPLPNNPLPPPPNNLPNPNKPNNNNPNNLKLLLNLJNPNLKLLKNNNNLLNNLNPPNKLLLLLLLLLPNKKLKLLKKLNLNKNLLhLJKKKLLLKKKKKJKLLLJJKKKLJJLKKLNLLLKKKJKJIKIJIJJIJKHIHIHJHIFB@;5400//--/-***-*-/*-*/-0-----///---//0-//-/0%i^JINNKJKIHFHFIFIIJHEIIIKIHFHIHFFFCEFECBBEFEFHIIJKKJJHIJKKLIIIHJNXIIJHFFIIJIJIJIIIIJIIJJIIIJIHIIIIHKIIIJJIJKJIJKLJJIIIJIIJJJKKKJJKJKKKJKKLKJKJIJKKLKKJJKKKJLJIIJKKJLIIKKIJJIJJIKJKJIJJHIJHIIIHJKIJKKKKKKIJIKJKKKIKKJLNKJJLLJLILJLLKNPPPPRTRURVWXXZXVXXXZZXZXWZX[WWXWZWVVWXXVVTWVWUUVXWVZVXVVWWVcWXXWWVUWXVWXWWWVXcVWXZVVVWVUUVVzRUTUcXUVVWWVUWVXTXcUVUVVVVUWUUVUUTUVTVWUUVWUWVVUUUWVVVUUTTUVWWVUTRVUTTTTRUUUUURUVUUUTTVURRURVTTRURPPPPRUTRA_WURR^QTPRTTRRTQR_TRTTTTBPRTTRTRRQTRTTRTPVRRWV=џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџёe€}||}||||{zz{ywx{zz||zzyx‚yzyyzzxwtxzyyzyzvyzzz€tvvtvˆxy‚xwvxxtwxxwtvxttvsvvssrsqrsvsstrsrrsqsrtqqpq{qprnpozoonoopooonopqrrnmnjjkwkjkjjjwjjjikjjijkjjijjkjjiihgihiigigghijiihhg\hgfhheeffghhghfffefcefceccfedddcdddddcccecca``_`a_^^^\[ZXVTTUTURRTPQRQRRRQRPQQPRPPQPPPQQPNLPPPPPPNLLPPPPNPPNNNNNNNNNNLNLJKLNNNLLNNLKNNNNNLNLLLNNPLLLPKLLNLLKLLLNKZPNNKKKLLLKNLLKLKJKLNZNKKJKKKLJLLKJKKLKLLKJJKKLJLKLLJLKKIIJIIIIJJIIIIIIHHIEA<;42000/-/0-*/)*-//*/--/---//-0/--/2------//^`KIKLKKKIHFFFHFCFHHEHHIHHFEFFFFFFECFQCBCECEFJHJJIJKIJJJKKKJIJIILKHIJJJHHHJIIHJIIIJIJIIJJILJKIIJJIJJJKJJJJJJJIIJIJIIIKKIIIHIJJLKKIIKKIKIJLJKJJKJLKKLJILKJJKKJKIKKKJLWLKKKJKJJIJKKJKJJKIJHIIIIIIJJKKLJJLKKKKJKKLLJJKLJLKLKNLLKJKJNNKLKPRPQUTVUXZXXZXVWjXZZXWWWXZXZVVWXWXVWWXVWUVhWXVVZXWXWXVVVXUXVWWVWWWWWWXXXUVVVWUXWVWVVTVUVVUUTTWWXWVWUVUVrVWWVTVVUVWVUUUVVUUVXVUTTVXVUUXUVTTTTUVTWUTVUUTUUcWUTTUVURUVUVUUTRURVRU`UTTTQQTUURTPUQRPPPUUUQNQVaRRPQQQQRTRTTPQQQPQTRRTUTTRTRRUTRTQTRRTTVUWVCџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџёmt|ˆz|{|||z|{zxw{{yzzzzywwyyyyzzywvyyyyyyxwsvxwvwtstyyˆzzzvwwvyvtvtvwttvwwtsttrrrqrssssssrrstsrspssrpoopqq{ponppnnpponopoooppˆpknnkikkmkkjhjmihhihigijhkjikmjjihhhigghgjiihhjhgfhzz„hgfgggfghfggghefegddecdddfgcdeedaeccedcaeedda`_a`a__\[XWXUTUTRRQRPPQQPTRQRPPRQRPPPPQNPPPLPNPNPNNNLKPLPPPPPPNPPPNNPPNLLPLLLPNPNKNNPKKNLNKNNLLNNNLLPPPNLKPLNLLKLLLPNNKLNLKKKLZKKKLJKLKLNNLLLKLJJKNKKLJKLLKKLJLKLNKKKLLKXLKJIIIIIIJJIHJJIIHFIHC=;6442/00//-----)-/0*-*-/*--//-0--/0/---/-//!aPJJHIIKIWJFFHHECEFFFFFFIICFFFEEEFCCEEABBBCEHIIIJKIKIJJHJJKKJIIJKJIIIIJFIIJIHIJKIIIIIIIIKJKJIJJJJJKJIJJIIJJJVHIIHIJJIIIIIHJIIKJKKJKJKJKK>;>KIKJJLLKKKJJKIJJKJJKKKLJJJKKKJJLJJJJIJJIJKLWKIHIHIJHKKJKJIJLJLLJKJLJKKKJKKLLKLLLLLKLKKLNNPQQPTRUUVZXVXVXXW[XWXZZXZ[W[XXWWWWZVXVUWWaFWWWUXXXVVUUVTUWVVWWUdXXUWWWWWWVUVUVWWUWVVXVWWTUUTUWWHXWWVUVUWXUVaTUVWURWUUVTUUTVXUWUaUVWVRWUWVUVUVXWWUUUVVUUTTVUVTTTWTTTVTVWVRTRUTUTTUTTTPTUUT_RR^PRRPPUVVQ8PVVUQQQTRRRRTTQQQPRRRTTTURRRQUQQRURTURTUTTWUWXGџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџыft|||}|||{}}z{{{{yzzzxyyzzywxxyzzzzyxxyxzvwyyvxstswtvtxzzyzzzwwvy€vttvttsv€twvtstrrsrrrtqqrsrqpqprqqssqqopoqrrppmnnomnnoknonopomppmkkjjjkkmigjkkkiiiiihihkiijmmhhhjjiigggghhhgghgfggjhfggfefgedfeggffffhgedegedceedaedfdaaccdcccacccc`a_``_^ZXVWVVTTTRRTRQRRQQQQPQPPPQPPQPPPPPNPPQQPNLPNLLNPPPPPPPPNNPPNNPPLLNKLNLNNLLNPNNNKLLLLKLNLPNLNLLLLLLNLNNKLNLLNNNNNKKKKLLKKKJLLLLKLLLKLKNNLKKNKJJKJKKJKKKKKLKLLLKIJJNJIJHIIHHIHIHIHIHHFFHE@=8443002*/------/-*----/-**-//0--/00-0000/0!WWIFHHFIIiJIKUFEBEFFFHFHIUFIFFECEFCEEEACCEFHIJJJKJKJIJJJJJKKJJIJIJJIIJJHHHIKJIJJHHIIJJJKKJIKJIJJJIKIIKJJJJJJVHIIIIKKKIHIJIJIIIJJJKJKIJKJPИKKKJJLJJKKKKKKKKKLJKLJJKKKJLKKKKLKJWKIHJJJKHIKJJIKIHIKJJKJJKJJKKJJJIKJJKKXKLLKKPLLLKKJLLKLNPQRhTTWWZWWWUWZZXZXXZZWXXZXVXVVWZWXWXVXWVRVUVVWWXhUUTWTWWVcWVVXWWVWWVVTVWXVTVVXWXXVVVVVVVRTUWVXcWVVRVVVRVTVUVVWVTVUTTVRVUUWUUUUVUUUVaVVUUUTXWVVVUURVTaVUTURVVTTVURTVVWVVUUUTRUTTRVVRQRQRRTRRQPPPQ`VVR8P_QRTRRUQTRQRUTPRTPCTjRURQTTTTQRTQQTURRRVUUTWV5џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџш^|z{{||z{}|}{{‡{zyzzzyyzzzxzyy{zzzzyzyxzzyyyzvtrqtvwyxzyyxywwyxttvtwvtvvwvvstrqqssrqtrrrqrsssoorqqrqp{ppoqspppzmnknmpnmnnnonomomnkimkjjmkkkjkkmiihjghihjwjjjjjghhjiggfghhsfhhhgfgghhgghgfgffdfgffggfdgedqgefededcdeeddcdcaddcaa``n`a_`a^^^g\ZWWVTRRUQPPPRRQRQQPPPQPPPPPPQPPPPPPPPPPNLNPLNNPPPPLNNLPPPPNLPNNLLPPLLNNNPNPLPLLNNLLKLNNNNLLLPLLJLNPLNLLNLNKLLPLKLLKKJKLKKKKKKLNLNKJLKLNLNNXXNNLKIJJKLKJLLPKLJJJJIIJHIIIJIIIIHHIIIHEFFB>88522/0-/-*-**-0-*--*-/0--000--/--2-/32322&[VHFIHFFJJJIJJHHCRCHJIH^FIIUHFEEFCECEEC`CEIHILKIJIIJKKKWKKKKKJKIJJIIIJJHJIIKIJJIJIJHIIIJJJJJJJJKIIIJJJJJIJJIJJJJJIJKKJIIJJIHJIJJKJJIKJIJ>;KJIIKIKKKKIJKJJKNKKJKNLJKJJKNJLLIJJILJJIKKJIJIKJKJHJJLKIKJKKJLKKLKLLKLLLLNKNILPLJNKKKINNPNNPQQRRRVƒZVVVVXWWXXX[[XVWWZWVXXUXXWWUUVVWRVVUTWWVVVUWWVVXVcVVWVcUVVUUWWVWWXWWUTVWVWVVTRVUWUVUVVVWUWVUaUUTVVUWUaR`RTTRTUTWURUaUUVUTTWUUVVTVTVWWWTUTTTTRUVTUWU`TURQUUUVWWUVUTUUUTUUVTVUTTTVTQQQPPPQUUWTRLQTTUR^RQTUPRTTQRQPQRUQUPRRTQTQRRRTQUPTPVE`VVVHџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъc}}{{{zzzz}}{}{{yzz„{yyxyzzyyzzzyyzyywvy{zzzx‡stwtxwyyyzzwwwvxxwvvsttvstvvvvttrtqssrqrrrqssqpqrqqqrqqpoo`qr{mommmmnmpoonzoonnpknkknkknnkkjjiikkjijjjghjijiikwkfhivihgfggigfhhggfefggfffddeedfcfhgfdedfffecdcdedccceddeefdcdcccdccaaa``_^_^[[XZXUURRRRRQRQRRRTPQQQTPPPPQQQPPNPPPPPPLPPNNPPPPPPPNPPPPPNPNNNPNLNPNLLLZLPNNNLNLPNPPNNLNPPLNNLNLNNLPLJJKKKXJKLNLKLKJKKLLKLJLKJLKNNLJLLLLKLJKKKLKKJLKLLKNLPKLJJIKIIIIIIIHVJHIIIJJKIJIHIEA>;5400///-//--/---*--/-/----/00///02@33202&ZIHEFHFFFHFEFHHEETFHHIIIFFIVFFFHFFEEFBCEECFIJLKJIJIJKNKJJKKKKIJKJJIIIIIHJIKKJJKJIJJHIIIJIHJJJJIIKIIJIIIIIJIKKJJJJJJJKKHIKJIIJHJIIJJKKKIKJJKJIJJJKLNKKKJJKKKKIJKNNKKJJLLKLLKJIJIIIKKIHIJJJKIIKKKKHIJJJKJIKLLLKKJKLKLLJKKLKKNLKLKNLPKNPQPQRRUUXWWWVUXWXXXXWZXWXXXWWXVZWWVWUWXVVUVaUWWVUWVVVXTUXWVVWWWTVVWRWUVVWWXVWWTRaXVUUQ`TTWUUWVaWWUWWURTTTUTURTUTTQTTVVUUVTTVVTRVTUUURURVVUTWVVaVWUUVVUUTTpRRTTRTUTRTTVTTVRUURTTVVRUVVTTUUUQQQPPPRTVUTR;PUTRPQQPTQTTQTPTTQVzURRRQ^RTRQQRTRTTRQQRUUTTUV@џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџшc}|z{{|{zzz{}||{yzzyzzxxwzwyzxzzyyzzzxxzzzzzzzvwxvvwxy‚ywvtsvvvxtwvtvvvtxvtrsststrprqrpstrrs|qqqqqqnqrpooprnmoopnmmoonmppoknnmmjkomkmmknm{ijkkikjhtfhiihhhikjggikkihgiiigffhdgfdfhfgffefefgfffgshgfeeggeeedddŽdeefeeeeeeeddeccaa`cc``_^^\\XZXVUUUTTRRRQTTRQRPPRRQQQQPPQQRPPPQPNPPNLPPPPLPNPLNPNNNPPNNNNLLNNPNPLKLLNLPNNPNPNN^^PKPNLNNLKNNLPNNNNNKLLKKLNNKLLLLJJKJXKKKLKLKKLLKKLLJKKLLKKJKLLKKKKKJKLLLKJKJJIHJJIJIJJIIIHFIKKIIIIFFEB=64020///-///0-***-/-------///0////2420/2&XJHFIFFEHJFEEFHHHHEFFJIIEHHJIHHIHHEFEBCCEHIJWJKKLKJKLJJJIIIKJIJIJIJIIIIIIIIIJJIJJIJJIJKKJHJJJKIHJIIKIIJHIJIIIIIJIJKIKIIKKLIIIIJJILJJJJKKKJIKIJKKKNKJJKKKKKKIIKKJKJNKJLKLLLKKKHIIJIKJKJIKIJIKHIJJJIKLJLKKLKKLKLKKJJaKLKKKJKKLKIJLKKLNPPPPQTUUWWVVVVXXXZXWXWXXVXUWXWXdXXXWcVVVVXUWUXVXWUUTVVTVWUVVWWVVWXVUVUUUWVURTUVTUVWVTRUUVVXWUUUTWTVVTVUUTUTTUVUUVVUTTWVUVWWTTUTURUUUURUTWVWVTTUVUWUVUWTTTUUTVVUVTTRTRTTTUVUPUUVUURUVVVVUTQRRQRPRTTWTUQPRTUURQRQQTRTQTQRRTUVTTUQRRRRRQPTTRRTRRRUUTTVTWJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџхc€}{{{{{zzyzzzzzzzz{zyzzyzyxyzzzywzxwyyzzzzyxzwtyzytsxwwwwywxswrwxvwvvxxxxvtvtqrprrsttsstrrrpqrrqopq{pooqponoopqpoookmoojknknmmmmknmmmjjmkmniiijmjkhiijihhiihihijhkiikighghifggfefgerghfefefeegeffgghggehgfegfeefdccdcdeddadcdaaaa`c`daa^_[\gZXVVVVTRTTRRR_TRRQQRRQQQRQRRPPPPPPQPPPPNNPPPPNNPPNLPPNPPPLNLLLLNNPPNLKNKNPNLLNPPNPc^PLPLPNKLKLNNLLLNLNLJLLLKLLLLKNLKLLLLNNLLLJLXKLJLKKLKJLKKLKLKKJLLNLLLLKKLKJJIIJIIIIIHHJHIFHIHIIHIJFHECA<532/-//--0//-----*-0/*/0/0-0/2//-/0/0-3UHFFFFFFHIIIHFIIHFFHHHIHEHHHIFHTHHFCCCECFHIJLKIJKKKKKJJKJIKJJJIJIHHHIJHIIIIJJJKIIKIJHIIJIJJJJJJIIIIJIJIIJIIIJHJIIIIHIIIIKJIIJJJIJJKLKLJJKKJJHJIKKJJJLLKKLKJIIJJKKLKKJIJKXJKJJKKIJIKJKKJJJIIJIIJJJJKKJKJKNKJLLKJJJJKLLLIKKKKKJKLKKJLPPQQQRfVVVcXVTVWWWZXXXVXZVZXXUZWZVZXWVUWXVXUVTWVXVUUVTTRTTVWXXUVVXVWUUVUVWVTUUUTVTVVWTVXVUXWVVWUVUTUWUVTVTUUUVUTTVWWVVUUVWVUUTUQRUVQTUTRTVVVTUUVVUTVTWVTTVVTUUTRTTRRTTTUTRCRRTTUTTUTUURRRRRUQTRPTURVVUTPQQRRTQQTTPRTRUTTUTTTRUTRTQURTRTTQQQTRRTTRTTTUWJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџф\|{z{{{z{zx{zzzzzzzyzzzxxywzƒxw‚yyzyzzyzxx‚wsy‚wvwwwxvvwxxvsxwvwvstxwsvttsrrrrrsttrtttrrsrsrqonoqoppoponoooomppmnknmkonmmmmonjkmmmnmmihjijikkhijhijhggihiggvihjihhgggggfgghfegeffegeeegfeggedgffefgfefffeddaaddedecpeccddcaaaacac^^^^\[[[XWVUUUURRQQRTRRRQTRRRQPQPQQPPRPPPNPNPNLPLPPPPNLKPPPPNPNNLNNLLLLNPNNLNLNLKNNLLNNPNNPNLNPNNNXKJLNLLLLLNNNNKNNNKLNLNLKNNLJLNKLKKKKKKKKLJLLKKKLLIKKKKLLNLNKKIKKLJJKIJIIIJIHIJIFIJHIIHHIHHFFQA>;6420-0-//-/0///0*-0/-///00//00/0/02/20^HECFHHHEHV\IFJHHHFFHFIFFFHHHHHEEFECCCEFJJJJJKHJJIJLJILJIJJIIIJIJJJIJIIJIIJJIKIJJJIFIIJJIIJKJIIJIIJJHJJIJKIIJHIIHIJIIFIJIJJJIJJIJJILIWKIKJKKJLKJJJLKKKJNLKJKJKJJKJLJJKKLKJIKILKJIIIJIHILJJIHJJJJHKJJJJLKNKLKLKKKJKJJLNJJKKLLJJLLJKNNPPQRTUUVTUUVVXUVVWZZZVXXWWXVXVVWUVWWWVUTVXVTWUUWcUUVTTUUUVWWUVVWTVVTVVVUUUWVTTQQUTVUTWVXWXVWVUWVUUUWUVTUUUVTRVTUUTUVWVQUTTUTUTTQQTTUURTTVWWVWWUVVUVVVVVUTUTUTUVTVTTTTURTUT_UTUTTTRRURTRUTQTTTTQQQTVWXURTQQRPRRRRRRRRTQ`TUQTTTRRQRQRRTTTQRQPPTTU`TRVTVHџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџцj}|{{{{zzxzzz|{zyzyz„zzwyzxzzzxxxyyzzxyzyyyhvwtvvwwwwwxxwvvwtvtsttssvtttstrtrqprsssrstrprrsrrsppnnonqqopoqnoonnnnmnknnonmnnmmmkkkjjnmiikjjjjkjjhigiihiiiihhhiighhhfgfhfhggffeefggfefgdfgfggeghheeeffegeedadccacddfedfdddeaccdadcca_^_^^[[XXVVUVUTRRT^RRQQQQRPRTRRPPQQPPQPPPLPNLPNNNNNPPPNNLPNPPNPPLLNNNLNNNNLLLKLLLLLKLNLKNNNNLLNNNKKLKKLNNLPPNPLNKNLNLKNNPKKNLNKLLKKKKLKLKIKKKKKKKK_NKLNNLLILKKKKKNLLJIKLJJKIHIIIVJHIHIIHIHHFIHHECB<;430/--0/0/-/-*-//-////0-/2/-002/20/02XHFEIIFFFEIIIEHIHHFFHEFFFEFIEEFCCECBBFEHIKKJJJKJJJJLIJJJIJJIJJIJHIKJKJIIIIIJIJJIJIIIJJIFHJIJJKIHIJJKIIJIJJJIIFKIJIHHIIFIJIHJIJKIIKJJHJJIKKKKJLKLKLKKLKJLJKLWIIJKKIKJJJKLKIJJJKIJIIIJIIIKJIJIHJKIIJIKJKJKNKKLKKLKLJKKKKJKJKKLLJJJKPPPQPQTTTTTUTVVUWWVWXXWXWZZXXXWXWWVWWUTWVUVUVVWWUVVVUaWVTUTUWVWWVWVTVTUUVUUTTWRTTTTVUVVUVWUTWUVVWVTVUTaUWUTUTUT`VRT`RVUVUR_TUTVURTTTQUUVTRUVWVUWQRTVVVUTTUTUTRTQUUVRTUTVTQUTTTTTVRQTRR_RRTTRTT_QQQQPRWXWWTURQRRPQQQRRPQRTUE`TQRRRTPQPRTQUQR^QRTRRTTVTVVTHџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџшXs{||{|{|yyzzz{z{{ƒjzzzyzyyzzyvzzzzzyzzzyvxyxƒywvsrsyw‚zvwwvtvtstsstrtvwtrrrsrsrqrrtrqqrpnpqssrrpoqnnoppopqpoonnoonmkmoomnnnmmmminmjjnojijjkjjhkhijhhgiihjkjhggjjjjhhihigffffefdedffgfffgefeeefgdeceeffdcddcdddecaddeeedeeecdedcdaaa_`^^\ZZ[XVVVTURTRPRQRQPQPQQRRRQQQPPPPQPPPPNPKPPPNPPQPN[LN`PNPPLPNPPNLNNNLNNLKLKKKJLLNNLKLLLKNLLNNNLNKKNLNLLNLNPNNLNNLKNNLKJJJLLKLKJKKKJKLJKLKKKKJKNLJJLLKKKLKLLJJKKJJHKLKJJHIIJIJJIIIIIIHIHHHFIHHE@;5322////////*/--/I//0-0//-/-2A222///3&XHECHHFFEEFFHHFFHFIIFFEFHHHFCCCFFEECFEHIIKJJJKJKJJIJIKJIKIJIIIIVIIHKJIIIIIIJJJJJIIHJIJKFIFHIJIJJJKJKIIJJIJJIIJIKJJIJIIIIHIJKKIJJJJKKIJKJJKKJJLKIJKLLLKKJKIKKIIKJJJJJIIJKJJJKHJIIIJKIIIIKKIIIKIJJKJJKKKJKLLKKJILLLKKKJJJKJKJKXLLLLPLN\PPTRTVTVTVWXVWWVWWVcVUVZWVVWUWWUUUUUWVUVWVVVWTVUTTUUTUUUUVVVVVTWVVUVRVTVUUTTTVUVUVUWVUTUUTVUUVTUUUUWVVTUVVTRU`VTUVVTURTTUUTRQTRRUTTTTRRUUWVTTTVUTWVVTTUUVVUTRTRTTVVUVTRUQQRQVUTTVUQRRTRQQQUPPRdQUXZVVRTURRRQQPRRQRQQTTVURTRRTTRRTQTTTRQTRTTTRTRVVRVW@џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџфas|}||}}{{zzzzzzzzywxxxzzxzzzywyywwyyzzzyywyyzzxwqswwyzytvxwwvstsrstrvvtssqrsrsqqtrsqqs|qpqqqqqqprqnonopnzqqoonmomjkomnnommmkkjkkimjkmokjhijjjhhiijitihhiijjhghijhjiijjihegfeqfeeffffeegggeedfdfgcpe’dgdafddcaaddddddegeeedcddedda_``^_^[Z[ZZWVVUTTRRQTRRRQQPQQQPQPPQPPPQRPQPPNNPPPQNLNPPPPLNNNNNPLLNNNPNPPNNNNKNKLLNKKLLLNPNPKLLNNLLNLLLKNNNLNLLNPNPNLPLLLPKJKKLKLLLKJKLLKJLIKKKJKKLNNNKNLLJKKLJLJKKKIIIJKJLKJIIHIJHIIHIIHIIHIJJHHFHEB=86200//0*-00--*//0///---/0--/3200-//2&ZIFCHHHEEFEEHHIKKHIUIHFFEFFFTECECCCECFFIJLKJJJLJLIJKJHHJJJJIIIKJJKJJIJIIHIIIJKaJJIHJIJHIIJHIJJJLIJIJIJHIIJIJIJFIIIIJFIIHJJJJIJIJJJJKIJJJJJKJJKILKKLLJKJKJKJIJIJKIJJJJJKIIJIJHIJJJIIJIIJIJIHJIIIJKIJJIJKKKLJKKKKKNJLKLKJJJKJKKKNLNLPNQPRRUTTRVUWVXVTVWWVUUUUVXXUWVXWVWWTUUUUVVUUVUVVTUUTUVVTWTWVTUVVUXWUVVUUUTWURVWVUTUUUVUVUUVUUVUTURUWRRURVUTUVTUTRVTRVUTTTUTUTTRTPRRTRTQUTUUWVTUUUTWVWVTUTQUTTVTVUURTURUTUTQRRRUURRTTRTTQNPRRRPPPRQTXXVVQRUPRTRTRTTPPRTRUTQQTRTTRRTRQTQPRTTRQRRTRUVRUUWFџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџшc€}ˆ{}{||z||{zzzyzy{zzzxxxwyyz{zyzzxxzzzxzxxyzwvrtssvsxzzyvvvtssvsvtsqswsrssqrprrtrrsrrrrqrqppqoqqrpmnoommnponoooooonymnnknmnjknkkjkimnjkkjjjiihhhhhihjhhiikgghifihhgiihgffegedfeegfffeefegeeefeedgeeecffdeaaccceecddeeffefdeeaddc``_j^^^ZZXXXVVTTRQRQQRQRPPPPPQQPQQPPQQQRPQPPPLPPPcPLNPPNPNNNNNNPNNLZPPPPPNPPLNLKKPLKNLKLNKLNLLPLLKLLNKLKLLNLLNNNLLPNNNPKLNLJJLKLKNNKKKLNKLKKJLXKLKLLNLKKNLKLKKJKKKJKJJIIKIJKLJIHIIFHIJIHIJIJHJIHIHFHEA=8502/2//---/0-*-0/-/-/////-020/-/0/2!ZJFEHFFFFFBCHFJVKHFIIIHFEFEJVFFCCCCECFIIJLKKKKJJKJJLLJIIJIJIJIHIJKJLJJIIHIIHIJI`IKJIIIJIJIIJJIJKIJHJJJHVIIJIIJIHIJJJIIHJJKIKJJIJJKKJKIIFIJJJKKKKJKJKKKKKJJIHKIJKJJJJKKJKJJIIFIIJKHHIKKJIIHIJJIJIIIJIKJ^KKLJJJJLKPLLLLKJKKNKJJKKLNNLPPQRUUTUUUVaUUVUVVWUWRTVVUWWVXXWVVWTUUVUUTUUVVURUUUTUTURWcUVVUTUTWVVUWTUUUWTTVVT`TTVUVWUaWUUTTUTUTUVUUUUTTTURTUTQUTRRRTTUTUUVQRRRPRRTRTTRTVUVUTUUTaTUVURURRTTRTVTTURUTRQ_TTQRTUTTTRTRRRQNPQRUQQPTTVZdVTTRTRR_QUQRPQTRTQTQPRRRRTRTTTRR^RURVTQRTQRUUUVWUJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџшdt|}z||z{|{||{{{yzzz{zzzywyzyzzƒzwxxyzxzyyyzvxxtqrrsssvxƒxvwwvsrttsvvvrvvrvqrrsqrssttqrrprrrrqpqrqorronmpoomnomnonmnmmnmkkmnmmkkmkxmmmimkkjjkjhiiigghgitighjgijifihhhghghggheffgegffffgeeddggeffeeeegfdepeddaddfedfecdffgedefdfcacaa`^_^^\\ZZVWWUUTTQQQTQRRQQQQPQPQPQPPPPPQPPPPNPPPPPPPPPPPNNPNPPPNLLLLKLNPPNLNPNNN`LLNNKLLLPLLPPPLKNLKJKKLLNLLNNNNNLLNNNNKKPLNLLNLNNKLLJKLLLKKLKLKLKLLLLKKKLLLJKKLLKKJIIIJKJKJKJIFHIHHHHIIIHJJIJHIHIHHFBA;64202-/0-/0/-*//0/////--/-00//-00/2#[JHFHFBEHECCRFHIHFHFHFFEFEHI[HHHEHEEFFJIIJJLKKKJJJKJIIIJVIJJJIIIJIJJJJHIIHHHIJHIFIIIIJJIJKJJJJJJKKIJIJKIIIHIJIIIJIIIIIJKJIIIKIIIJJHKJIJJIIKJJIJKJKLLLKLKKKKJKJKLJLJKKJKJJ`IJJKFIHHUIIJIJIIIKIIHJIJIJKIKKKNKJJJKKZLLJKJLLKLKLKIJKLLNNPPRRURUTTUVUWVVRWUWVXWUVTXUXWVUUUWWUWVVUUTVVVUTTT`TRTRVWVWUR`URTVVVTVVVTTUUURTRTVVVVVUVVUVVRTTRUVTURTTRTQURUU`UVTUVTRUQTRTTURQTQTRUTURR`TQTUTTRRVVRVVVTVUQRTURTTR`RUUURRRQQTUTVRUTTUUTPQPQRUQRRRTVWWWTQQURQRTRRTRPRR^QQRQRRQQTTTTTRRPTUUVQTRTURRQTWUXHџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџсgt||{{zz{|{||z{zxxz{zzzzxxwzxvwxzzyvzzyzyxwywxwr}rttrtyyƒixwwvsrstsvwvtqvrrqqqsrrrqsrsrrrrpprpppsppqpnmozomppoomnnjkmonmmknkjnmkmmmjjkkijijkiijjjjghhjhjgghhhgihihhgghhghgiigeeeffgfffegezfhgffefdffefedaefddacfcgeedeeeeeffdcdecdaa``_^^\[[WWWUTTUQTQPRQRQPQPPRQQPPQQPQRQPPPNPNPPNPPPNPPPPPLPPPPNNNPLNPNLPNPPPPLNNNNLNLLNLNPLPNNaPNNLLNKKLLNKLNLLNLLNLPNPLLLLLNKLLNLKLLIJKKKLKLLLLLKLLLKKKLLKJJKKLNKLIIHKJJKIJJIIHHIIIIHII[IHJHJHIHHHFFCA=;4440/0--0//-00-//--0=-000//0020232;_IHFIFFEFFFCFFIEFIHIFFFFFIIEHHHHFFFFHIJJIIJKKKJLKJKKJJJIJJJJIKIHJIJJJKIIFIHHIHIJHIIJIKKIJIIIJJJHJJHKLLJJJHJIJJIKIIHIIIIJJJIIJJJIKIJIIJKIJKIJJILJKKNNKLKJJKWKJIIJJJKJJJJIJIKJJJIHHHIHFUIHFIIHFFIJJJJIIJIJKLKKJILJLKJKKJKJIKKKKKJKNLNPPPPPTRQ`RVVWVVUUgVVVWVVUVUWWWWWVVVUUUUTVWTVUUUVRUUURUVUVWVVRUUTUUVTUVTUTUWUVTVUTURUVVTWUVUWTTUVRRR_RRVUTRTTTVTTUR`UUUTTURTTTTT_RRTTTRTRR`RUUU`RRTUTUUVRRUTTTRQTRTTTQRVRTTTQTUTRRTRQRQ_RRQQUTPPPQUUWXVRPRPRQRPPQTRRRPRQRUUQQRUTQVTUTRRTUVVURUTTRQTTTVV@џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџпm€{z|{|||{z{|{zzzzz{{yywxxwxvzzy‚xyyywyywvyxwxtrtsssxwƒzxxxvwvsvvtvvvrqrsqqqqrrqqrqrrtrqrpq{pqqqropppnnpppomnonnnnknmnknmommkknkkijhmjiihhkjhihijihhijjighgg„gghhhjhhgighfihffggfddeddffdfedeffddffdefdcdffpceefgceeedffdddcddcaaaaa_`^_[[X[XVUUUUTURRRTRRQQPQQQQPPPQRQPQQPPPPNNNNNPPPPPPPPQLNNNPNLNPiLLNLNNPPPNNNLLPPNPPLNNPNLN[NLKLNNLKLLKLNLNLNKLLNNPLNPLNNNLLKNKKKKKJJJLJLLLLKKKKKKNJKKLLKKKKLNLLKJKLIIKIKIIIIHIIIHJJFHIJIJJKIIJIHHFCA<64230///-->0-*//0)//-*-0///0/@330#!VIFEHFFFHHTHHFIHHIFHFFFEEIHEHIFHECEIIJJJIKKILJKKKKJJJJIJIIJJIIIIIJJIHJJIIIIIJHHHHJJIJIJIKJJJJKIIJIILKJKJHKJKJJJJIIJIJIJJJIKIIIJJJIIHHIJIJJKIKJIJLLLKKJKIKJJJJKIJKJJKJKJJJJIHJJJIHHIHIHHHIIFHIEHHJIJKIIKJLKNJKJJKJKWKKJJKKNKKKLKNLKNNLPPPPQRTVVRUUUWVTUVRUUUVVWTTWWVVURVUVTRUUTUVTTURQQRVTUVTVVVTUUTRQTaVURTTVWVUTTTTR`UVRVUVVWTUVUTTTTTRUVURRRRT`TTTTUTRUUUQRQRTRTTRUUTUTTTTTUTUTVTUTUURVUTTVTURTTQTRQPTVUTTTTRTRPUURTUQQRURRTyRPNNPTUUWWRTQTTRRQQPTTQRQRTRUTQRRRRTTUPTUVURUVVVRUVRTTVVTXFџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџнft|{z{{}|{}{z{|zzxxyy|…{yyxxyxyzyzwwwyyzwwyxxxw€wqrvvwz{vtxwtxwsvwtvss}vrsrsrqrrrqpppsrrsrpqooppooppqooooopnmnnnnjimmynnonmkmmkjmmkjkkjjijijhhihjijihkjhhifhhjiigjhihgigieggfegfgefffeegcgdedffedgdeffddcfdefdceffdeedfeededddccaca___^^^\\[VVUTUTTRRRQTTRPR^RTRQRPRQPQPQQPPPPNPPNNPNPLPcPNPQ[NPP[NNPNNPLNPLLNLLNNNLLPNPPLNLNPKLPLKNNNNLNLNKKJNLKLLLLPKNKKLLPLLKKLNLKLKLKKLJJLKINKKJKJLNJKJLLLJLLKLIKKJJKJLLHJIJIJHIIHIVJHJIJIKIIJHUHHIHFB@;54322////-/--0*=----/0--00/02220/5^FEFFEFTHEHHEHJHHIHFFFTFEEFHEIERFEEHJKJKJJKKJJJKJJJLJIJKIHIJJIHIJJJJLJJIIHHIJHIIJJKKJIKJJKJKJIIKIHIJJKJKIJIJIHIJHJIFJIKIJJJKJHFJIIIIIJJIJJJHJJIIKNKLKJKHHJJKILJJKJJJKJJKJKJJJIHHIFIIIIIIFHHFHFEHIHJIJKJKLKJJKJKKLJKJILLKLKKJJJKLJLLLNPQPRRRUTVUVTVTUVUUUUTTTXWWWWWVTUUUURfUVTUTTVUURTTTVRUVVUUWTTTTUTURUVUUUUUUUUUTQTTTTTUUVTTTRTTTTRTTUVUTVUUTRTTRTTTRTTTTTPRVUUTUV`TTUTURQTRTTWWUWTUT`VRURVUUTUTTQPRTUfUQTTVUUTVTTRRUVQUUQRUVTQNLQTUUVVU_TRRTRQQRRQQPQQTRUUQRRRTUURQTTRRTTUVURURTTVUTTVQџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџнdr{{z|}z|z{zz{xy{zzxwxyŠ|zzyyyyzzxyxxyxwxxwwwzyvvwstrsrx„{yxwvtwwvwtqsrrrstsqrrrqrssrsssqqrqrqnpnpopoppopnnoonomnmkjjmknponmnnmnnmnkiijkjiijihhhhhghihiijhjhhighghihhghfjiggfegfgffedfgfgggefdffgegfeeefedadededfdfcffeaedddeedd`cacaa`a`^^\\ZXVTUURTUQTTRPRRRQQRPQRQRQPPPQPPPPLNPNƒNNPLLPPPNLPPPNPPNPNPLNNNNPLNNLLLNNPNPPPNNNNNKLLNLKLNNNNKLLLKLLKNNNPPLNLKKLNNLKLLLKLLLLLLKKKKKKLKKIJLKKJKKKNKLLKJKJJKJKJIKLJFIJJJJJHFIJJHIIVJIJJIIFHIHEIEB==6430-/2///->/-//--0//-///-2/00//&^FFEITCHEHCCEFJHFIIFFFEHEFEFEEFEEFHHJJJJJJJKKKJKKIILJHKIJJIJIIIJJIIKWJJIHIIIHIIIKIJJIJJKIJJKJIIIIIIJJJJJJIIIIIKKIJIJHIIIJIJJJHJIJHIIJJJIKJJJIJJJLLKLKKIJJKIJLJJKJIKJKLJJKJJJIHHHHHUFFFIFFFHFFFFHIJJJJIJLKJIKKJKKLJLJKJKKKJJJJLKLLLPPPPPQRRTTTUTTVVVTUUVWUVVVWUUUWVVTVUTUUTUUVVTTUVVTTUTUTUTTRVTTQQRTUTVUTVUTRUTVUUTRRRVTPRVUTTURTURTRVTRTTTVRUTTTTUTUUTRTUUQRRVWTTVVTRTVRUTTUVUUUUVVTUTTRTU`VRQQ_PRQPQRRURUVTVRTUURUTRVUR_QTTRRTQPPPTTWWURTRUURQPQ_RRQNQPTRTTTTQTTTQRURURTUVUTCUTPRTRUUVWFџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџлcf{|yz{{{{zyz„zxy{zxvtvyzywwwxxxxwzzwzzwxywvyzƒxxwtspdevƒzzvwvtwvwtvvqtrrvstrrrrqrrsqqrpprpprqomnqppnppmoqqnnnnnojmnmnmomnmmknmmjkmiijjjjijiijiiihhgihjijhihijhhfhgshfhhihgdggggggheddgddedhgdffdddeeeqfeeacecdeddcddUedeeefcdddc`cd``ma_^^^\XVWVUUUTTQQPQTRRRQQQPPRQPPPQPPPPN\NLLPPNNPNNNPNPNPPPNNQPNPNNLLPNLLNNNLPPPNPLPNNNNLNKNNLLKLLLKKLLLLLNNNLNNNLLLPNKPKLKLLNNKLKLLLLJKLLKJKNJJJKKKJJJKKKLKKNKKJJKKJIIIJJIJJHHIHHFFIFIIJHKJJKHIHIHFHHFA>864320/00/-////*/-0/0--0//0-/0-/&_FHFHIHFFEFEIHHHHFHFFEFHEEEFEFECFHHIVJJKJILLJLLJKJKJJIIIIKJKIIJIHIIKKIIIIJJHIJIIIJIIJIKIKIIJIKJJJIIJIJIJJIHJIJIJIKIIHJHKIJJJJHJJIIHIJJIJLLKIJJJJKJKKKKJKKJIKKIKLKWJJJJIIKIJIIJHHIFHEHFFFFHHFIEEFHIHJIJJKJIKKLJJJIJKHIKIKKKLJJKJJKNLPPPPQRUTTTTTVVUTVVVRRVUWWVWUUUVUWUQUVVTWUVTTURUQUUTTTT`VRTRURTRQRTVVUTTTTVUaVQUUUTUTRUTUVUTRRTTTRUURUTURURVRTTTTURRUUUTRRRUVVVTUUUUTUVV`QTWVTRRWWUTTTTQTRQURQTRQ^TQTRUUUURVR`TTUVRTTVTRTTURRRPPP^TWWVTRQUTTTQTRRQQPNPRPTTRVoQRTQTRQUQRTTURTTTTTTUUUUTVMџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџкtj}{z|zz{{zzzzzzzxzxtvswxyzyywwxyzzxyy{zyxwyzy„wvtvrswwwvyzywsstwwswvtrstrsqrqrrpqoprqrrsppppqponrqpnonononopnnmomnnjmmmkmmommjkjjkikkijikjhghjihgghfhiihjjhhhijhigfghghhiifgfhhggefefeedgffedddeddecddeeeeceeddeeedcceddfdfdddcdc`c`a`_^\^^^XWVWVUVRTTRQPRQQQQQ^PPPPPPPQPLQPPPPPPPNPPPPPPNPPNNLPPPPNPNNLLLPPNLNPLNNPPNNNPNPPNLNNLPNLPPKNLLLNNNKKKLLNPPNKLNNLLNNLLLLKLLKKKLKJJJKKKKLKKJJLLIKLKJJLLJLKKKKJJJHIIIKJIJIHHIFHIFHIHIIHKIIIHIIHHFEFC@<6322//0///-0--/--/0///0/--/0///&ZIFEFJIIFHIIIHIIFFFHHEFFCECFFCCFFFHIJKJKHJJKKJJKJJJKJIJHIJJJIIJIIJKJIJJHIJJIHIHIHIJKKJJJLJIJKJJJKIIJIJJJJJHHIJKIIJIHIJIIJHJJIIKIJJIJJKKJKKKJKJJJJJKJKKIIIIIKIJKLJHLJJJIHIVJIFFHHFFHEHFFEHFFFFHFHHHFHIHJJKIKKKKKIIJJJIKJIJKJKJJKKLLLNPPPRQTQTTTWUVVTVUT`WVVUWWVVVUUVWVRVUUVWUVTUVTUUTRTRRRTTT_QTRTPUTRTVCTRUUTTRURTRUUTRUTUUVTTTUUTUTUUTURRU_RUTTWVTTUQTVUTRVRUURTURTUUTVUU`TTWVRUWVRURURTRTRQTTTTQTRQQRRVTUTTTTURT`TRTRURTUTTRQQPNL^TVVVQRQURTUQRRRRRRQPRQRRTTRRQQQRRTRRRTTRRQQPPTRRTWVWXBџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџйm|zz{{zz|zyzz{zywyxvvgwwyzƒzzzƒyyzƒzz{zxyywvxzƒzvvtwzywxzywtssstrtvvqssqrrrtssqropqoqrqqqopq{qoqppopoopnnoomnmmmonmmmmmimkmkkmmkjjjjhgjkihjijhiigihefhhjihigjjhigffghfghiffeffefgdqfgeefeecveafdeddeededddcdeddeeeedcfeeacedddoacca`___^^[\XWVWWUVTRTTRRQPRQQQQQPPQPP@cQPQNPPPPPNPPNPNQPLPNNPNNPNNLNNKNKNNPPNPPPNNNNNNNPPNLPNLNPLNNNPLKNLLLPzJLNKLNNNNLLLKL[LLJKLLLLLKLKLJJKNLPNLKKKJKKLLLKKIJJKIKJILKKJJJIJIJJIHJJIIIHIIHIIIIJJIHIIIIFHFFFFA=<4220-0-0/--0//--/-/0/0--/--00/5ZIFCIHHIHIVKJJIHFTHIEFEECECFECCFTIIIKJJIJKJIJJIKKKNKLIIJHJKIJKLIKIJKKJJJIIIIJVIJJIJKKJJJIJKIKKJJJKHJIHJFJKIIIKJKKJHJIKIIIHIIJIJFHJKJKJKKLXKJJJKKJJJJKKJJJJJKIKJIJJJKJIIIHJJHHIFFHHHHFFEHEHCFHEFHFIHIIJJJIIIJKJJJIJIJJJJJIIJLIJJLLKPPNPPPRRQRVUWVWTUWTUTUTRRaTUWUVVVTVVWTUUVTUUUVUTTRVURRTTTRTTTRTQTTQUUTRTVTTRUTTUQTTUVTTTQUTUTVUTUUTVTTQUQRRUUTUWTTTUTUTQVTUVUUVRTTVWUUUTTUTRUUUVURTTRUTR_UUURTRPQTTTUQTVTTTUTRTTUTT_QQRRTTRURPNN=QUfRRPPPRTRTTTUTRT_PQTRURTRRPQP^RTUTTRRRPUTTTRTUTTUVZXBџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџйg€|zzz{|z|zyzzz{zzxyxxvwwxwyzzzzyyxy{yzxwwwwwwwyzzvtwvxˆyzyzwssswtrtsttstrrrrtrrrrrqrrrppqpqpoqqpopnopnmnnnonkmm}mkmmnnkjjjmnknkjjjjjkkjhikhjijiihhgffgghhijihhjihhgfhgggfhedeegfddefgegdddcddegeeepcceedefcaaffeefceecegccdeddcda```a_^^_^\fZZUWRVVRQ_RRRRPQQQPPQPQPPQPPPPRPPQPRPQPQPPPN\PNNLPPPPNQ`LNNPNNPPLNNPPNLLNNLPNNNPLNPPNLLNPKNNNLLNLNKKNLLNLPLPKKNLNnPKKK5a0PNLLKKJKNPJLLLLJLJJKKLJLKJIKJJKJKJKJJJJIJJIIJIIIJHJIHHHHJIIIIHJJJHJHHHHIEA>6420220-0-/-0-0//0-/220/--0/2/&XFEEIFFHHJIIHIHHIHHFFFFFEEFCCECEHJLIJKIIHKKKJJKKJJNLJIHJJIJIKJKLKJJJIIJJIJJIIJJIHHIKIJJIJJKKKLJJJHHKJKJIJIIIIJJJIJIIIIKJHJJIKIJJJIKJKKJKLKJJKIKIIJJJKKJJIJJKJIKJIKJIJJKIFIIFHIIFEEEFHCFHFFEEFHFFIIHHIIIFJJJKKIKIIVIIIHJKJIHWIJNKLLLNPPPPQRTTUUUTVVVWVaUUVaTUTUWUVUWVUUUVTRUTUR`UVTRRURU_QUUTRTTTTTTTTTRRRRUTfTTVURVUQTURRTQTUUR`TRTTUVTRUURTTUVRTVUTRUTTTTTTUUTUTTTQVUTTTUUUTTTRRTTUTQTTTQQTUTUTTRRTTUTTTUUTTUTQQRTTTTQRRTTUTUPPPP6PTQPPNLPRUTUTQQRTTTQQPTRTRRQRRRTRTUVRRRTTTTTRTRTTWaVWXFџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџе^}{z{|{zzzyz{„yzxzzzyxxxwvxxxyxz{yyƒzzyxvvvyvzyxzzwwwtzzyxzxvvrvtvqssvsrrssrrrsqsprssqqrpqqrrononqpoopononnnjnnoommnonmmkjknkkmnkjiiimkijkijjhhhghhgefghhghihjjigffihggfhfffeeehrgfffgddeepcecdgfgdpedfeecfedccqddccefedfddceda`anaac``^^^\[ZZZVVVUVTTPPQQTQP^PQPQRQPQPPPPQQQQPPcQPNPPNPNPPPNNNPPNPPPLPNPLLPNLNNPPPJNLLLNNLPNPPLLLLLP[NNLPLLNLNKKLPLLNNNKLLZLPL[KKJ§NPLJXKKJLLLNKLKKLJLJLKKLJIIJKKIJKJKKKKKIJIJHHIIIIHIJHFIIJHJIJIIIIHIIIIHHHEA=633000/-*/--0/-//20000///00006aEEEHHFIHIFEFII\FFHHFHFEEEEFCFFHIJKKKJJJJJJKJJKKKJJJJJKHJJJIJIWLKJHIIKKJHJJJHIIJHIJJJJJJJJJKKJKJKJJKIKJJKJIIKJIJKJJIJJJJIJIHJIIIKKJJIJJJKKJJKJKJJJJJKKJJJIJJJJKLJJIJIJJFHHFFHIEFFECHEEEFFERHHFFEFHIIIHJHIIJJKIJKIJIJKKJLKIKKIKJNNLNNNPQQPRTTUURUUTVXXVUTUWUUUURTRUUUVTVTTUVRUTUTRTRRTRTTTVVTTRVUUUTTTUTTTTTUVTQTTT`UTUTRTQTUURRTUUURTUUTTTTRRTTQTTUUURTTUTTQVRTURTRTTUUUUTRRUVUTUURRTUVRTTRTVTPTRTTTTVQUUTURRUUUPTRTTTTTRRRUTU>RRPLNdRQNQNP_TRTQQQQPTQQQRQRTRPTTUQTTRUQRPRQQQRTRRRTTTUTUWRџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџиi}{{|zzzzzyzzzyzzyzz‚xwyzxyyyzzzzyzzzzzxvvzyzxwyyxxvwvxzixyxrwtttsttvtrrt}r}sssprqsrqqqpqpoqqqpmooomnmmopnnmponnmmmpponmkjmmkjkkiihijikjihhjhhfhggfefgghiijghihhffhfgfhghgggfefgggddedeeddddfdcdgeeccx{Wdecedeeeefdeddedcecdddaad`a``^`^^^[Z[XXWXVVRQQPPQPQQPPQQPRPQPQPPPNPQQPRPPPNNPPNPPPPNNNPNNPPNNPLPPNPNLNPNNLPLLPNNNNLNPPLNPPNKPNLLNNLNLLLKLNKLKNNKKLNLNNPLLLыLLLKNLKKLNNLNLJILIKLKKKKJJJJJJKJJIJJKJJWIIJIJIIIJFHHIIIIJIKIHIIIIJIHIJFHFHE>;5320/0-----/0/0/0///320//-//5^HCFHHHHIIHHIJKIHHHFHIFEECEFECEHJJJHIJJLKJKJIJJI^JIJKJJIIIIIIJKJKKKIIKKJHJIIJIIIHVKIJKKHJJKNKIIIJJIJJJJJJHIIJJJJIJJHJJJHJJIIHJIHJJJIIJJJKKJLKJLIJJIJKIKKJKLJJKJJJJKJJKJHHIIFEHFEHFEEEFCCEFFEFFIHEFHHIIIIFJKHKHLKIJKKJJKLJLJKLLLKLKNPNPNPPRTRRVTVVTVVVUVUTRTUTVTVaTRUVTUTVUTTTUTURUURTTTRTRUUUTUVRRRTRRTTUVUTTURRRTRRRRURURUTUURRRTTTVTQTTRQTUVUTTTVUUQUTTTPRURTTRUTUTUURTTfTTTTUVTUTUUUVRUTVTCUU_RTTVTUQUUURURCTUUTUTTVTRTRTTUTTURPPRPQQPPQURRUUTTRRRRQQTTRRQTRUVUUTRQRTRQPRRUQQRRRRVVUWVGџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџгf}{{{zzyyzzzzyzzzzyxyvxxzyzzyzxwxvyywxxyvxyyzzxxyvwqqsvyxtvwttvrrvtrrtsrrrqqqrrpsrqppqrrropoppnnnnoponmoomnnonmommmnnpmmnmjmmjijmviijjjjkjhjjihhhggfggfhkkijghhhghhhgfgegghhhffgefeddddfdcedfddeffdfdgX™fdddgeeeeededddddcdcadec`dc`_```^^^\\ZWXWTVTRTRRQPQPPQQQPPQRPPPQPPPPPPQPPPPNPPPQQPPPNPPPNNPLNPPPPLPPNPLNNNNPPPLNPNKLLNNNPNLN[PNPNLNLLLJLPNNNNKKNNLNNNNNLLL@8BKNNKNKLLLNLPPNNLLNKNPLKKJJKJKJIIKLKJJHJJJJIIIJIHIHHIHIIFIJJJFIFIJIHIIJHHIIFB>;4200--00*0//-//-/023420/-0/%PHFFHHFIHIFIKKJHJHHFEFFCECCEEEEHHKJIJJ^NKJKJJILJJJJHJJHJHIJJIJKJIJJJKKIIIJIIJHIJIKJKJKJJJIJKKIIJKJHJJJKKIJJIJJJJJJJJJJJHJIJJIHIJJJJLIJIKLKLIJJKJJIJKKJJIKJKJIKJIJKJIIJIIHFHHEHHFEEREFCEEEEFEEFFHFFFFIIJFIIHJIJKIJLIJJJLKJKKWJNJKNLNNPNPPQQTUTVVVWaUUUTWWTTVVVVVVWWVRVVRUVWU`TUTUUQRRTTPTRQUTQRTVU_TRQTTUUVUUUTTRURRRTRRRURUTTURRUUTURTTUURRTRUTTURWUTRRTUUQTUTRTTVQUUUUVTTTUTTRTVRUUU`RVTVTVUU`RRRTTVTTURUTTTTTUUTRUTRTRQQPRRQRTRPQNPPPQPPNUVUTTRRRTRRP^PRPQQTTVUTRTRPQURPRTTRQQQPQRaVVUVGџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџаn}}|zzzzyz„zzzxzxzyywwwywyxzxwvwxxxxyxwwwxxzzwyvwqopqvwstsssstrtrtsrrqqrrqqqqrprqppqqqqopqqppmonmnnoooponmmnmnpomnkmoojmmimmkikjkhjmjimkjjhjhghiggeghigiijgfgsedghfgfeghhfggegfdegecfegedceecaddegdqfeddefeeecfeddcefdedacaeedcadcc`_`^^\[\[ZXWVVRTTUUQ^QQPQQQPRQPQPPPPPQPLPPPcPPNPPPPNLNPNPNPPPPNLPNNPNLNPNNLNLLNLPNLNNPPNLNLPNPPPPPPNNNNNLLLKLPPLLKLNNNLNNLNKKLNJLJKNLNNLNNNNPPLLLLLLNLKKKKKKKNJJIJJJIJIJHIIIHIIHIFHFIKIJIIIKHIJIHFIIIIHJJJJIEB=84200//*//-//0--0/22430//-2WFEEFFIIIUJKLJIKKJIHHFFFFECaFFIJIKJJJJKKLIJLKJKIKJLJKIKKIKIIIJIIIIIKJJKIJJJJHIIJIJKJKJKJIKJJKKKJKHIJIIJgKIHJJIJJIJIIIIVIIIIIIIIJKIJKNWJLJJJKKIyKLfKLLJKHJJJJKKJJIKJHIIIFHEEEEEFFEEEFEEFEEECFEFFFFFFFHHFHIIHJHJIIIJKIIJJKKHKJJJKKJLPLNPPPQQQTTRVTUUT`UUWVWTUTTTUTWUVUUTVVTTUTVTQRQTTQTRRTRRQRTRTRRTTTURUTTRVUQURRRRURRRUTRTTRRTTRU`TURTUVRRRTVUT`TVUVTVVTTTTTQTRRTTURTRVVVVTRRTRVURUUURRTUUUTUTVRTQRRUURT`TRUURURTTRRURUTURTUT_UUTPPPTRRRQNNTUUVTQRVURTQQPQQRQRRRTUURQPQRRTTTRTQ^PQRVUWVVWNџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџШe}||zzzz{yzz{zyzzyxvzwwxvxyzxxyxyzwxyywxtwwxywxtqrnqrvsrvrrssrrstsqrprqqsttrtrqprpqqppqqpqrpoponoqqpopooonomnmokkkjkmonmxmkkimkkjiinnjikihijkigihgeffgiiihhghhhfghgfgfggggeggfgeeffdghdeddaeccpfedegfeeffdffdefeedceefeecceadd_aaa`_``_^\^^[ZZXWWUUTTURTTTQQQQQPPQPQPPPPP\PPNNNQQPPPPLNPNNPPNPPPPPPNNPPNLPPLNKLLLKNPNPNLNPLNPLNNPLLNNPNNNLLLLLZNNLKPNNPLNPNNNLKNKLNLLNLLNLLLZNNLPNKLLLLKLKLLKKKKKNKIHJJKKJIFIHIIHIJHIIIHJIIHIJIIIHHHHHIHFIIVIIJHFA<5I020/00/0//////020020-//0WFCEIIIHIHHHIKJIIHIHCEFFHCCCCHIKJJJLJJIKKJJKJKIJIKJIIKLKJIJJWJJJIJJJJJJKIJJIIIIIIJJKJKLKKKKJIIJJJJJIIIJ^KIIJIIIJIHKHHIKHJIJIJJIIJJJKKJJLK^IIKIKJJJILKKKJKJIJJKJKJIIIIIFFFEFEFFFEFEEEEFFFECEFEEFFEEEFIHFJHFHHHHHIIIJJJILKKJIKJKJJLNNPNPPPRRTRPRTVVVTTTVURUVUTTRVVTTUTiUWTRRQUUVRQRURRRRTTUQ^QRPRTRQTTQRUTUTQRRTRUTTTTUVVTTUUTVTTUVRURRRUUUTUUTWVTTRVTUWaVVTTTRV`V`TTTUTRUUTUTPRRUVUTTURRVVTTUTURRRUUUTTUTVVTRVVRRTRTURRTR_RTTRTUUQNNQTTTQPPPQUQRTRVTT`T^QPQPPPRTTTQUTPQTQRQTRTTTdPRRRTVUUXGџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџШer{|{|zzzyzvyyzyzzzywyzzxxwzz{xwxzyvtyxxxvvvvxytsonnrvxtftrrssrttsrrrqqtvstrstrppqsppopopqpooooooqppononnnmmpnomomkkommjmmkmkikkkjkkkjkjjhkikhghhgfhhggiiihggiighshfgfeeffefggffdeedqgcefefadddgeefefefewffedecafcccfdddddcdedaaacaa_^_^^^^\ZWZZWXUTUTTRTQRRPQQQPQPQPPPQPPPQPPQPQNPPNPPPPNPPNQPPNPNPNPPPNLPLKNPNLNLNNNPrLLNNLNNNPPLNLNLNNLKNNLKNZLNPNNLNKLNNPPPNNNLKLLLNPKNNLLLLNLLNLKLKKJKLJLKJKJKIJJJKJJJIHHKJFHHIIHJKHIIIHHIIIIHIIHHFIIHIJIJIIC>842200///00/0/2002/////0235TCCCIJJFFFEEJKJJHHJHFFCEFBBCHIJIKIJKKJJJJKKKJIKJKJJJIJIJKKJKKKJJKJJKJJHIJIKIIIIJJJIJKKJJKKJJKJJJJJIIJHJKIIIHKIIJJJJIIIIJVIIHKIIIJJJJKKKLLJLKJJJKJLJJJJJKLIKJJJJJJJJHIHFFEEEEEHEEBECEEEFCEEFFEEFEHIHFHHIHFHIHHIIIHHIJJJKKKKJJJNNLNLPNPPPPTRQQTTUVTUTVVUVVUVVTTTUWTVVURTUUTTTTUTRTRRQRRRRRVTTPQRQUUVTQ`TTTQTRPUTUQTUUTURUVUQRTTVUTTRTTTTUU`UUUUUVUUUTTUTTUTURTVURTUUTQTRRTUTTUUUVTTRVUUVUTRVTTTTRTUUTTaTTUUVRRVRUTRRTRRRQTQRTQRPRTQLLPcRTUT^PTQRUTVTTTRRQQRLNPQQUTTQTRPRQQQRRTTUQQPQTRTVVWWOџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЯho{{|{z|zzxxwxxyzzzyzyyyzxxhy…|zxwxyzxxvxwvwvvwwwqmoosvywrwtttsrrrrsrpsrrts}rrtrqqpqsonqqnpqqpppnnpznponnnknonpmmmonomnijikjkmjikijjjmjgihhhjiggiigihhjhiihihghggifgegegfegeehggfeeedeceeepddcccddegdfdfdfeqeddecfdcccfedcccdccacadc_`_^^^^^Z[[VWXXURRTQRRRQQQPQPPPQPQPQPPPPNPNPQQLPPNPPPNLNPPPNPPNPPPPNNNNPNLNNNNNNNNNNPNKNLNPLPNNLNLLNLPNLLNLPKNNPPKLPPNLLNPPPLPNLKKKJLNLPLLLNLNPKNLLLKKKKLLKKJJKJKKJJJJKJJHJJIHJIIHJIIIIJIIIIHHHHHIIIHHIHHIIVIJFB=642/0000/0--/0///000233306NFFFIIJHFFFI6IHHJIIIIEFCECBEHJKKKKKIJKKIIJJKKJJJIJKHJIIHKKHJJKJJKKJKJHJIIIIHIJJJIJLJKKKLKJKJKKJJKJIJJIHJIIIJHJIIJJJIIJIJJKHIJLIKJJKKNKJLKLKJKKJKJKIJJLLLJJKLJJJJJJJHFFEFEEEFCCEEECBCEEEFFECCFEHFFEFFFFFHEHHFIHFIIIFJJIJIJKJJKKLLN[NNNNPQPTRTTTUURTWUUVTTTUTVTURUUVTTRRRRRTTQUTTQQTRRRTTUTTTR_TTVURTVTVQTQRRPR`UQTUUVVUQUTRTUUTTTUUTUTRUTURUTUUTVUTRTT`RVRRQRQTTTWT`RURTVURTRUTRTUVTWVUUTRTTTRTVTR`RVVTRTUTUUV`RTRQRRRQPRTRRQPPT_QLJNP;JLXNJLJKKKKJJKKKJJJJKKLJJFC'FL03/@22205I22/0005@EECJJIIJUIJJHIHIIHHIFILKPPQNPPPR^QRfQQPPNLKKLJKKIIIIHIJJKHIJIKJIIIKIIIJJIIJJKJIJIJIKJJJIJKLJIJJIIIIHIIHIHHJHHHFHFHHHFFIHEEHFEEFHHFHIFEFHFFFFHFFFHFEHEHHFEFFECFFCFCEEEFCCCEEFFEFEEEFCEBECECECCCCCFCFFFEFFFHHFFEFCHEHEFHUFHCEFIHJJJLKKKLKPNNP\PPPPPPQPRQQRRQRQPQ^QTQQRQTTUQRRQQTQPRTRRRPRQRQRRTQQRRTRRQTRQRTRRTPQRQRRRTQTRTTRTR_TPRTRQRURUTTRQTRRTTQTRTTRTQRTUQTVVVTTRTUTUTRTRVTTRVUUTUVUUTT`VTU`UVUPTUTVUQT_QUTTUPTPRTQRRTTQUQRQNNQPUaUUQTUVaUUUTTVURRTRPQTRRRUTTVTTVUUUUTR`UUR_CUQVUTVUU`џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЊi{zz{|{{zxyzyyxwxzyzzxywxtxxxwtwstwwxyxxvwtvvtwtrpoqqrs„tpqvvtporokmrrsqssqpqqqqppppppqpopopqqnpnnqopnnomkmmkkjkkjkkknmjkjkjiiijjhihiijhjhhhihfhgfihffgggighhfgffhghfdegiegfdedcddffddaeddeeefgfedddcdddfddddcedcdeaaddecdcdcaaaca``c_`^^__^^[[XVUWUURTRRRRRRQQQQPPPQPRPPPQPPPQPQQQQNPPPPPPPQQNQPPPQPNPPPPPPNPQQPNNNPNLP[NLPPPPPPNPNNPPNNNLNNPPQPPNPPPNPLLPNLNNNNLPLPNPPPNPPPPNPNNNPPNLPPPPPPPLNKNPLLLLNLKLJJIIJHJJIJJKIJJIJJ8КPKJKKJKLIIKJJJKJLKLJJKLLKLIEA&4222003002220//005NFECIKJJHHIIIJIIIIIIHIJKLNNNNLLKPPNPPRQQQPPPPKPPJJIIIJKIKIVIJJKJIFKIIJIIJJIIILJKIHIIJJHIJJJJJIIJIFHHJIJIIFHHFHHEFFEIFFFEFEHFHFEHFHFHFEFFFIFFFFHFFFEHHEFHHFCCBCEEEEEEFEFFECCCEECCCCECCCBECEBCCFCCEBCHEFEEFFFEFFEECCEFHFHIFFFCHIHIJJKLLNKJNLPPPPPQPQRQRTQQQQQTPTRRQRPPRURRRRTRTQQPQQRQRRTRR^RQQQR^RTRURRTPQQRPQQ^PPQRPRRQPQRURPTRRTTTRTTRQQURRRTRRQUTURRTQUTQRRRTVWTT_RRUUVVTQRTURT`TTQTaVRRTUUTUTTRTTRRTTUQRQQTTRRUTRQTPRQ_TRTRRRNKPQRUUTTRRUWTTRRTVURQURQRQPNRR`UTTUTRVRWUTUTRTVTRRUURTWVpџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЖezzzz…{zzz{zxyvwvxyzzywtvtyywwvxwwxxzzwsvvsrrstvrp_nqqswwrpvssrqoqpporqrrsrprrp{roonmqqqqpponoppopopommjmnnnnmjkkjkkkjmkjkkkijiikjiihijijmhihihhshghiiyhgfhffgffrgghfhfeggrfdeedddedddddfedfdffeeddedddeefhzdccdacedd`ceeadd`aa`cdac`a__`_^^^\\ZXWWVUTTUTUTUTRRPPNQPPRPPPQQRPPPPQPPQPPPPPPNQPPRPPPQPQPPRQQPPPPPPPQPPNNPPNPNNNNPPPPNPPPPPPNPPLPPPPQPPNLPNNPLPNNPNPNLPPNNNPPPPPPNPPNNPPPPNPPLPPPLNNNLLLNLNLLLLJKJJJKKKKKIJJJKJJK>>@gKJKLKKJJJKJLLNLJJKJKKKJJKJC<544322332002200028BFFEHVKHHHEHHIIJIIIFIJJKNNLNNNLLKNLNLLLPPLPQ\RQQNLNKJJKIJJIIJKKKIIKIIIIIKJJIIJJIHIJIIHJHIIHIJHHFFJIUJHFFIFFFHFHFFFFHFEFEFEFEFFHIHHEFEFFFFHEHFFHFFFFFIFFFCFHEBCEEFFFHHHFFCEEFECCEQECECCABCCECCCCCRFFEEEECEECECEEFCFEFEHHFHFFFHHHKJJWJKPKJNLPPPPPPPQQQQRRRPQPRPPRRQRRPQTRRRQQRTQRRPPRQPQRRRRPRQQRRQTTTQRTRTQQQRRPQPP^QQRRPTTTPRRQPURRR_TTRTRUUTQUQQRQTUQRQTVTRRRUUVVRRPTTUVVUTUUUTTVQTTUVQQUVTUTUT_Q_TRQUTTT^PLPTUTURRPRRRQTTRTUUPPNPPTWVaURR`TUTTTRTVRTPTPmTNPPQRTTRUURUVVVRR`RTUUQRTTUUTUgџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ­nzzzyyzzzzzzzyxvxyyyxwvxywwwwwwyyvwwƒƒxvwfsqsstrpm^prv€pr}rprprrponqqsrponpopopponnmppopppnnooponmoommonmmmnmkjkkmnmjimkiiijiijkiihghmkkviihhhighthhhhggffffdfgggigggdfdeeeegdddcccddedeefdddeddadddfddefeddadacedddaddddd``m_d`d``__``^^^\^\^[XWVVTVUUTQUQRRRQRRRP^PPPNPQQPQPPPPQPPPPPPPPPQRRPPPPQPPQTRPPPPPPPPPPPPNPNPPNNPPPNNNNPPRpPPPPNPPQQPQPPPQPPPNNPPPPPNLPPPNPPPaPNPLNPPPPPNPLNNNNPPPPPPNNLNNLNNNKLLKJJKJJJKKKKJKJKKNLJKIJKLLNKJIJKJJKKLKJIJKJJJKJHA<52234220202244326TEECFJIHHKIIIJHHFHIIIKKKLNNNPNNLLPPNKKKKNKLLPPQ\\QPPLKLLKJJJJJLK^KJIKIJIJJKIIIJIIJIJIJJHIJIJHJIIHHHIFFHIHFFFFFEFFEFHHFEEFFCFTFHEFEIFHFFFFFFFHHEFFFEEFCEFFFFFCEEHCFEIFFFHHHEEECFCECBCFEEEBCFEEFCEEHCFCEECEFCCFEEFFEHCFHFFFHIFIIIJKKKJLPKLPLPNNP\PPPPPRRPQPQPPPPPPPQ^QQRRRTQQPPQPQTPRQRPQQRPPRQPRQRQTURQQQUQPPRRPRQRUTQTRUTPPQTUTQTPRQRQTTURTTQTURUUUQQRURTTRVTRUTTTTRUTVUTUVRURQRQUTQURTQU`UVVTVTRUUQQRRRTRT3NPPPQRRRTUTTPRTTRTQQPLPTRWUXTTRRTQTTVUT`RRTQBTQPRPQRQTUTTUQRVWUVTRT`TRUUUUTUUeџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЊez{{zzzzxz{zyyxwwyxyxxxwyzxxvthxwxxxywxxttwsssrspmknotv‚^qqqqrspqrppqqqqonopppqqoopmooppqoopmnoomnnpomknnmnmmmnjkiiimiijjjhiijiijhghjjikhhihhgghiffighhfhggfdffgehfeefgededfeffefdccecedefgddffc`cepegfaedcpddadccd`adeecdda`ccaaaa_```a_`_^[Z^[[XXVUQTUURTRQRTRQTQPQPPQPPQRQPPNPQPQQPPPQPPRQPPPPQP^TPRQRRPPPPPPPPPPQPPNPPPPNPNNPPPPPRPPPNPPNQPPPPRPPPPNPPPPPLLPPNNPPNPPPNNPNNNNNQPNPPPPNNPPQPPPNPLLPLLLLNLKLKJJIKJIJJLLJJJJLLLJLJJNKXLJJJJKIJJJJKJIJKKJLKKJF>552030/020BEPC226BECEHIHIHVKWJJHIFHJJNNKNLNPPLNNLKKLLKKKJJJJJJLLLNP\PPPLPKJJIHJIJJJIJJJJIJJJIIIIJIIIJJJHJIIIJIIFHHFHHIIIHHFHFFHHFEEFHHHFFIFEHEFFEEHEHHHTHFHHFHIFHFFECHEHFEFFFFEFECHHFFIHFHHEHHHEECBEFECCBBBEFCEFFFCEHHCCEFECCFFECEEEHEIFFFHIEIHIHIKNKZPLPLNKLNPPQPPPLQRPPQQPQPPPPPPPPQPRPRQPNRQPQRRRPQQRQRRQRQQQPPRRTRRRRTTPPQTRQPQQRQQRQTRQPTRPRRTQ^RRTQTQQQRRTQUURRTVURTVTVURQTTQ_TUUTTTTTRTTQRTTRQUUTTRUTVUVRQTQTTRTTQUUTPNPRQRRRTRTTRQRRUTTeQNPPTVVWVUQTTRRTTWRURUURPR^TPTVRTVUTTUVUTUVVTURTRQURTTRRTTbџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЗho|zzzzzzzyzyyzyxwwzzxzxxzzwttwyxxxyxtvwtwvvtvromjmqsp^qpsrrqpnpqoqpopnmnpppqrqpppnonppppqzknnpnnnkmmmmjmjjjkmikhijkijijiikkvijjgivjijivjhggghgighhgighigfffffggggefegffdcdfffefeefedceeeeffdfdddeffeeddedeefdddcd_aeddccdddca`````a``k__^^[[[ZZWVWTUTTTTRQTUTPRPRQQQPPPRPPRRQNPPPQPRQPRRQTQPPT^QQPQPQPkPPPPPQPQQPPPPPPPLLPNPPPPPPNPNPQNNPPPPQPPPPPPQQPNPPLKNQPPPPPPPQPNPPPLNPP\PNPPPPPNPPPNPPLPLLLPNLNKPLLNKKKJKLKJNLKKLNKNJIKKKLKLJIJJJLLLJKKLKJKJJKLJJKIC=5424203003552206BFBEIIFFFJKLJJIIHIHLLPPNLNNLLNPPKKKKLKKKKJKJHIKJKKNPP`NPPLNJKJKKJIIJIIIIIIKIIIIJIHHHInIJJIIIUHHHFHFEFFFFFHEFFFFHEEFHFHFFFEFHEEECEFHFFFFEHFEHIEEFHHFFFEEEHFCBEFFFFFFHFFEEFEFFHFFFCCEEEAECCEBFFECCEHFFHEEEFCFFHCEEEEECFHHFEEEEFHHIKJKKZKPNLLZLNPNPPNNLPRQ^PPPQPNPPPQPPPPPPRPQRQQPPPPPQPQRRPPQQPQPQTQRRRRTQ_RQRQRTTPRQ^QRQRQTTRRQPRTQQTQRTRURRRQQTRUTTTTTURRUVTRUUQTRUQTURRRRTRUTURTVTQRRTRTUUTTTRRRRQTTTRQRQPTQRTQPUTRUUQQRRRRTRdNNNPPUUWURoUgUTUUUVTURQRRRRPTaWVaTTTR`UTRTTUVQTTRQRRRTTUTTaџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџГqzzzzzyzzzzzzyzyxxzyywwyyxtsst€wyvxwswyywwvxvtqmkno}vtnnppqttrqqpqpoooppkoqpqoopppqmonnoqqpqnmmmponmmkokjnkkmknkkkikmmkjijhkkhhijiikiihg{ijigghihhhhhhgfhgefeedeggfdvddgedecfcdVfedeecefddeeffpddedddegdcdefdedaecc`adeccaaaddcacacaaa`__`^^\ZZZ[XVWWVTRRRTQQRQRRPPPRPQQPPQQQRPPQPPPPRRPRRRRQQRRPPQQRQQQPPPPPQQQNPQPQQPPPPLPQPPNPQ\PPNPQNNPPPNNPPNPPPPPPPNNPPNPPQPNQPNQPPQPPPPPPPPPPPPQPPPPPPPPNNNLLPNKKNLLNPLKKKKKKKLKNLPNLLLKKJLLLNJJIJJLLKLKKLKJKJKLKLKKJH@833330220202//2;AFFFHHEHHHIJK^JLKJJKPPPNKLNKJKLLKKJKKJJJKILJJIIKJKKJKPL[\RQPNJKIJJJJJHIIIJIIJJIIIHFFHFHIJHHFIHIIJHHFEEFFIFFHHHFFEFFFHEFFCFEFEFEEEEFFEEFEEFHIHEEEIHFFEEEEFFECEFCFFFFFEFEEEEHHBFEFFBE\FCBBEBCEEBBCFFCEFBCFFFFEFEECHCEEFHHEEEEEEFIHIIILNKLJL_LLLPPPNPNPPNPQQPPPPPQPNPPQPPPNQPQPQPPPPPQQPN^PPQRPPPRQPQRPQQQQTRRTRQRQNPPRTRQQTRRPPRQRQRTRQRPRQRTRTRRTURRRRVTRTTRRRRRRRUTRQUTUUQQTVUURRTURRUTRRUURTTTRTRTTRURRUQRRRTUTRTUQUTR^P_TRTRPLPJLPTUVRCVVVVUVVVUTRRPTTR@PTWWUVRTTRRTTVRURTV_RUTQQRUUTRUdџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЉi{z{{{yxxzyzzyxxywyyzzxxwttvtvtswvstvwvwwvvxtss|ojmpqt}pmrrtvqsttrrpnmnnonoqqrnonqponnopoqonnononooonnnmmknnjmmkkmmmnjjjimjijhhihiijiifhijjihhghfgfhgghgggfgfdeeggfgdaedfdfeecddgedeegffgefefeccceafedqeddddffccddcdaccdccaaaaaaa`aca`_aa^^\\^^Z[[XVWVVTTTQTTRTTRQPPPRPPPPPQPQQRPQQQPPQQPRRTTQPPPPQQQQPQPQPQQQPPQPQQQQQPQPPQPPPQPPQPPPPQPPPPPPQPPPPPPQPPPPNPPQPPPPPPPPPPPPQPPPNPQPPPPPQQQPPPPNPPPNPNNNNLLLLLNLLLJJKKJKLJLNLKLNKKLJJKNLLKWKKKKJLLKLLKJKJLLKJIKJE=63323200//0//26AQCEFEFFFFFIKWJKKINPQPPPNKNNLLLKKLKKKLIIKJIIKKJJJIIJJJJLPR^R^PPL[PKIJJHHFIIJJIHIHHHIIHHFIJHIIHFEHHEHFFEFEFEEFHFEFHFEFEEEFCFEHFFHFFFEFCEEEBHFHIFF‡5CFEEEEFCFEFFEHEHFFCCCECFFFECEECEEECECEECEEECCBCCFCHFCCCFHEECCFECEECEEFITFFEIHFIHKLJKLJKPLNNNPNLLPPNNPPPPPPNPPPNQPPQPPPPPPPQRPNNPPPPPPPQPQPRQRQQQRPRQQmPQQRRPPPPQPQRRPPQPRRQPRRRTTURQPRTTTURT_RQTQVVTRVURRRRQUURVTURUTUUTTQURRTRTTQTRTTRQUTT_TUUQTQUTQTTTRRRRRTTTTQRRRRTTURQRNNL;NP`aTRR_TVTTQUURUTCjXRTPRTQWcVTRURRQVTRRTRRTRTTTTTUTUTTaџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџВh}zyyzzxxzz{yzywyxyxƒyxvtwvtx€wwtvsswwvsvtwxtfsomjoqrttrqprrtvtssssqopopoonnqqqopmonoonpooponomkonkmmnmmmkimjjmnkjkjkjmkjjkkkiihjjjtghfhijiijffihffefheggdegegffdffffcdceeeddvecegeffedfggfddegpafccdddgedefecfedeacdexcdcancaacddaa``a`__^_^\^Z[[ZXVXWUUR_RRRTTURRTTQPTQPPPPPQRQPPPPQPQRTQTTRPPQQPQRQQPPPPQQNPPRQPPPRRRRPPPQPPPQQPPPPPQQPPPPPPPQPNPPPPPLPNPPPPPQPPQPNPPPPPPPNPNPPNPPPPPPPPPPQPPNPPPNPNPNNLLKPPNLNJKKLKKKKLNLLXKLLKJKPLLJLKJLJLXKJKKKJKJKLKKJJITC<5433322//-/205AVCBHIFFHFFFIJJILL\QQPNNNLLNLNNLLKKKKLWJKWIKKIJJKJJJJJJJJLPQ^^QQRNLKIKHHHFIHIFHIFHFIIJHHIIIIHFFFHHEHFFZHEFHEFFFEHFFFEEEEEEEFHCFHHFFCECFEEFEFFHJJH5FFCFEHFHBFIHFHHFEHFECCCECECCEEEFECECCCBCCCFCEFECCEFECCEEFEECFEEEEEEHIFFIEEFFIHIJJJIKLJKLLLLPNLNNNNPNNPPNNPLLNPLPPPPPPPPPNNPPNPNNPQPPPPPPNPPQQPNQPPPPQQQPPPRRPQR^PPQRTQPRUTRRTTTQQTPQQRRTTURRRRQTRUWTRTUURQRTUUTTRTTTTTVUUURTTPR_RPTQRT_PQURQRUVQTT_RTTTUU_TRPTQRRQUTTRRQRR_TPNJKN^VVRTQQTfT_RTTUQRTkdUTeTTTRVUQRTURRUTPTRQRTTRTTTURTUTTjџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЋmzzz{{zyzxzzzzzwzzzjxxywwxwtvxwtstvttstqqsvwwwsjknqqpproqrsrtttsttqpnooppopqqqqpmppnpomoponkonnnommmponkjjmmkimkjkkkkkjmmkjjjjvighighihhjighghfgggfghggfgfffffHfgecfepdegededceefedgedfdedffeeedeepecdfgddpddffeeadccddcca`ddcacaa``__```\^^^[^[[XZZUVWVRUURRTRTURRQRRRRPQPQRQQgQPPQPPRQQRRRPP}PNPQQPRQQPPPPPQPPQQPPRRTPPNPPPPQPPPPPPPPPPPPQPPPNQPPPQPPNPQPNPPPQPPNPPPQQQQPPPPNPPPPNPPNPQPRPPPPNPLPPPPNLLLNKPLNLKKKJLLKLKLLLKKKLJKJKLLLLJLKKLLKKKIJJLKJJKKKKKKKHB6402/00-///026>ECE\^IFEEFHJJJINP\PPPNPLPLKLLLLNLKKKJJJKKKJKIIJJJJIJJIHIJKN@RRRQQRRQRPQRURRTRQU_TPPPPPNPQRPRTUUTTRTWURVRURPRfRTQUQ_RRPRPTQQR_TRRRRRQUUTTVTaџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ“t|yxzzyvstyxwwwtvyvxxwsrwvwwwxvvsrvtsoopt„tw€vvspnnpopr{o^nrprtrsrppponoqqqrqqqpnqzqqpqpoponomknijkmjjmkmkmimjikjkmimkjjijjiiihhhhfgigghifiihffffhhggfeffgffddeefgefddeedwdfefeeeeefegffdeecddeceddeggecceecddddd``acdewccaddeddcca_^`ca_^j^^^[ZZZXXXVVVUUTRQTRTQTQQRQRQRPPPQPQQQPRRQTRRQRPQPPPPPPQQPPQQRPRRPPPQmQQPPPPPRQQPPPQPPPQQPPPQPNPPPQPPRPPPPPPNPQPPPQPPQPQPPRRQPPQPPPQQQPQPPPPQRQPPPPPPPPNPNLNNJLLKKLLNKLLLLNKLNLLLLNKKLKKJLKKJLJLKKLKJLJNLJNNJKKKKKKKKLKR=432000/2366@CCBFCHIIETEEJJNPPNPPPNPPNPPNKLNLXKJJIKJWKJKJJIHIUHIIFIHFIIIFHHFFFFIFFFFEFHFHFIIFFFFFEF/;5FFFFFECEEEEFEFFEFEEEFEFFCFEEFFFHFFHFEEFFEEACBEEFEFFHIHFEHEFFFFFFEEFFEFEFEEHFECEFFFCCEECCEABBCBBBBABCEBCBFBCECBBBCCCECCBECFFEEFFFFFFHHFIIJIKJLKKNPPKJ5LNNNNLKPKJNPNLNNPPPLNLNKPPNNLKNNNKILKKLPLPLLKJLLKPPLPQNNPLPP\PPRPPPPQQPQRPPPPRPQPRRQQRRRQPQRRQPRQQRRPPQPRRTT_TQQPTUTQRRTUReRTRRPTRUTQQTRRRRRRRQQQRNQTPQP\L[PTRRRPQQR^PTP_UQTQRRUQPLPQPPPRPR^TUVTTUVTVTTRRNPPTUTTfTTRRQRRTTQTRTTRQUTTURRTUUiџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ–ozzyyƒzwtvxyxwwxvwvxycqttwxsvt}tttt}rzor}tsvvsspnkoopqz}kjjmrqrqqr{nonpqrrqopponnoopoonppnmknjiijnmjnjmikmjmmihkkjkkkjihiikjjfeghgghigigiggfggghhghgefffhfeffhgffdcefdccefeeffdgeghgefeddfcfedecdfgedeaceadddddccccddgfaadccccaa`_^`c``_^^^^[[[X[ZXVUUVUURQTPRPRQRTQQQPQQPPPPPPPPQQQRQQQRPPPPPPQRRPQQPPRRQRPPPRPPQQPPPQQQRPPPPPQPQQQ^QPPPRPfPPQPPQRPQPPPPPPPPPQPPPPRRPPPPPQPPQPPQQPQQQRQRPPPPNNPLNNNKLKKLLLLLKNLNNKKJJLKLKNLNKKKKKLLKLKJNJKLLKKILNLNPKNKJJKKLKLLIA6423222466=@BABFCEFFHFFILPQQPPQPPPPNNNNLPLNNKIKJIJILN`IKIHHHIFFIIFHHHHFFEFECEHFFFFEEEHEFEFFEHHFCEF2Ь%RCEHEECFEEFFFFEFHRFEHFEEHFECEEFHCEFEEFFFFECFEEBEFFHHHFIFEEFFFFFEFFEEBFEEFCEECFBBECCCFFEFCBCBBCBCABCEBECCCCFCECCCEFEFBCCEEFHFFECHEFETHHJIIJLJKKKNNNKLKNPPPLLLLKJKNLNLNPPNPLPLNLNLPLLLPLKKKNKLNNPNLPPLNZKLNPPPPNPLPPPQPQQNNNNPPPRQPPQPPPRPPPRQQTQTRPPRQRUTQTQTRTQRPQBTRUR`TTRRPTQTURUQQRQTURUURRTQRTPQTQPPPRPPQ^NPPRTQRR^TQRR_RTQTTQRTUTPLPRQPQQPPRRTUTUVURWTQ^Q=LQTURRUUUTQTTRRTTRUTRRRTQRRRRUUUiџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ™wzzxyyxxwxv‚xxxwxwwwwojmtwtqmxnyqzpjnozzzoxzhht|jztgecefeimoqqrqqppoqqoppoonwtgjmnmnonoomm|nkhmmmmmjjmkmjjijhikkjjjihjiihjghefghhhgiggifhfghhfghgfefghggegffhffdeeeevddeffggdeefqdffgegdfdcddeeeefdcmPw`acecdcfdd`cddcadc``addaa_``ak^^[\\^[[Z[ZWTVVVVT_RRRQQQTRQQPPPPRPPNPPQQPPRPPQPPQQPQPPPQQQPQQQPRTQRQPPQQPQQQPNP^PQP^QQPRTQQPQQPPPPPPPQPPQPQQRPNNPQPNNPPQPPRPQQQQQPQQPQPPPQQTPPRQPQPPPPP`PNLNLLLLPNNPLNLKNLNLKNLKLLLLLIJKKLLLKLKJLLLKJKKKKKJKNNPLKKWJKJKLKH@6265234548LB@ACHEFTHFEHNeQPPNLPP[NPPNPPPLKLLJIIIIJKJJHIJJHHIHFFIEEEFFHFCEEBEFFFFEEEEHCCFFFFFEFEEH2}-FEBECEFFFEFFFFFFFEEECHFCFEFEEFFFEFHHFHFEFEEECECHCBCHHFFEFCEEFEFFEFECHFFHFCEFHFEFEFCCCCCECEECCCCEABCBBBCECCEECBCCCFEFCEBCEEFHEFCEHFFIFIIIHJKJKKLNLKKLKZKPNNPLNLKNNNKPLNNNP@AACHIEFFHEJLPPQPPKNNKLNNLPPPLLJJJLIIJIJIIHHHHFFHFHHIHHFFEEEFCCCEFFFFEFEHEEEECFHIFHHEEHKFHFEFCEFECBEFFEFHEFFFFECCCECFFFEFFFFFEEFEHFFCCFEFECEFEEEFEEHFEEEFEFFFEEECFFHFFCCEBEECCCBCBFEEWCBACACCCCFFECEEFBACBCEEEEFECHFCFFFCFHHHFFJHJJIIKKKLLKKLNNNNNNLJKKNKPNNLLLKNZLLKPLLLNKNLNPLLKKNKLZLLLPKPLLLNNLPPNPNPNPPNNPNPPPPP\PPNPPRQRPPPPQPPPPPQPQQQPQQRQQQRPQQRQQTQQRQQRTTQQPPPQTRRTQRQRRTQRQQQUTPQPRQPP=\PRQQQRPQRRPQPPRRUTRTUQRRRUTPLNNRRQNNL_PQQPQURTTRRPN3”VQPQPQQRTT``TTPQRURPRRQPTRTUTTRkџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ™dmzyzxxyxyyyxwyyxvxywtmikpo^™K[\ZHKZ[ZLLWEEFK[WWVJXLZLHHHL\Rc^LX[^cvgffocadc_^\\XWVTUVZ`dhjwmiknkijjnkkjjkimmnmihijthhhjjijhjjhhgfffhgjighhhghgfhgghgeghfghhhfgegfgfed`^[\ZVXZZZ[k\[dXVVZfm\ff\\\[\^h^\^\iE|gWeeZ\^_imXW[ejiZ[gija_acda_`P^^_\\^\XZZWWWUVV`RQTTUTRRPR^PQRRQPNPPQQRQRRQQRPRPTRQQPQQPQQPQPQQQRRRRTQRPPPPQPPPQPPPPPPPRRTQRR^QPPPPPPPPPRPQP\PPPPRPPPQQPPQQQ^RQQQQPQQQPPPPPQQQPQPPPPPPNPNPLNNNNPPNPPLLLPLLLNLLNNNN[KKJKJIKLJKLKKKKKNKNKLLJLKKNLLKIKLKKKJJJHA5400236;;>A>@BHHEBBFEJKPNQPPPNLNNNLLLNNrJIJJKJKJIIJHFEFH^IFFHIIFFEECECEEEEEHEEFEEFECEFCEEFHFEEEFFFECFCBCFIEECCEEFEFEFFHFEEECBCCCEFHEFEEEEFFFFFEECCCCEFFFHFCHBFHFCECFFFEFFEEFFEEECEEEFECCEBECCCECCCBBBCCFCEEECCFECCCEEFCEEEEEFFFEFFEHFHIFFJIKHKIK;NLKIJLLLNKNPNKPNNKPNLLLKLLLNKNXKPLPPNKNPNNPPLKPNKLK>oPNNNLLLPPPNIL;NNNL`PNPNNPPPPPPRQfQ\PPRRQPQPLPQRQRQQQPRTQQPPP^QTQRRPPRPTRQRQQRPTQP_TTTQTRQQQ^RQTRQRPPQNNhPQ\\P\PQQQPNLP[PRQQRUTQRQcPIKLNPPLKUFIUIJLLZ``PNKKH2А=TQLNLPPTQQQTRRTRRTQRRQRQUQRRRUiџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџœryzzxyzxtvywxhyyyvtwwp^k{hefRNZXVFAERTURBPBCQREUVWX^^[^`cehqc\EBEUJXZIIVVUFACQP=N>>NNACW^wrkjkkjnwhmmmijjkkkmmjjiijhihjjijhhjhhihggghgjhggXgfhfffefggffefgegggfgrhecaZXUTRPPNPNNPL>KLL===LLLLLLLNLPPTQPPNNQRLPPPQQeVR@>@CEFFCEEKKLNLNPNPLLNNLKNPNLLLLJJKLKIHIJFFHHEFHFHFFFFFFFFCCCECCFEFFEEFEFEEEEFFFFFCFFEHCEFEHCFEHHEFFFHZFFCFFEFEHCEEFEHFHFEFFEECHEFFFFEFEBEFEFFFFFFEEFEHECFFEFEHFHFFFFEEFECFBEEFFEEECECFCCACBCEEFEFECCEBCECCCEECEFCFFFFEHHFFIEIJJJFIJJJKNLXJLLLPLLLNNLLPLIWLJJHTZJUZHUVIWNLLLLLP_LPNKNLNLLJ<”=L^LVJJ^LKLJHJWJKNNLNPLLKPPNQPPPN@PPNPPPQRQPPPQQRRQRQURPPPRQRTRRTdPPTRTQRTRPRP^QQTTRRQURRRPTTRRTP\PZN^JFJJLKKLK`X^JVIJIKLZ`[Qc^ZLKHEHHIJIHBB>>>@ACBCHFECCCCHPN[ZINKLP^TPURQURQP_TPRQPQRTTQRTvџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ•mzzzyyxzxxwxvvwwwtvtx|kwsU_cdca^\WURUVdWUTTTRUUWZX\`deghvjkwie^C@PBPBPPAPPA@PAPPNNLLa=;PRJ^wzjkimmijjjhikkjjmkjhjhkiiihiihighijihgfgihhihsgghhehfgeeefggdgegggdefgea^ZRRUQNKIHH8FFEEEIHEE2E52E4EEFF8HHH65E666E5EF68HH4LKEB3B46;>QX^a_``__^\^^^^\[ZZZZWZWTTURRRTRRQPPQQQQQQQPPTQPRRPQQPQPPQRQPQQRPQPRPPQPPRPQRQQRQPPNPQNPPPPPQPRPRQPRQPRQPQQPPPRPQPQRPPPPPQPTRRPQRRRQQQTTRTPRTQQQPPQQRPPPPQPPPPPQPPNPNLNLNNNNNNJLPPPLLLNNNNJNPNLLLLJKLJLLKKLKKKLLJLNJNLLLLKKLLLLLKKJ^KFK40/05548>A@@ECCECEIKNPPPPPLLKNLLNKJKLJJKLLJKJIIHHFFHHFFFHFHFFTFTFEECBCEBEEEEFEFFFFEFFEEEEFFFCEHEFtEFFFFEFFCFEEFEHFECFFEEHFEEEFHFIEFFEFEFIFEFHCECECFEEFFFFFFFFFFHEFFHFFEFFFEEHHECHECFECEFEEEECCBEEECECCCFCCFEFFFCECECCCFHFHEEFHEEFFEFFHJIJJHJKJJKLNNKNNPNPLL[LLWKFCHHEBB>@@=>=ABFHIJUJUUJVJIIIRHRHH`BFCFFECCHRHFFQFQXRHIZITITIIKNPPPPPPPPPPPPNPPRQPPPQQQRRQTRQQPP^RRPTRRQQQRRQTTRQPPTQPRRTRRPUTQRTQRPPNKIIEEC@@AAAAABACBBBABA@CHCIJeKEC@>>@AABAA>=>;==A@>-<=-A@@BEIHIEKNNQUQTTTRRQQUURQUTRRPRTQ_Ukџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ—jzzzzxywwxwyvxxxxvxtgwtnjc^^`dt|w_g[XWZ\^^^^^\Z\\^`ccgkxoyonnnq\WVTQPCTRRRTVTUUTUVUTRPPP=BU^ogghtjiihshijjijjiiitjgshhihtihhhhhfgggfghgssigefgggeegfddeedddfgpddgfd_ZTQRr`QLKJIJJHEEEHIJHHFHHFEECHFFH6HFCCEHFEECCB3CEFJ8ECFEHEF35PX^^^`q`^^^_^^[Z[ZZXWWXT`TUTQRQRQRRQQTQRTQRQRRRQQQQQPQPQQRPQQTRRRRQP^RRPPRTRRQRQQQQPQPPQPPRPPRQRRRRRPQ^RPQQTRQQQQQRRQPPQPRTRQTPPRRRTRVTQPQRPPPRQQRPQPPPPPPQQPPPQNPPPPPLNNNPPLLNNPPNLNLPPNLPPNNLLJJJLKJKLKNLLLNLJLKJJLKKJJKKKKLKkJKLKF=;3023458@@>>CFEFEEJ^_PPPQPNKKKNNNJHKN;JLJKIIHVJHTIHFEFFHIHFEFEIHHECFFEEBCEFCFFFFECCEFEEFFEFEFCHHFFFFFEEHEFFECEFEEHEFFCEEHEFCEEFEEHHFEFEFFHCEFFFFCCEFFFFHHFIFEFEECEEEEEFHFECFEFEFEEEFFCHFFFFECCCEFECCBCEFBCERFEFECEECEEHEHFFHFFCFEEHFFHIHJJJIJIKKKNLLPKLNNLL[NLU0=<>=;;6&5666&6<<@>@A@ABAA@====)=<*;#6;'8;)==><<<<<<<<=@>>>>@>BCIWNLNNNLPPPPNNPPPQQQPPPPPPQQ^QPPTRQPQRRRTQQUTT_QQTQQQQRPQQRQRUQQRRRR`LFECAA@>=<<<=;<<;<88;);;=);<<)@-*=88'=<>>>@>@>@>CBA>A><;=NAA>0AAA'UJPQTUTTTRRTTVUR_QTURQQTPRQjџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ—w|zzzzzyywxzxwwvxvxww€tnd_Q^Q^aca_^\^\^`eexgecccdcfsjkppmoonmprngc`^[Z[[[\\h^\[^^^_^^[XVURQCX\^qdpeppdedffqqqqpfffooefpffyfooeoedeodcooedeodcamdnccddcdrcz`a`ccaccmj[XTRPeTQPNLJKPPPLKJNPPLNNPPNJJLLJLPQNKIJPLKKIHIHIJLPPLJLLKLKK8<<844658>@>>CTFFHCFIJLPLPPLLLKKKIJJJW^IIIHIHHJJFEHIIIFFFEHEEFEFFEEEHEECCCFEEEFFFEFFEFCCEFFEEEFFHHFFFIHHIFFCEEFEFECEFEHCFFFEHEEECFFFHFFEEHFEFCEFEEFFHFEHHFFFFHFEHHFFHFHFFFHFECFFFFEEFECFEFFEFEFECEEBBEEFECEFEEEERCEFEEFFHFFFIIHHEFFHHHHIJjJKKFJJKLPKLNKXLZLNZKKP)8<8688<65;=;8;;;<)8''''88<8%%5556;55555568885565&;86566666&66'&>EHVKXLNZKPPPPPN\PQPPNPPNPQNPQPPRPPPPRRPQPRRRRTRRQPRRQRPRPQQRRRQ^QRQJEEAAAAAA>B>>><=>;'<;;<<=>;<)8<<8;<<;*>@A@AECEHFFEECHHEAA>CCECCEEEEJJPQTTTTPRQQTQRQTRTRRQPRQQTgџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџƒnˆzzzzxyyxxyxwvxxwwvz…{gVededa^^^_^^_caftkwwvjhjhghmmozojmmmnowŠamizok__^`codcadfpfqpc`i\ZVUQQUXXp\\^\^^^_^^^^^[\[\[^\^\^^\[^^^\\^^\\\^^[\\\[X[[\\[[^^\^Z\ZZ\Z\[[\[\WUQPPQPNNKPPQ_VUURTTWaVVVT`TQPTRTWXh`RTTVURPPQTTQQUWWURTWVRQPNKNVWn``^_^_^\g[[f[[[XWZWUTTUURUUTQRUTRQRQTTRQQQRTPR_RRUTTPRTUTRRQRRRPRRQRTRQR^RRTRPPPPRPQQPPPQRQRRRQRTRR^QQTPQRQQRQQRQQPQTeRTTTRQQRRTTTQQQRQPPPPQPRQRPRRPPPPPQPPPQTPPPPNNNNNPPLNLLNNLNNNNLNLLNNLNNKNJNNKLLNKNLNJLLKKKNLNLPKLLJNNPLZJC@@AA<8H66>@>@FHJIHFFJKPPLLNKLKLNKJHJJJIJIHHHIFHJFHHFFHHFFEHFFFECFFHECFEEEECEFEFFEFCECCBEHFFTHEFFFFEEFHmFIFHFEFFCEFHEFHIEEFFHCEECCEEIHCEEFEEFEECFCFFFFFEFIFFEHFHEFFFHFFEHFHFHEEEHFFEFECEFEFEHFCECEEECCECQCCFFEFF3EFECRFCFEFHHFHFHFEFIFFIJJ^JJIIWIJLLNNLHJKKLJKNR&6;6658;<<==<<==@@>>>><;;;;<;<=;>8;<<<<<8;<<<>AFHKIKLL[PNNPNNLPPPNKPNL[NNPQPKNPPPPQPPPR^RRRRRQPPRTRQNQQRRRPPRQQPHFC@ABCECCAUBAAA>@BEB@@AA>@BC@@@=@AACFFHEFIKJILJIIJLNNJ[FEC3CHJIIJJHK\RTTRRTPRPTTTURUVRTTQTRRVuџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџŒez{zyyyywvxxyxvvw‡tytnVfijhihc_`accdcehnmijmjkmwmjkooznnkknnp‡нxnz{gd_^aefqgqgshjjkkied`^ZWR@;B8==EFJ@JFHCEECHHHCHCCCC=F=CB>85>>==CHLLIHHIKLNPPPKJIKKKKxIIKJJIIIIFFHIHHIHIHHFFEFHFFFFEHEEFEFHFCFFEFIFFEFFRFFIFFFFFEEFHEFEHHHHIHHIIEEFFFFHFFFFHHHHEEFCCFFFHEFFFIFFFEHHEHHFHFFHEFHFTEHFIHHIIFFHHFHHHFHFEFECFEFHIHEFTCCFTFHFFFCCEHEFCFFEFEECCFFFHHFEEFFFEEFFHHJIJIKJKJKKJLNLLHHJLK^KNVB!6;686;=@@;==BCP@CACBAA@=<<<>>==>A><=>@>@BA>>CABVAABBAB@AACA@-@CFIIVLLLXKJLKJLNLLKWLLKNNXL^KKKNLLXNPPLP[P[[NPPPZ[NPNPNLPZNNZNZaVFAB>@@BBCBBCAEBAFH[JHEEHCCIIIEACRFEKLWKJLKP\QPPQPPPQQUPPKJFHJWLLLN^JXNTTTVTTQPRRTRRRUTRRQTTPRUgџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‰nz{zzzzzywwƒyy‚wvxxwws^gim}okmhfeerhhijnonihjjmkknnnoopmmkknocwВvUheUR^^cfddegiihkmkm{hdac`_[[[[^XX[[^[\^Z[Z\[\[XJX\ZZXZZZWXWWWVWWJXWWWWVIZVVUUVWVHUXWUTTUTFUUTETRRTWWQ>>PPNNPPRTTUVegfXX[ZXWVZ[WTVWWWWWWWZZXZf\ZWZ[\^^^\ZZ_zPTWvKHV^_`_^\^^\\[[g[XZZZZWWWVUUWWUUTRTRRUTTTQUUUR`VTRU‘WUWTTTURQURRUTTTR_TUTUTTRQRRQQPPQTQQRRRTRRQRTTRTRRTT`TTTRRTTRRURTTRRRTRUURUUVRRRURQQRTURRTQRRPRTTTTTTRRQTQRRPQQQQQPPQQPRPNNNQPPQNNNNPPKNLmLNPPPNLNLNPPLLLKNPKKNPNNLLKLLJKPLNLKLEHUIFIIB88=><>FHPPLKILPPLJNLLNJKKKJJIIJJJJIHFHIIHHHFHHHHFIFHHHHHEFFFFEFFHEFHHHHHHFHFFFIHFIHIHFHJIEHHFHHHIIHFFHHHFEFJKJHIEFFHFFFFFEEFIFFIFFHIFFEFIIVwIHJFIFIFFHHHHIIHJJHHHHIFFHEFFFFHEFHHHFIHJUFEFHHIFFCEREFIHHFFFHFEEFFJHIEHFHIIFEIJJIHIIJJJJJKKKKJNNLLJJLKLNNT*5;<N@CABAACPBA@EC@APCCBBFCCZREHIIXFEFFBFFHEABFEAEFHCEFFFRCFFFFFFCFEFFFFHFHHECHFHEFHHIJIFIKHHIHEHJHHIFFEFHFFIFFAA@>@@PPABB@ACBBEJVKVHHJIVVVJJHI\JIJgPPLPQRTUTPdTRRQRV”QPPLLPPNNPLKPKKLQUUURRPQTRRQPQTTTRQRTQTTuџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‰szzzyyzyyyzzzzxxvvxxtr_koposrpkhffjknnooqpo^nnkmkmnpnnqqommoondpahhedffdeggfiijhgjkknyjigffeepyepfoeoeoeodneoedcccmmdmccndmmqkaj`|caka``aj_`i^i^^i^_j`^^hh^h^^^^^[\\^^[VRRRTUWZXWXZX\ZZKZXWWWZ^\^XXXVVVVXXVHXX[\[WZL[\\\^_\ZNgЮdJI›m[X^aa`^^^\^^^\\Z[X[ZXZWZVTWVWVWUVUUTUUVQTUTVTTUUTTUWdvWRTQUUUTTTURUTRQ`UTTQTUTTRTQRRRQRRRUTTRTUVUTRRRUTWTUUTQRUUTVUTVTVTVRUUTRTVTTVVTRPQUPTUTUVRRTTTTTRRRRRTQRRQTRRTQQQQPPPPPPPQPPPPPNNPPNPPLLNPPPNPPPPNPLNLPNNNNNLNNNNNPNPPKNLNNKHEILNPaX<8<>>>FKaTPNLLPaNLKINKLLLKKKIJJIIKJHIHHFJHHIIHHHIFHHHHHIJIHHHFHFHFFHFIFIIIIHHHIHHHIIIFIHIEFIFHHJIIIHHHHHFEIHIKFFHIIIIFFFFHFFIHHIHFHIHHFFHHHHHHHIIIHHHHHIFIIHIHHHHHHFIFHIEFIIHUIHEFHHJIHHHHIHHFEIHFFEHHFIHHTIHIHIICFIIFHJJFJIFIHJJKKJJKJJKNNPLLNXJLNNNJF%8>=>=8@NB>APCEEEHFECFECQACEHFBCBHIEBFICCFIEHHHUH\VF5[KIHFJHHHJIIFHUIFBBCA/)>00@0*A#00*00*00@0#*-F-00#00*A3//3/33/-2%-3/%-0#**22-*#00>>=*@ACA>ABACBFJJHJHHIHKKKHHIWLLNNLNLPQTReUATQTTQRRTZkCQ\P\PLLKKLPPNIINQRRTRR^RRURRTTRRTURRRTVxџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‰szyxyyzzxxzyzyzyvwvƒqnzprsstpnkhimoqpqpppqopqpopoopnp{ronopqoomkmmikjjikjjkmkmkjjkjkomkmvhjjijkjkkijihiisgihghgggfehhffghhfeffeegfeeefgffefdddddodcedc`adcccddcaa``m`_^^^^^^^^`_^_^^\^_^^^_`_^`^^^^\h^\^^ZZX\^\ZZ^^\\jk``_^H>aZN>CJ^URRNNNPKKKKKJIKJKKKWJIKKIIIIIIJJIHIIHHHIFHIIFUIIFHFEIHIIFIHFFFHHIHHHIIHIJHIHHHHHHFHFHHJJIUIHIIJIIHIIIFIIIHFHHHIFHFFJIJHIHHIHHIIIHIIHIIHHIHHFIHIHFFFFIIIHHFHIJIFJJIIJJHEFHFIIIIIIIIIHFHHIJHHFHEIFFFHHHJJFIHJHFIKJHJHHFIKJIIIWKLLNLLLLNKLLNPNLVC);>A><8<>AACCFFFEFECBEEFFFHJJKFBEJI5HJKJJVKIINNKNLIHKJHEEJIJJIIIFKLKHHHFHEBBCCBCCBFBCCCEECCCECCEHFCCCFEEEFFFHHIHHFFEHHUHEHFECHFEFFCHHHFFFA@A2AAABCCHILHHIHIKJLJIIHNL@P@FJPTU_QKKLKJJKJJJJKJJJKKJKLJIJHIIFIHHIJIIJHFIHFIIIIFIFHIFHFHIHIHHJFIIIHIIIIHIIHIHHHHJFHIIHIJHFFFIIFIFFHFEHHIHIHHFFIEFHIJHIIFIFHIHHHHHIHIIHHHFFFHHFFIHHHIIIIHJJHJHHJIHHIHIFHHHIFHIIHHJIFFIFHHIEFHHHFFFHHHHHIIIIJIKJKIJIIJJKKJKKKLKKLKNZKNKLLPLLKWE);=TK848>CFHHJKJFFIHIJIIKJV;PXH&KKHKNNKJKKJLPZKLPNJLLKKJKKLLJLKKJXNLLLKLKKKJJKWLLLLJVKKLWLLNNXLP_PL^ZPZZXLXLPPP[PNZPPPPNPZN_ZZNZ[PZZNPPPXLVIIHFJJKLZNPLPZNZNNNNNNN[PLPPPP\PQQTRTRPRRURUVaUVRRQQR^QQQQ[NPcQNNPQoTT_TTTRQRQRRUTQRRRQRR„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ}rzzz{zjxzwvtyxzxwwwsqnopsttrrqropqrrrrqrrrsrtrrrqtssrrroqrponpqqoppnnpomoonknpoonnmnnmmnoommmjokkxjjmkkkkjiikjkjjjkikihkjjjighhhhhhgghhhgthggrgffihggffhgefggfefgefdegfddeeefdcedddeeeeccedfcdddcccda`dddedaccaa`acaa`ddecok\UV[N6тЄAqa^`_^^^^^[\^[^Z\Z[ZZXWXZXZWWXVVWWVUVUVVUTUVVTVWWVUVUWUUVUVUU`UUTUTUUUUUVUTRRRRTPRRTRUUUUUUTUTTVTRTUUTRUTTUVUVTVWWVUTTVUWUUVUWVVUTTTTTUTTTTUWUUUURTVUTUUTTTTTRQRTRRRPQQRQPQPRPRPPQQPNNQNPQQPPPQPPPNPPPPNLNPPPNPPNPPNLPLPNNKKLLZNZKJJL^\KFBA/AAEIKKQVVQ6LJHIIKIJKHJEHIKJJIIJIJIJFHJIHJIHHHFFFIFFIIHFFFFFHHHIEHIHIIHHJHHUFFFEIIIJHIFJFHHHHIFIIHIFJIJFFFEHHHFHFFHIFHIHFHIJIIJFFHJHHFHIHFIHIIHFFHHHFFFJHFHIFHHFIIHIHFIHIHFFEFHFFFFFIIJIHIEFFHHHEFHHHHEFFEFHHHHIIFHKJHJJKIHIJIKIKKJLLJLLNLNZKLNPLNKLH=;=>P5PWVLKNLKKNNLLJLJKLLILdNHALZNZLLKJJNNNJJKLNLLLLKLLKJLLNPPLPNLKNLZNPPNNNPPPPNNPPNNPPPnNPQQPPRRRQPRPPPQPRTQQRRRT^PQQTRTPRQ^RTQQ^RQRP`NP[P[\PQQRQPQQPRPPQR^QQPRQQRTRRRRQQURUTn@TVRTUURQTRTVTRTRNLKPcPPQRRfEVRRRRQPPTQRQUTUPPQTT„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџyzzxzywwttw‚ƒyyxvvs|qrrttrssrrrstsssrtrsrtqsrrsqtsrsrqrpqnnrqonnpqqoponooonooqookoonojnppookkmkmmnkmjkkkkikmijkijhjkijkjjkiiihhhhihihhhhhffhfeffhhhffgghgghheggfffddggdccddcceeeefdgfffecfedcfdaoccdcddccdcd``acdacda`dfea^[WWNi>џџVga``^`^^^^^\^^Z\ZZ[Z[XXXX[ZWUXUVUUUTVUTUUWUUTUUTVVWVTTUWWUTUTTTURTVRTUUTTQTTRTQQTTRRTUTTTUTTUTTUQRURTTRTRTVVTUTUVRRVUTVVUVTTUWUUUU`TURTUQVUTVUTTTUUQRRRRUTTRTRQQRQQQPPPPQQRQPQQPPPPQPQRPNPQQPPPLKLNPQPPNLNPLNNNNLNNPNLNLNNKNNLNKLJILP[PILNIEHFHPQLLTfRNLKIKJKJIJKI5JIHI`JJHIIHHHHIFFHFIIFHFHIHHFHFFEHIHHFEFHFIHIIFHFHIICFHHFHIFFHHIFEFFFHIFFFHHEFFFFHHHHHHIIHHIIHFHIJIVJJIIFJIHFFEHHFFHHHHFHHFFJIIHFIIFFHFHCIIFFHIIIHHHFEEHHFFHJIIIIHHHFIFEFFFFFFIEHEFIHHHIHFHIHJJIHIJHHHIIJJJKKKJKLLNLNKKLNNPL3W@><63JXXPPPNPNNPZKKNNJNJILPLJщ'PNNKLKJLLP=LLNLPPPNNNLNNKLPNNPNPPPNKNNPPNPLPNNPN`PNQNKPPNQPPPQQPPRRQQQRPRPQPUTTTRRQQRPRRRRRPTRRTRUTUTQQRPPTTQQQTRTPRPRRTRTRTRRPPRTRRUTTTTVTTTRUQ_RTTVTUVVUUUVUTUTTPPJKPLLR^PURURRTRQPQPTQ_RRRRQRRV…џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџwj{yzyzyxxwtxvyzxxxtrrqsvtrssspstttvstttvttsvtprqrqrsrqpsqpporqqnooopqonnqqoonnqooopnopokkoppmjonmmmkmjmnkjjnmmjkkjjjiihikmkjjiijhighjhhghheehiecffgggggihehhefegfgfddfgeadddedfgedfeefgeeaadfddcaddceecoaadeca_nccacccdock\VTW[dЅy„œNLKLJJKLKLLLLLLLLLXLLLLLJJJKKJJJJJJIJJKJKKIIIJKJJIIIJJLJJJIJKKKIJIJJIKLKLLLKLKKKNZKIJJKJKKJLKJIKJJJJKJJJKJJWKJLLJKKKKKLKKJLJKKIJLKJIIJKKJJJKKJKLJIKKKKJKIKJLJJWJKJJKJIJKJKKLKLLLJLKKKKLKKLJJKJKLKJIJJLKKLLLLLLJJKNNJLJJLKLLKNLNPLNPLNNPPPNNPLNKKCB>P#!CV`PPPQPPPLLNNPNPPNLNLLPPPPPPNPPPNLPPNNPNNLKKNLLPNNLLNNPLLLNNKPLPPNNPPNNNPPNPNPP>PPQPQPPPLPPPPPPPNQQRPPQRRQRTQRRPPRTTTeRTTTT`R_QQRTRRTTRVTTRTUTTRQRTTQTRTTT`RVUTURVWTUTUTVUTTTUUTUVWVUVVVTTUTRQcK55@\[PRPNNNLPPPNLNPPKNLLKLPP=PPLNPPPLLNKKLNLLLPNNPPPPNLPLPLLPPNLLNPNLPNNPPPPPNPLNPNPPPPPQPPQPN\PPQPQTRRPRQPPTQQPQRRRTQTRQRRTRRRTUURTUUTTQQTUTURTRQUUPRQUTRPRTRTfTTUVVRTWUUURRRUTTRVVVWUVTVURLN^QLJPRRRRRPQTRPTTPPPPPRQQRP„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџŠkyzzw‚vyxwywyzxtstsv{hTjopr}rttstqstvrrtssvsrtsrtssqrrsrqrpqnpqpnozmoponooponnnnonmpnnonmkmkkmkmonnmmmkkmkmmmjkmkkjkijjhkjhjhihhtijhjiggiggfggghjjiifehggfffhhhjtijgfeeeeedcdeeeddeddddccdededddcddcddcddccdcnaace^oa8AQUX[_ccca_c``_acaa`ca_madca_a^^^`_``a_^`^`_`^^^^\__^^^^[\^^\^^^^[[^ZZX[ZZXWZ[[XVWWVXWXWVXWWWWVVXXWWXXZZXX[XWX\[XZZ[ZZ[ZZXZZ[Z^^\\[\\[[\\[[^[^^\\\^^^\\\\^\^\\^\Z[^^\[[^^\^ZZ[[[\[XXXXZXZZZXXWWXWVWZ\XZXXXXZ\ZWXZZXWXWVVWVWVVXWVWXUVWVWVUURTTQTRRQRQTW;k2Qq5PПF\FPQPNNPPQPPPQRPQPQQPPQPNPNPPPPPPQQNNQPNLPPNNPNPPPPPLPPPPPLPNPNQPQPPPPQPPPPPPPNPPPNPPPQPPPPNPPPPPPPNNPPPPPPPNPPKNPPPPQQQPPPPPQPPPPPQPPPPNPPPPQxPPPQQPQQPP\PPPPPNPPNRQPPPPaNPPPPPPQPRQPPTQPQRPNPPPRPQPPP\PPRPRPRPQQRPQPfQNQPQPPPPQPPPQQQPPPPQPPPQRRPPPNKJFAT2BV`PNPP[NPPPPLNPPNKNLLP[PNLLNNNPPPKNNPLPNNNPPNPLLPPNNNNNPNL_LLNPLN\PNQPNLKLPZLNNQPPKNQPPPNNNQPQPPPTTQR^PPPPRPPTTRTQTQTTRQRRQTTUTQVTTRTRTRR_RUUTRURTQUTTTTUUTUUTUTTTUVVUQRRTUUVTTTVVUUVVUQLJNPPKPR^QQRTTRPQUUQdPPRQQTRT„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџuhyyxyxvxyyywxxyytttvrjXjpssrvvtrstssstttrqsstssrrrrqtrrpqrpnqnnknooomomoonmnonmoonppnpznmmnokjjopymomkjkkjjkjkkjjkjjihjihihhgghhghijhhgghhfehfjhijgegfffehefhjjitigfdeffeedcfeeeddfeaccdcceeedaccccccecaaaa`cdcWvО^2TUZ^__a`adcdcdaccaa`a``cadaa^a`^___`aa`_^__^`^^`^^_^^\^_^\_^^^^^^^[[Z[ZZZ[ZXXXXXWWXVVXVWTXXVVWXWVWVVXWWXXZZ\[[ZfZ[Z\\Z\XZZZ\ZZ\h\^^\\^^\^[[\^^^\\\^\[^[^\^\[^^^^^\\\[\[\\^[^ZX[\\\[ZX[[ZX[[[[\[[XXXXZZ[[XZ[\ZZZXXXXWWdZXWWXVWWXXVXVVWUUVUUUTRRTURTAQQRBPNPN>4B5RNNPPPPQPQQPRQRRRQQRPQPPQNPPPPPQPPQPPPPPLPPPPPPPPPPNNQPPPPNPQPPPRPPPPQPNPPPQPPRPPPPPRQPPQQPNPPPNQPQPPPPPPPPPPPPPPPPRPNQPNPPPPPQPRPRPPPPPPQPPPPPNQQRQPPPNNPQQNPPPPPQQPPRQTPPQPPQPNRPRRPPRRQRPQPPPQPPRPPQPPRTP^QQQPQQRPQNQQPPRNPQPPQQPPQPPPPQRPQQQRQQRQPPKVFB;32@UZPPNPNPPPPLLLNPLPPNNPNNJLLZKPNLLLNKLPNPNPPPPNPNPLPPNN[NNKNLPNLPPPPPPNPKLLNJLK[NNNPPPQPNNPPQPP\PPQQPPPQPRPQPRQRPRTPQUQQQTTUTUURUTRRQQTTRTRTRTPRRTVUTVUTTUTTVTVRUTVRRTTUTUTVTTUWUVVUURTPNLLP[KPRRPNQRURQRRQUTPQRPRRRU„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ{zywxxxxvxywwxxywwwtsnFkrtsststtrtttssrtrsrqrqrprtrrqqrrrqpopnpoomoonppnnknmpnooopppopnoppomnnmnmmnmmmmkjkkjjkiijkkjiiihijijjhghhjghhhihhgfhhgggijiggffffshfgggghjhghffdefefecdccdceddfedddeddeadaacdddcdcacc_aaaPŽџC4TZh_`amaaddacaacc```a_``ccm_`aa___^`_`^___i_j___^^^^_^^^i\^^\^^^^^XXZ[ZZXZXXXXWXWVaWaaTVUVWVUWWTVVVWVXWWXZZZZZZe[[[[Z[fZ[X\\\[^g\\\g\g\g^\\^^\\^^^^^\m^\\[^^^^\\^^\^^\^^[\\^[X[[\^^\\f[X\ZZ[X[\fZZXX[ZZZ[ZX\[[XZZ[[XXZWZWXZXVWVWdVXXXaT`VVVTURRTTTRTRQPPPLLKJKPNPPPQPRRRTQP^QRRQQRQRRPNQPQQ\QQPPPRQPPPNPQPPQP\PPPPQPQPPQNNQQQPyQPQQPQQQQPQPRTQRPPPQQPPQQRQPQPQPPPPQPPaPQPRQRQPQQQPRRPQPQR^QcPPQQQPPQPQP\PQPPQPQRQPQRP\P\ddPRQQQQRRQPRTRTRRQQRQPP^TUTQRRTRPRPQQRQQPRQQQhQQTRPRQ_UQQQQ\PQQ^RRPQQQQRRQQ^RR^QRRRQRTQPRTRQPNNKfB;4#@UPPPPPNPPPNKLLLLNNNPNNNPNNNLLPLLZPKLNLPPPNPNPNPNPPPPPLNPLKNLPKNLNPNPNNNNNLKLNPNNLLNNPNPLPLNPPQPNP^QPPRPPPPQPRPRQRRTQQRQRURTVTUTQPRQQTUTUTTRTRRTQVRRRTRTUUTTQVVUUTTRUUaUVVVVTWVVVUTTRNP\PPQP=NPTR=TVRT_QPPRUPPPPQTTRwџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџpszywzyxyzxxvxyxyzˆyywpHh€vsrrsttvvtttsrrqrsqsqsqqrsrroqppppqqpooponoonnnpnmnpommnnnnonmmnpnmmykknmmmnjjikjjkjkkjigkhjhfgjjigijiijhhiighffhhfjighihgfdffhgshgefsggegfggddfeeefccadddcaeddcddccceeac`ddddeaaacaack^Wє5WXfn__i`s___i^^i`_a^^^^h^^__^\^^^[\^^\^\m\[\\[\[\[[[f\[\\\\[eZX\\[dXWVVXga`VV`UTQTTRRRTRQQRPQPQRRPRTTTR^TTVWWUVUVccXWWXXWaVWZZZX[XZWXXWXXZXZ[[X[[[Z[[X[Z[ZZZZ[[ZXZ[[fe[\[\[e[WVZdZX[ZZXXZiZcXWXZiXXWWhXXXWWWWXXWWVWaVVWUWWgV`VUUUoU_VUTRQRTTR^QQ\Pa^\PP[PPNLLJKKNNNNPPPP[QPPPPP[PLPPPPPNN[PNPPZNP[eQPPPPZNNZPPZLNZP[[P[P_NNLNZPPQPPPPPNPZLNLPP[PPPP[NPP[LPPPP[PPZNZZNNPP[PPP[PPPPNPQQPNPPPPPPPNPPPP[NN[[LPP[[PP[P[PPPPPPPPQP`P[QPPP\QaQQQQQPNPN[PQPRcQPPQ\QPPPdP[[P[QQTdP\QPPPR^^\[PPPPPPP\\PaPQa\QQPPQP\RQQ\\aQ[PPPQ`PXLKUF@=4@UPPPNPNNPNPLPPNNPPPNPPNPNNNLLNLNKNPNNKLNLLPPPNQQQNPLNPNNNNNKKPNLPLPNNP[NJKKNNNNNPNKNLPNLPPPNQPNPPQQRPRPQRRQRPQQTQPQRRPTQQTRUTRTPRUUUTRUQQRTUTQQURRTVUQTgTTRUTRCVUTUTWXTUTTTUUVTRUVRRPRQTRNKaRRURTRVaRRQQRRRRQQRTRT„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџirzzyzywz‚yxwxxyxxzzxw€Z\qttsqqqtvvtsssqrsqqrprrqrrstqsopoqpqqqpnnnnnpmmonnkopnnnomnnmnoomnmkmonmjknnmkkjjiimjmmkjghikhhhjihihkhhiggghghhfhhghjhiffhgggghgghfgfgggffdfgfeegfgfepfdpedaeecdcddeecdc`acddcod`cedn`^JEQk@IX[ZZJWXXZJXXWXZL^`JXXVWXXWWWUXVUUTWUUVUVURUUTTUUUUTUUTURVUUTRTTURRPPPPQPPLLPPNLKKLKJJJJIIIJIIIJJIJJKJJNKKNPPNLNPQRPPPPPQRPPQRQRVQUCTTUTTRRWTTURTRUUUTRTTTTTTTUUTRRUURRUWTVURRTRTTUUVVRRRQPQQQQQQQQQQRTRQPTRQQQQPQPQPRPPPQPPNPNPPPNNLLKKJJKJLKKJIIIJKKIKJJJHHH\IIHIIHIHHIJJIJIIHJIJIIIKIIJJIIHHHIHIKIJHIJIHHHHIHHIHIJHJJIIIHHHIJJFIIIJIIKFIIHIIJIIJIIJKJIIJKJJJIFFIIHJIIJIIJJIIJJIJ^IJLKJIJKKIIIJJJKHJKKIIJKKJKI%6>JZPNPPLLPPPNPPPPPNNLNPNNNNKNLLPNPNPNLPPPNPNPPPRP\PNNPLPNNPPPNP[LPLPPPNKNKKLLPPNNP[ZLNNLPNNNNPPPPPPPQQPRRQQQPQRQRQPRRQPRPRRPQRRQR_RRVVRTTTRxUTP_TRRTTUTVUTRUVUUUWUTUVVVfQVUTUUUUURUTRQPQRNPRRTUTPTUpVPTQTQRTTQRRRT„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџpqzyjxxyiyyzxw‚yyxzwwv}m^pssspqswvtwtttsrsrrppqqrstsrsrpoo{oppnooonoqoonpmkmmonnmomknonmmmkjmommmjmknkkkkijmxjkiiigzjkjjjiijvjihihhgigiiihhhihihggghgegefffeefffgfddfggdfedgedfecdecdddcdedcocaccaddcddaaaacda\UAW[[JWZ\JVWUUWVTVUUVUJ`ŒCWWUTTUTTUTURQQPRQPRQQPPPPPQQPPPPPPPPPQQPNPPPPNLLLNKKKIHIJJHHHHHIFFFEECEFEEEEFCEFFFFIHFJKJJLLLLKNNNPPPPNLPQPNPPPPPPPPQPPPQQRRRRRQTRPRPPUQTPQPRQQRQQRQRCRQRPQQTWTQTQQPPPNPPPQQPPPNPPPPLNQPPPPPLNNNPNKLLLNKKKKKJJIJJIIIHIIHHHFHHEFFHHHHFIFHFHFFHHFFEEFFFFHFFHFHFFFHEFFEHFHEHEEEFFEFHEFFEECCHHFECCEFECEECFEFFHFFFEEFFFHF5FFEFEFFEFHHFHFHIHHJ8IKHEEF8JJI;J8HIHJJH8II;;;J;IK<PR2‘TfjUeW‰WPfQvTT„XT`TRcw[idk‡K_Ї^caoTTQiTXiV_Б^@ƒЏ)ƒhvp\wWJ‹XWsXc|XiUiiUfWtV`gqPyUP…RgTQQˆTTTnT^_hU^TgT`fVh^UTRRdhRh_VgpiURhXzXXkiXWdoˆmjqU`cmmXcspoqˆ‰Ÿ;CLNPNNNPNPPNPLPPPNLLNLPNNPLZPP`NPNPNQPPPNPPPNKZLPPNNKPLLNLPNNNLNPLLNLLNPNPNNLPKNNNPNNPNNNNNNPNPPNPPPPPNPPPPPNQPPRRRQQQPQRQRTPTQTRTQRPRRPQQQQTQTRURTQRURRTTTTUTRURVURTVUTTRRTURQQRQTPTPNPRgRQQQPTRPRQRQQTRRTTVT…џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџhozyzyzywwtsvtvtwyxwtttq`psvrtpsvrssssrsrrsrqqssrrrrppqrqoprrpppoppnonppooommommnmjkxnmmmjnnnnkkmjkjnmmjkkkmjjjiviiihiikiihggifhjhggihijggiighggghhhfhgefdefeefdeecfffggefeeddcaddcaca`ccadadcccaacccdcpefn_ZR>Wk[\^[WVZXZW[XTTUTUUTUUVXTRTURRTRRPQQRQRQQPPFzVQLNPNPNPPP\PPLLPNNNNLLKXLNKNLKJHFFECCECEBBCEAAA@@>BC`>A>@@>BAeEHJ8`IIIJXKJZ[LLQUVVUqBTUfUT[g[\XZUUcXUTT_QPPUUTUTRRVVVUQRURQQRQQTUTQQPPRQTQRQQRURTRTRTRTQRRQQPRRRRRPo`RQPNZPPLLLLLLLKIHJIFIHHFHFFEFFECHHFFFCCFEFHEFHFFEIFFFFFFEEECEFCCECEEFCFFIHFFHFFFEECCFFEFECEBCCFHFFEEFFEFFECCEHIFCEHHHJHFEIKH5HJIJJKJKJKHIIIKKLcKJJIJK<[NIJPe2d4PPNPNPPKX=_KN^PPNPLQCPQTRARXUP^@PQLNPKPPPPNLL6ZKLNJINLLPLNLNLJJKKKJKKNPLKKL\LIJINKLLNPPNNKN;PN>LNNKPPRP@>=<<<=<<<;<<<>@ACAABBXEFHHJFHI`KJINLLP`KPNPLNVgVRRQNLKPLPPPNNLNPPNNNNPQPN[NPaNPPQPQPPNNPKPNPPPNPNPLQPNNNPPQPPKPLNLNP\PTTNLKJKLNKIHIIJKHHFFFEFCEEFEFBCFBBECEEEBCEECECEEEEFFECCCCCCBECBECCCBCABBCECFEFCEEFCECBCECCCCBAACABCCEBBBBBACBA@CEBBBEBCCCBCBCBCAECCCFFHEFHFFFHFCEFEFHFFHFFHCIJFHEFFEFHEFEEEFCEIHHFFEFJHKJIFFHIHFHFHFEIFI6FFFFEFHHIJHEFFJH6FEFEEHEFEEFFECFFECECEEFEFECFECEEFFCEECEEFEEEHHEECCHFEC3CCEECECCEFHHEHEFEEEFEFEEFCEFCCBEEFCEF-F@##@EJNP[LPPLNLPQPPNNKLPLNLPPNNKPNNPPNPLPPNNNPPPPNNNNLNLKKLLPKLLLLLLKNLLLNKLNJLZLPLNNLPLPNLNLNNLLNPNNPPPPPPNPQPPRPPPQPPPQPRQPQRRT_RRRURTUQRRRRR^PQT_QURUT_TTPRPRRRTURTUURWVRRTTRRPTRTRTRKPPPPPRTQ^RQRPPQRRRQTRQRR„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџgozzzzxwxvwtxtrtwvstwxvt_stsromqvtsttssttsrprrqpqssrp{prprpqqpnpoooopnoqonnnnjmmmkknjmkmjkmnnjjnkkjkimjkjjjkjivigjkjjhiiigghhhghjgghigghgihihggghghffdfgffeefdgffffggggdedeeefdd`adcedaacda``ac`caacaddcqmZPLP^RQRRTU_RPQPPQQQPNNNPPPPLNNLLLNLLKJKJJJJLJJJIKHIIHFIFHIIFIJJHFHHUHHFEEFFECBCABA@A@=><=>>=;<<;88;688;888;8;<<>=@@@AABBBCCBEFFEEFFEFHHHJIIJNPNIJIHHFIHHJJIWJIILKLIILJHKJJIXKKKNNKNKKKKJLKLKKLKKJJZNKJIJKKLKJLJKKJJKKLKKJJJIIIHFFFFFFFCECCCECCBCECABAABBBBCBCACECABCAAABBBACBBABECBABBBBB@BBBBABBCACBBBAABCBBA>B@AA@ABBA@B@@@@@@A>@@BAAAAABA@AAA@AA@@>CACCBCABBABABBBAAABABBCBBCAECACBCAAEBBCA@BAB@@CCBCBAAABCBCBBBBBE@CBBCABBEA@ABCCBABAAAAABBBAB@ABCBABAAA>BACBCAAAB@C@BBA@ABABAAA@AACCABB@@@BCBEBAAABA@BA@B@BBEBCBCABACBAAAA@@A@@@>A>BAA@B><6Q^LPNP[NLZNLNPPLZNNLLLNPNLLNNLNNNPNNNPNKLNPNPLNLLPNKNKKLPKNKJXJPLKLPLKLJLKNPNNLKPNPNKNLKNNNLZNNLPKLPNPQN\PPPPQPPPPRPQP^TRQQTQTQRTPQRTPTRTRQQPQRTRRTTTRQTURTRRRTTTUTTTWVRTTRTRQRPQQPPNJNRPQTTTPQRPPRRRRRQUQRRTwџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџd}{yzyyvyywxywstvvvxxyypqtspm_ortvvssstrtsrtrrrqqprrqqpnoqqopqpnpqppopqpnommnmkmmmkmmkmnjkkkmmjjjihhjkjkmjkmjmijhihhghhghhiihhthhhgihiighgggfgfhhhggfeeegfdggffhgefgggeefddedddcxaodecaa```_`aca`cadcdegz{RLLNPPPPNPQRPNLPLPPQLLLKLLLNLLKJJKJLJHIIIHIIIJIHIHFHFFFEEFFFFFHECEEHFBBBBBABBBA@@@>@@<<<<<;;;;8;665658666566668;<;=<=<=>==NBBBAAABCCBBBABFEFEFFECCEBCEFFHFHFHHEHFHIFHHFFFFFEHFIJIHJIHHIIJJHIHJJJJJJKJJJIJIHJIKJIJJIJIJKIJHIHHIFHCEEECBCBABC@AACAABAAA>ABAAAACABABAAAAABA@AACAAABA@AA@@@@AAABBABBA@A@AAABAA@@@@@@@AA@>AAA@@@>>>>A@>@@@>>@A@@@@A@>@@@B>@@@AAA@A@AABAA>@A@NAAA>AA@@B@AAAA>A=>BA@@@AAA>AA>>A@AA>>@@AAABA@@>>A@@@>@A@>>>>@@>>@AA>TAAAAAAA@@ABA>@@@>>BCA>@@@@AA@A>A@A@@@BA@@>>A@@@A@@>@@@CA@A@@@@@@B@A@AAAA@@@AAA@BA@@@AA>AA>@@>>>@A><8@of>@>===<=<<8;<88;88665644554554566566888<;;;;<<=>>@>>>>>A@>@CAAAA@CBABBAABBBCAEBBCCCEFCCECAECECEEFEFEEFFHFFEFFHHFHFFEFFFHHFFFEHFHHIIEFHFFHIIFHFHFFEFBCBECEAA>AA@A>BAAAA@>>@>@A@A@@@>AAAA@>@@@@A@@A@=@@@>A=>>>A@@AA>@AA@@BA@>A@@@@@>@>=>>>>>A@@>@>=>=>@@@>A>>>@=>=>=>>>>>>>>>>@@@@>@>@@@>@>@@>>>@>>>@>@<>>>>=K@>>@@>@@W@@>>>>>>>>@>@>A>@@B>A@>@>@@>>>@>>>=@@@>@@@@>@@@A@@A@>>@@=>@><>@@>@A>@=@@>>>A>@>A>>AA@@>@@>@>>>>=>@>>>>@>>@=>>@>@@>@@A>>A>@>>@@>@@>@==@@@>>=@@>=;8C…m@LNNNLPNNNNLLPNLKKNNLLNPNPNLPQNLNP”LKKPNPLLKLNPPLLLNLLJLJKLKLZPLLNLKLNLLLLJNNKPLKLLLNNLPNLLNPNKPQPQPNPPN[PPPPRP^^PPRQPTRPTPRRRTTQRQRRPRPPPQRTQTUTRTTQTQTTTTQURRRUT_RUR_RQRPQRQRTQ=PNQPQTTTPRQTQQQRQRRTTRQ„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџdrzzxyxxvxxwxxtsvwvxyywvpq}ssrqssvtttsrvrsrssqssqpqrsrqqqqqrppnoqonmoopnnpmmnnkxjkjjmkjnmnijmjwjjmkjkjgiknjmkijvihjthihhihhgghjhggivihhhyihfgfgghhhgefehgffedefehgdefdeegfeeddccecccacc``a`aa_acctdcfjƒ{WA=>@>>==<<<=<<8;;685655555444334354334443444556686;;8<<==;<;<=>=<=>R><=>@=>@@>@>A@AA@@@A@BAAAAAAAAABBCCBACBBCECCCBECFECEECCFCEEFBFECEEFCCEFEFEEEHEEHCFECCCBAA>@B>>>>@@>>@@@@>@>=>@==N@@><>==@>>>@@>>@>><>=<>>@@<>@=>@@@@@@@>>@>@@A>>>@>>===<==>>>@@=>>><<=====>@=><>=<=>=@=<>>>>>===>=>=>>@>>=>=@@>>>>=@@@@>==>>><><===>>A@>=>@>===<==>>>>>>@>=>>>>@=>=<=<@=>>=>=<>=>=>@>>>@=>@>>>>@>>@>=>==A>>=>>><@@>>>>@>===>>@=<=>==@>=<===>>@>=<>>>===V>@>>>>@<@>>====@@>>=>>A=>>===@<<;4F|\LN[PNNPNPNNPNLKLNPNLLLNLPLLPPPLPL>LNLLNPNPLLNPNLLKXJLLKLXNNKLLNNKLPKNNLNPLLNLNLPLKLLLLNNKNNPNPPPPNPLPNLPNNPQPPPPPPRQPRTQRPPRQQRRQQQ^QTQQPPQPTTRQUTRRRTQUPRQTQUUTTRRRQQUQQQRQTQRP>>>@>@@>@>@@=<=<<<<<;8<<<<8666554444534444432433333333433445444565888;888;8==<=<>=>====<>@>>=>@@@>@@A@@ABACCBBABBABBCBABCBCCEBCCBBCCCECBCCCECEBECCBBBBA@A@A=@>=>>>>>>=>>=@>==<>>><>>>@>======><>===>==<=======>==<=>=>>>>>>@>>>>>>=>>@===<<<>=<====>><==<<;=<===<><><=<<><=<=>==<<==>>=><>>>>>=>==>==<<=>=@=;><<>@><><=<<><===><=<;==>><=><==>><>>AA@^<>><<>>===>@@==<><>=>=>=><>>==>==<=<=<>=<<=<><=>=>==>>><>=<=><<<><>=<=<<<==>=>=><<<>=<>=<;<<<>===<==<>><>;J<;>>=>=<<<<82@UhNLLPPPNPNPPLPNPNNNLKNKPPNLNPLPNKNNJNNPPNKNNNKNPKKKLNLKLKLKLKNLNKPLLNLLNPPNNPLL[PLKLLLNNKLLPNLPPLNNPNNPPKPPPQPQNPPPPPPRQRPRTQRQPQPRPQRQRPQPRTTQQRRRTUQQURQRUUTURQQUQQTRRRRQTTQPNHIP^PRRPRRPRPQRPPQRQRRUU…џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџb}zzyyzyyxywwxyvxyxy{zˆ`nqqrrcsvvsrrqsrtttsrqqrqrqprtqrqqrppnpppoppnznpnmnommnmjmmkmkkknmmiwihjjkjkhjjknjijjjhjhhjhfihhghjhhghghgjgeggghgfghhghhigeefffhgegfcggfefeeeefadeeecddcadc`dc``mm`a```aaaezvT=HFHHHHHHIHHFFFHFFHEFFFFFEEECECCCBBBBBCAA@BA@AA@@>@>@@>>===>@<===<===<;;<;;8;;688666666544434433443230342222222332233342335545556666868888;868668;8<;<;8;=<888<<;;<=<<=<<;<<<=>A>@>@@>>@>@@AAA@AA@ABABB@ABAC@ABBAA@AAABABA@@@>@>@>>>@=>=<=<<===<><;<<<<;=<<<<<<;=>>=><<=<>=<<><;<<=<;;=<<;=<<;<==>=>===<==>=>><<>=<;;<<<;<>===<<<;;8;;;;<<<<=<<<<<;;6<<<<<<<<=<<>=><<=<====<<<<<<;<<<<<=<==<<<;<<<;<<<;<;<<==;;<<=<=<=><=;<<>==<<=<<<<<<<;<<<<<<<<=<<=<=<;;=<=><><<<<8;<;;<=;=<;><==<<<<;;<;=<<;<<<;<<;<<===<<=<<<=;8<<<=<>=;<<==<<=;;;<;><;<8;=8884#'#[s@>>>>>><=<==<<><=<;;<<;<;;;8;;8;5666654565644543345222023302223022@220000222030323334444444444565546464586686566886888888;88;;;<;8;<8=<==>=>><=<;=>=K>=@>>>@@>A@@@@@>@@@@>>A=@>>@>><>=;<>=<<8;<;<;;<<;;;<;;=;<;<;<<<<;=>===<=<<===;<;;;;<;8<;;<<><;;;<=;;;;;;I;<;;<8;=<88<;<<<;<<<<<;=<<=;<;<;;;;;;;<<<<=<;;<8<;;;;;;;;<;I<<;;;;;8;;<8<;;<;<;;<;;<<;;8;8;<<=<<8;;8<;<8;=8<;;;;;;;;;;8<8<=8;;;8<<<;=;;;;=<<;;;;;<;<<<;<<8;<=;<<<<<<<;;;<;;8;<<PPPPPPNNNLLLKLPLKPKLNLLNPLLNNPNKNNNNPLNNKNNJKNNNLKKLLLLIKNNKNLKKNNPKKXLKLZNNPNNNZKPPNKNNPNLKKLL[KPLLNNLNPPPPPPNLPPPQPRPQQPQRRPQQQQPPPQRTRRPTT_RTTRQRQTTTUTTQ_TQRTPRUQPPPNJ8KZNPPQPTPNPQPRQQQQQPPRQT„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ`|{yzxyyyxxyyvvvvwwvyxv{^mpqosrqsrwwsttrsvrrssqrrqqqrroqqrqpnoqpnononnnmkomnnkmkmmnnkmkkijjkikkjjjjjkikjkijjghfghihighitghihhhgihggfgghhfhgfggfgfffgehfeggfqfdffeeeddddddceddccccccaadc```_a`^`chˆp4/CCFEFEEFCECCECBBBBAABAAABB@AA@>@@>>A>=<<><<==<==;;=;8;;868665688888866686644545342444330320220322/0@000020//2//P200200222/2022042434323436443444424444445544545565685665568588888<<=<<<;;;8<;;<<<<=<=<==<<>=====>@<=><====<<<;;;8;;8<;8;6;888;888<8;8<<;6;6<;<8;;;;8;;<;<<;=;8;6;65668;888888;8;;=<<;<<<<;<<><<;<<;888;;;8<<=;;;;888688;;;88;;;;8;;8;888;<8<8;;8<<<;<<8<;;8;8;8;8;8;<888;;;;8;8888;;;;;88<88888;H68<8;;;;8;;<;<88;8888;;8;88<888;88;;8<;;;<<8;<<88;;;8888;;<;8;<8;;<88;;;<8;8888;;8;<8<;;;<;8;;;8;;;<888;<<;8<<<8;<<8;;<8;6;;668866;868542'!@‚xQ>NPNNPPNPJLLLNNLNNPNZLPPPKLNNLLJLNNLLLPLKLLLNLNKLLNPKKKLLLLLLNKKJKNNLNJKNLNLLKLNKNKNLNNLPLNNLNLLNPNNJLNNNPQNPPPPPQNPPQQRQRQQTRPPNPRPRQQRPQPQQRTUVTQTTTRURTRQTRQTQRRTPPNNLLLLLNPPRRPQQPQRQQPQRPRTPQR„џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ`|zyyyxwywxzwwwxxvxwyŠ€o^noppqqrstsvtvvtssrvstsqq}rqqqqpqqoqppnponoopnmpoonnnnnnnknooonkkmkjkkjkhkkjjwjkkjjjhhjiiijhihhhiiigfhijjihihgsfffgghgfgfgheffeeefgffeeefefdcedacdecdfdda`dac`ccaca_a`_ac{‰q4FABABBBCBBABBAAAA@>>>>@>>>@>>==<=<<<<<<;<;;><;8P8888;8688843444555645445544434344233223322320202022002020//00200////00H400//2/0/2002222032232222345322033334444333344444455444566566886866886566;8;88888888<8=<8<<<;8;;8<LPPPPPPPNLKLZLNLLPLLLLNLPLPLNLPLLLNKPPNLLLNNLKLNLLNKNKJKKKKNPKNKLLLNLJNNNNNZKLLNKLNNPNNLNNLLLNNNNPNKLLLLLQR\NPLNPPPPQRPPQQPQQ^QQRQPQQRTPQQQRQPRURRT_RRPPRQRQPPRRQQRPPPPPNJNPQQPPQQPTPQPPNQRRTRRTTPƒџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџP|{zzyvwxyxxywwwwxyˆxzvqmmqmoqpq}pttststrrqttsvqtssqrrppppqrqqqnonokononmnonmnmmmnnmkonmjnnijijkjkkjjikhjmmiiiigihgjiiiiihiihjhijhhjigigfggegfhfgfhggwegdefegefdedeeaeecceecfdacaaac`a``a_a_mcadg‰q;&>P@ABABA@>>>@@>>>@>=<=<<>=<=<;;=A@@@A>=A>>>====>=<<=;<=<<<;<;;8;88;;8888856666665465634544434445434454324544344232220222332222202242223020-/0/0/00200220002022220/23332230@033222K222323432443222433332234354344456556664664545864556444865685;<865455554445544343444444545245244545545554564556658656566858456555546544686565586656888;86888866685886868665888886686656;858;6665866656556465688688;;66658568668885566885556686666668885666655686658888858;86885665;86686868668886665668868868666;;5868F66668668;88;8;8;;6568688688868H<888;86N;8;8;;;;688<;;;;;68888868686;886866688;8868853&&Aw{R>KNPLPNLLKNNPKLNNPLLKNPLKNNNKNLPZKPNLZLKLJLKNKNLJJKLLILKKLLKLLNLLKKJNNPKKKKKNLKNNPNNLKLLNLPLKKLLLKLLKKNLKJNNL[NPPPPPPPNPNRQPRPPPPQRPPTPQQPQ^RRTPRRRTQTTQRTRRRPRTRNN\PPQ8LNPPPPPPQQQcQRRRPP^QRPRRƒџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ[|{xwvwwwwvwxwvvxxxwxxsorrrmi^p}sssrvrrsqroqqssrrpqrprprqqpppqppppppoppnpnnnkmkkkknmmmkkjijihjmknmmiiiihjijikjiijthiifhjghghffghjhhffgggeghgdefefefddffeeeddeeeeddcefadTceccaccacd_a```c`waTz n2*<==@>>@@>>>===<>===<<;;;;<<<;;;;;86F686566646566864555654334343333444443253433434323434333332322200000343200@0020022022020020223320232332222003323323!32322233233433322343323334445365645552585554545546446666;8688565544545344444433B3434444324345445565865556646855P6556668856456556454555688;5685686866888N;6;6;8668888888;5666866688868<68;6<8F;66686;;68;686888;;8;88668668888885656888586666886888;8586668685666;888;8;8866688888<68688888688;88888;;8;;;;<;88;8;;6;;66;;;;6;;;<<;8;=;8;888;;8;;6;8<;<8;<;;;;;<;;8<;;;;<<<;<;;<<;;;;;;;<8<;;8;;8;8;;86;86B/'&0xQNKNNPPJLNNKNLLPNLPLNPNLNLNPPNLNNNNKNNLNLKKNKKKKJKNLKJJKKKJKKLLKKNKLNLPKLNLNKNKLJKLNNLNKPKLcNJLLPLPKKLKNKLKLLPPPPPPLPQNPLPRPPPPPQQQPTRPQQRUQPRTTRQTRPTRRRTVURQAQRPPNKP[NNPLKNPQPQPPPPPPQPPPPTTRRƒџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ[{zvvsxyxwwvxhvwvwwxˆ‡tppprqmkpsttsssrsrrssqpqqsqqrsqqqoopppoppopppqooooonnmmmknmkmmnmkkwkkjjhkmjmmjiiiihjijigiihhihfsghgggghhhghgggfhfefgdhhffeceefedefedddeeqddaadedeacddeddacaaa``_``cccei‰m2#;<=>>>>>K<<=<==>==<=;;8;;8;;;<;<88666566866655555665545654345433444344434443433343334242242522033402324433232002022/00200222223222302223220202232332243333333432433022224243223455554C56565544544344454344646556858;5543244343434433233433434444544554565556658565665558;5664566688455554666666668688868666;;888868;8888888;888886888886;6688688;868588;8868868868888;;<8668668866868;8866888;8668;8;;<;<868W68;8<;8;6;8;;;<;;866;8888888;8;;8;6;68;;;;<;88;;;8;88;8;;886;88<<;8;;<<<<<;;;<8;;<8;;<;<<;<<;;;8=<;<<8=;;;;;;<;;;==><<=;<<<=<<;;<;<;;<;;<<;8;<88;85840'&!ixQLPPPNPNNLLZKLNPNLNNKNNNPNPPLPNLKLKKNJKKNPNKNNNKJJLJJLLJLKKLKLNLKLJPJKNNPNLLKLKKLNLLKL_LNKNLLLLLNNLKNLPNLJLNNLaNKNNPNPNN\QNPNNNPPQPRPPPQQ^RRPRQTTTTQPRPRRTTQRRR^PPPNNPPLPLNPPPPQNPQRNQPRPPRTRTRџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ^{zxvyyxwxvxxwtvxywxtoopqqpoqrstsqsrssrrsr|sqqqrspoqpqopqpoopononpooponnmknmmknkimikkiimmkkkikkikjhjijjthijjhihhgffghjghhgfhgghhhggffqefffgededfdfffefdddeedefacdcdcecddccdca_`ac`_```acX€[));8;===>K<<=====<<<<8<;I;88866;888666646666655656564454454454444244434545533343344334435323343334435433342333432323222222032322230024303323322233333334332323333443332334243244324544444555566456445443554444466556566644333333352443444233433444443464554456566466555866668;;6866666665666868668868886688868;8=<<8;;8;;8;;;;;88;8;8;;8;<<8<8;<<;8;8;8868<8;8888;88;;8;;8<;686;88886;;;888;;;<8;<<;8;8;;;<;;;;<<8<8;;;8;8;8=;;6;8<;H8888;;88;;68;;8;;;<=;6;8;<<<;<86;;8<;;;;<<;;;;<<;<==<<8<;<=;=<<;<<=;=<==<=J<<==<;<<<=<<;8;<;8;H;;E3-&)!){€8NPNPNLNNNPKKNLPPPNNNLNPNNP[LNNNPLKNKLLNNNLLNLKLJIKLLNKKKLKLKNPJNcKLNLLKKLLNKLKLNNNNNKNPNhNLZLPLLLLLKLNPLLNPPLLPPLPNPQPNQPPNPPPPRRPQQPPPQRQ^TRTRTTQRRRUQQQQRTRRLLNPKNLPPPQRPPRP>PPPPQQQQRRURQUџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ^rzzyx‡xvwwvwxvwvvtvvxxsnpqorttttssssrrvsrrrs|rpqqqqpqprponnkommpnmpoznpmnnmmmmkjkkjjkmkmmjjkmnjhjmjhgjgggiihihhffgsg|jhigehgffggggeegefdfqefqeeefffedfecddeddcdaaaecdca`_ac`_aa`^`_`cag|ˆZ**8;======<=<<<;;=<<<;88<86866886668666646686885666866545454433543344444454544324344444444433544334333433324343422402332222000322232324202230244343433433234244433444444334334343443444455454454345445443544I455E54544464543030222233344533344443344443445544555556466555656688;<66F668888666868;;;666688;<8;;8;<8;;88;8;8;;;8=;;<;;<8;;88<;;88;8;;88;;;<88;8;;;8;;8;;;<8<<8868;;8;;;8;;;;<;8;;;;<8;;<<8<<;<;<<;;<;;;;;<;<;88I<;8<<;888;8<;8;<;6<;<<;;;;;<<=;<;<;;;<;;<<<<;;;8;;8;=;<<;==;<==<;<;;<<<==<<>=<=<<=<<=<=<<=<=><<<>==>;<==><<===<===<<;;<<<;<;;8;=;;;8<;;;60'))2„yT5\PPPLLNKLLJJNNPKKLKLLLLNPNLLLNLNNJLLNPKNLKLJJIKLIJLNJIILKKLKLPNLLLKLLKIKILKLNLNNNLNLNN<<<<<8<8<<;<<<<<<;;<8;;;;;<=;;;;;8888<;;=<8<<;;8<;<<;<;<;;;=;<<<;<<<;8=<;<<<<<=<==<<<<=<==<>===<<<<<>;<<;<=>=>><<<<=====><>==<><<==[<<;<<<==<=<;;;8<;8<8;=;63*'&)Aj‚UANPPNPKLLLLNPPNLNNLLLNLNPLKLLNKJNLKLPLLNPLKKKWKLLKLNKWIKJLLNKPLKLLILLLKJNNLLLKNLKLKJPNLKLNNKLNKNLPNLNPNPNNPNPPNNNL`NLPNLNPPPPPRQPPRTRRTTTTR_RQRTTRURTQTTTPNPNN`PPR\PNPQQQRPPQPQPRTPTRRRTQQU’џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ^nyyywvxwxyv€vttwwwyxvvrkjzonoqtsrsvtstqrqrr‚rqrqprooqpooqnponppkmnnnoookoomkmmmkjkjkijjjkkjiiihhikkhjkkkjhhhhjkhhihigfshighiifggghhhhfffghffedeefefffddddcdcddddddaaaa`aa``a`c_``____`Te{“U'!4588=;;8=;;68888H88666666;566655668564654656656645454446454443344434444334344444232343434434322333032333333442334243432322022332322333332322202324033253234443334333432344343444343435355445545444444533432344334435433303000000020202202220203343224234534B343355545555566;866888H85568888;<;<<;6<=;=<<=<<;8;;;<<<;=;=<==<=>==<<===<=;<=<<<<<<<;<==>==<<=<<<====<==<@=<<<==<<<;;<<;;<;<;;8<<;<<<;8885-*'''dˆT@PPNPKNNLN`NNLNKPNKKLNZKNNLNJNKKKKLKKLLLLLLKIKLLKJLJLJLKJLNmPLKPLPNLLLKJLKKPNPLKLKKNKLLKLLNNNNLNPNKLPPNNKZPLPLPPLLNLPLPNPNLPPRPPQQQTTPRQTRQRPQRTTRPRTRRTQPPLPPNPPP=LNPPPPRPLPRPPQRPPQQPRQR’џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџenzxyxw‚xwxvwwvvvvxwwt{^joqm_prqrttttssrqprppqsqqpppooppqppopzopoonnomnmmookmmnknjkijmjhjjhjmjijmiimjkiijjijkjjifghigggiggghghhgghhieegggggfeeefdeddddd`c`cddecc`a`````aaa`a^a``^^^^^`f‰}T%22488;;;8888668656;66868666566555666456455455454564454543445233444342334223223333224442443234353332323022343433334242444200H22203H22232222222330202223343323423233342323242333343332334456453423444435232333023234423322220-/0/0///////-020000/000200002033324343443556455a546668666;688666666;8;8858;68868;8;;;8;8;8<6;8;;;;<=;;<;;<<8<;<;;<8888=<<;;8<<;6;;8;;8;;;;;;8;;;<8;;;;6<;<8;;;868;;<=<=<<<=;=<<6;;<=;<<<<8;<=<<<<>=<<=<==<>>=<>;==<=<>>==><><<=<<<=;;<;;<<;<;;8;<888;;86F52-**&'!zgT=QLNJLLKPLKKKNLNNLXLLKPLPPLNJKKJLLLKLKLLLJJKLNJKLKKLNNNKKJLLLLLLLNLXJLLNKKLLKNLLILNNLLNLNNLPNKNNLNNPLPPKNKLLPNLLPPNNNNPNPNPPPQPQRPRQUURRQURRQRTPRRRQPQR^PPNPNNPnNKNNPQRQRPPPRRQPPQPRPRPRR”џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџi|zzyxyxzwywvswwtvvtwvtp^mpppoqrqrrpssqstrqqrrqrqqrqnorqpoqqqpoomnomopommmknknnkmkmkjjjjkkkkkmwjijmijmkjijjjkjhhhighiggeeefeffffghgehfgffggehffdfddfepdccacccaddcad`_ca_``a````^^^^\^^aq’P##024858;8;86866656656566565654543545655644465445536545446444444433342332434234332022233344343343534333222023233323232334322023222022332223322202/202222320323322023343422020222223333333544444342233334332222222002323030232/E0/*/--/-/0/-0//00//00/0000020202434333455455544454558;P558886666886886;)=)8886;8;;8;88;8;88<8<;;;;<;;<;;;<;;<;;;;<<<<<;;<;8;8;;888888;88I<888<<88;;88;;<;P;8;;8;<;<;;;;;;;<<;8<88<8;8;;;<;;<<<;;<;;8<;886;88<8<=8<;<;;;<<;;;<8;;<<<=;8;<;;;<<<;;<;;R;;<<;=><=;J=;<<<<<<;=<=<=<;=;<><=8=<><<<==<<==<<>=<====<<<<=<<;<==<;<;;<<<;;;;;;8;8;866;85/*'))'!)zULNNKLKNLNKKNLNLNKLKNPPPPLLKNKKLPLLLLKLKLLNKKNKKLKLKLJNKLLNLNNNKNJLLKLJLKKLLLNLKKJNLPLLNLLKLLLLLLPLLKPNLLZLLKLLPLPsNP>NPPPQPPPPPPQR^RRURQTRRRTTPRRPRRRPQPLNQPPLPPNNPRQRPPQRQPRPPPRPR^RQQT‰џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ_qzzyyyzyttst€vtxxtstrk^yqqqprrqqsqqttqqsqqspppnprqzopqpnoonomomnoopmmmknmikmmjjkjkjjjkkijkkkjjikjkjijihkkvhjjiiighffgfeegfffghgfefefgegfefgfefdefefdecaccaecdecacaca_^^`a^^^^^^i^^^_c­P!/0255668;8;555655665444445555654465454665344655654455345444552444344432240302222232300334252234232333032200343430322243323202303232222322233222000202222232323342423222203332422223223234354453423220332H222220000223002/002///-----*---/----//--/22/0///-00/2222223443333333444566;655PL55665856;858)Є%8688868<886886886;8;<;8;;;;<;;<<;;;<8;;<<;<;<;;;888868;8;;<8;8=;;<<;<<;<888<;8;<;;;;;8;;88888;=<;<;;;<88;;<;=;;;=;;<88;8;;<<<888;8;888<<<;8<;;;8<88;<;<;8<;;8;8<<;;;8<8;;<;8<<=<=;<<=<;<<<<;<<<;<<<<<<=<<=<<=<=;==<=<<<<===>=>=<<;=====<<<=;=<;<88;8;;;8=;<8;8886;85H*'&&)&>toN8LNKLKKNPLLNLKNPLKNPPNNLLJLJLLNLLLNLLLLLKKJLKLNKNNJLLKLNNKLPLKKLLJKKJJLLLPZLLNKJKLKKLKKLLLKNKKLLPNJJNKKLLNLLLNLNPP`P\QPNPPPQPNQRPPPTQRQPRQTQQPRRRTRQRQPPPPPLNQPPPPPQRQPQQPNQQRRQPPTPQPT“џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ_pzzx„zyxwrtvvxwwwxwqt{kTopsspoprrrqqstsrqrqsronoqoppopqooppnoopooopnmnkonkmmnjmkkkkmkjjkijmjiiiihikjghhjiijhihhhgishfggeegffffdffdfgffefegghgeegfdddddddceccccda__`___^_^^__^^^^^`a|v>--033446568666656455554555534455445545445554654545455545455345434322423333332322220320220032322332223320342223202233222222002222300200022322342000//02002324403220322332322422303222233233444443323420230/20000/0000222020///----*--)-*)-*)*------*/-/0/-///00000223033233232243645458;664455566586666#;'8668886888888;8;;888;;;;<888;;;;<;;;88;;;8;;<;8;8;8;;5;=;8;886;88;;;<;8;;88;;88;;8<;H;;;;88;<;;8;6<8;688;;8;<8;;=;;8<868<;<;<;688;;8;;8;<;;;;;8888<<=;;<;;<8;8888;6;;8;;<;8<<<<<<>;<;<8<;=<=;=<<=<=>=<<==<<<<==<<<<<=><<><<;><<><>===>=>;<<=;=;;;;;;;;68;;;;;;6;68884/')'&&'!%[jc0//0-////---=-**--*V))6*-*6)****-****)--/0---/-/000032223203232/334343654FK645455868566864866888;6;8;;8688;;8;;;;<88868;<8;;8;88<<;;;;;;;<<8;8888;=;;;<;8;e8;8;;;;<;<;;<=;<;;;8;8<;<8;;88;668<6;;;8688888;8;<;;;8;8;8;<<88;8;8;<;;;8;;;;;886<8;8;<<;<<888;<;8888888;88;8<;8<=<=<<<<;<;<<==<=<<=<<<<<<<<<===<<<<==<==<==<=<=><>><>;>;<=;;;;<;;I;;IX88;688;;888;5C3**'&''&'&J”TLNLPPNJKLLNKJNLNLLLLPNJKKNNNPLLLLKNLNLNKLLLJLLNILLLKXJLLKNLJKNKKNJJXLKKLKJNKKLLKLLKLKNJNNXLLNLPPPKLNLKKLNNLNPNLLNNNPPPPPPPNQPNPRPRPPQQPPQPPTQQRQQRPPPPLLNNNQLILPQPRRPQTQQPPPPNPQQRRQQ’џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџіcqyzzxzwwvvtxyyxwttsrspomqqqrtqrrtrrrrvsrqqssroprqppqq{pqqpopqonpmnmmonnmmjikkmiikmmmkkkjjjgijjihhjkikzihhhhhijhhighgihgfehhggfhgfgfeeefggededdddddedeeaaodcccaa_^a``^^`^^^\^^^^\ackz8/*-/0234436855443544444543C44443445434544435542344445454444443433433323022302233222020/32222004L22224332222300233343222/22202202/022000/0302022/32/202222022002220222322232002200///%52022/224342230200220/2/-///*0///00//-*/)*)*)*))'))*'*)*)'*--*)*--*-*-***-*//->/2323300220242334334444544545468656K#6F88;;888;;<88888;68;;;688;;68;;8;6;88<;;886;;;;8;886888868;;68<8;86688;<;8;;<<8;;;;;88;;;;<8;688;888;;;;;88;<88;8886;<<88;8;;8;;688;;;8<;;;8;;;;68;;<8<;<<<;;688;6868;;6;;8;8<;8;;<<<;;;<<<<;;;<=<=P==;<;;<8<<==<<<;=><<==<<<<>;;;<=<<=<<<=<;;;<;;;;68;<<;8<86;86886842))&%&%%&'etR>LNLNLKNKPLKNKKLKNKNKKLPKLJLLPLLLKZPLLKLLKKJLLKLKLKJKLKLLJINLLJKLKLNPKLLL^LNLLLLNLNNKNKJKLLKNNLNLLLKNNLKKLNLJKNNLLPQQPKNPPQPNNNR^PPPRQRPQRQQRQRQQPPPPNPNQPPJJNQPPPRPRRQPPNRQQPQN@RRRџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџїZ}zzzyxyvxwvxwwwvwvrrsqqppomnqsqprsrrssrrpsqtsrppopqpopoppnonpmnnommononnmijikkiijkjkijijiijjijiihhhiggihgiihjijhhhjghhgrffgrghgeegfefdeegddeeddeecocdcacaddt```_``a^____^\\^^^\ae„qE-'*/2344454556544454445434455443544405444434543444B243344623444342322332234223024302322022322323322023232323222U2022232220R3333202220///0022000/2200200222002022/2020F020232000002003Й%40222232324A2203000@200/--//*=2///////)-))*)))')))'*)'''')))**-***))*--**---0-/0/00//0///0222323344545455566655665588688;688888;88<6<;8;8=;888886;;;;8<68<8;;8<68;666866688;886<;868;86;;8;8;;;<;88;;<8;868<;;8;88888;68;;8;8;;;<;88888;8;;;;<<8;;;;;86688868<;;8;8<<88;;8;;;;8;;;;;;8;88888<8;;<;<;;8;<;;<<;;;<;;<<><<<<=<;<;<;<====<=<;<<<<<==;>>>@>>><<<<;<=<=<;;;;<<;8;;;;<68;;;86886653-*&'#%#%#!Fsm0LZNLJNKLLNNLLLKPKLKJLNLLLKLZPLLJNKNJKNKLNNNLLKKJKKLJKKKKKKJLKKKXKNNKLLKLKNLLKNJLNNLIKNNNLNKNLKL=<<<;=<<;<;=><==<<<=<<;><<=><>=>>=>=<<====;<<8;;;<;<;;;668888;68666540-'&#%#&%)Iˆ`<<=======>=<<=<<<;<;;<<8;;;;68;;;;8<;686686833-''&#%'##'e‡_;=<=;>==><<<>=<<<<<<<;;;<;8<;H8<;<68888;856666855/*'&&&%%%%&IƒU@=LPPNKKZKKLKKNNLKLKNNZNNNLPPKNLNLLLJNKLKKLXLLLJLLKLLKKLKXKKKKLNLNNKNKKJNNLKLLNNLLLKNKXJNLNPNZKJLNPNNLLNNKLNLLLNNLNLKPPPPNPPPNNPPPQPPQQQPRQPRQPPPQLLKJKILPPPPQPPRQQPNQQNPPPQQPQQ’џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџї^{xyvxwwxvwxtvwvwvvxwtpkjhmq|rqrsrqqqrrrqpqppprppnmoqppqpppppmkkmpppmnnmknjmnmijimmmjiijkjjjjhhgjijigjjighgghggggggifffhfgfffffefdddeceddcdcccaca_ccca`^_^j\^^_^\[^^^^^\^^^^e‘a-%&&')*/22000233342342645434233243334333W5464443323233322435322332223222200/2022000002/0300/222220000022/22202/202323202220222022@222002/22000000200000030/20/2//022002000/00//0000020//@0/////0/220000032/00-/-*--*)*****<**)-)))*)*''''&&&'&)'%%'&&#&%&''%'''''&&)'&)A**C/*))***-*-/-/*//23A233222233344444K55554655886LF68666666686;86486;6888888;66668668;8;886=;;;8;6665588<8888;88<886;88;;;;;88888;<<8888;68;;;6;66;;8;8;6;8666668;8888;88;;8;88;688;;<888;888;;8;;888865688;66888;88;<;;;;<;;;8;;;;;;;;<<;<=;;;;<<;;<<<<=<<=<;;;<<><<<<=>>=<==<=<><==<<<8<;8;88;;868R=8868F6;566643-''%#%###E{p>KLLLKLLJLLLLKNNNPLNNJLNNNNNLKNLPPNLLNNKKKNKXNLNLLLJJKNLXNKKJNLLJLKLLNNKLLNLNNNNLNNNLKJLLKPPLKXKKLLPNLPNKKLKJLNZNKLKLPPPNPQPQQRPPPPNPPRRRRRPQQRRPPPNKXLKNQQNPPRPPQPNQRNPNP^PRRP’џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџі^oxxyxxvxvwvvxvtsvsy€vomooorpqnsrqq|srqqqrsrqoooznonnopoqrqppoommnoonmomnmkkmmkiikjiijjkkhijiiihhijjijiihhgghiigeffgheffggfgedeeededfeddXUWacadc``__^aa^_^^^\\^^[[Z\\\^\Z\\aˆ%&%#&')-//2300222243B24N24332300232333243342445444332243333303333322320220220022220/220/203@0020/200@000232022022A0320022@/02/0//02/220000000200022000/0/20//20000/0000g0222/-00/-/00//-00//0/22200-00/203//--/0/-*-**-)'-))*)'))''&%3''%'&%%&&&&%%''&''&&'&'''%'#&&'&&'&*''*)*)'))*--)**-0//-04H/02242024343338P4444455665666656686666866686886688888H88688;688856<<88;6F85F8668886;;888;888686888;;888;8;;8;8;8;;;<;66<;6688688866585868888;8<;8;8686556;;;86;;;88868H68;;8;8666568656888;8;;;;;;;<;<;;<;;;88;;<<=;8;;<<<8<<;;<;<<;<<;;<<><<;<;<<;<<<=;<=<<>;<86;;;;888686;8;88;6866656853/)&&%!!!!!!#Fwe<<<=-<8;<<;<<;<<8===<;<<<=;<<<<<<<;=<;;8<;8;<;88886;;;888;666856666852-'&#!#T•i=<<;;<;;<<<;8;888888;8;68868658565688564A/'%!!#Zd;LNLNNNLPNLLLLNNLLNNLLLLKLNXKKJKLNKKKJJLKNLLNLKLKINLNLKJLLLNLLNKNKLKNKNLNLLLLJLLLLKLNLNNLNKLNPLNNKLLLJJKLLNNJLLLPNPPPNPPNNPPKKNNPPQP^PQRPPNJCAAABEN[PPPPQNPQPQPP\NNNQRRQQR“џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџыh{xwxzxvxvvvwfrtvxvtsrtvssqqrpmmpqrtrqqqstsqrqppnqpnnnopponqpookmonomnmjmjkkmmnmiimijiiihjiiihhhhhgiiigggiihgfehhfefffhgegedefdecc`ac__a`^`^^__^^^^\^^\[\\[ZZ[XWXXWWZXZia%!!!#%!&'))*/-00/2/2020020H02200233022332323244433333432323332233223333233232224423222202220203033303/222322232232332020/00223332202003220222222322222200030002220200020020/002202000000/20200203020@/00//00//-2--//**<)-''))')')'))')'&'&&&&&%&%%#&&&%&&%&&%%%'&%&&&&&%%&%%%%&&&')''C'%'''''')'))--*--/--/00020022233344444445665586;8686686;868668885;;6868;66688;866666686668;88<8866;888;888<<;;6<;;668;;<;<8;;;8<;<;6;<;;6;8;;;6;;;;888;8;88;;8<;;6868888;8688;888;;68888;;6;<;<686;;88;;8;<;<;8;<<;;;;8;<;;;8;;;<;888;=U<<4e*I<<<;<BHHWLPQRQQPQPNLPQRPNN;PPPPPR‘џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъgzxxxxxttvvvwvtx€vttrrvtssp|kvhm|tqsrrrpsttqqpqpoqpppooonzpnookkmnmnmmkmknkmjmmmjjmjijihiihhiihhihXighffgfghhfgggfegefgfdceffffecdac`_a_```_^^_`^^\\[\[\[XZXXZWXWWXXWZiƒ[%%%#&&)*'-*-/0//2200020/3203004432303433333223234234344233334323333222320002224232322233033324432022222022223322322020002034432404232320200224002032230222202302202200003000000200000000020/2/300220-0/-*-P0-/=*-**))*)*'&)))&)''*'')'''&'&&)%&&'&'%%%%&'%%&&&&%&&%!%%#%%&%%%&#%&&''%'')''*')')**)*)***/-/-0//200232344343468P6656665886668;;8<68688668668;<6;88;88886866;566858;88858888688;;I88;8;<88<8;;8;;;<;<;<==<==<<==;;;;<<;;;;88685;88888;888;8;688566643@-)#'Bo2LPPNNNNLLLKLLJZLZLNLLK>;п*LNKKJJJILKLLNKKLLLNPNLNLPLKNLLKNLNPPLLLLPNNLNPLPJJLNLNNNLLNLLNL_KKKNNKJLKPNNNLLKKPLNLPKPNPLLL[LPPPPPQPPPQhFFJJLPPQPPQQPNNNPPNNNLPP^AQPQTџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъczxxvwwtttwvstwvrqtvsttpkc_F6tosrqrrqqrsqqrqpoq{opnopnoopnmppmmmmommmmimkijikjjijijvkijiijkjiijihhiihseggghggdffdddgcedeffaedccaa`a^^`_\^_\^^^\^[\[XX[XdXXWWWVWVVWXh…P#&!!!##''))**-*--*-//2022Q0242223B85334454334333444323335443434344344333333332244434334034203244422333224345332332342333344f34323443334242233334323442233333022022/2200322022222220200222223H2000222000/-a--*-)/***-*)*)*-*')3'*&'''&)'&))''%)''''&&''&'&''&&'&%&%&&'%&'&%'')''%&&&'))')''')*))*))*-)*-/-////022222234344354655886666;688888<8<;8868;;;8<88;6;;8;<8<86;88H86888;88;8;8<<8;;;;;8<<;<;;<8;;<;;<<;I<;;;<<;;;<<<;;86;;;<8<<8;;;;;;t<;<;<<=;6<;;6;88;;;;;<;;<;;;<88888<8;8888<;8;;<<;;;<;<<;<;<;;<<8<;<<;<<<8<;<=<==<=<><<<8<==;<<=<<<===<==<=<>==<<<<<;<<;<;;;;;<<;<8;<;;;;<<;;8;;8;;<8;<8;;;6;8;;88<;;8<;<<;88<6;8888888;6;;8;;8;<88<<;<8==;<<<<<=<;;<=<;;=;;<<<<===<>>=;<<<<<<<<<;=;<=<<==;===>><<=;<==8<<;;;;8<<<;<888<8;68856655543030*&&!!R„h=8;8<;;8<88888858888;668;88888;=<<=<<;;=;<<<;<<<=8;>===><=<<<<=<><;<<8;;;;8<;;8;;<8888;888886664433300-'&!!!'!C{w=PPPLNLLLLLLNPLPLNLILJKIJKNJKLJKKKKKKKKLJLLKNNNLLNLLLLLNLKLKXLLLPNKP=LLKLKKJLNLPNJKNLLKNLLPNNLKNKKKJLLLKNJLNNKNNNKNLNLNPLNPNPaLPNP=PN6IHJKPPPNLPP\PPPKPPPPLQQPPQTQQU’џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџцdzxvw—wstvvvttrrqsvsppspopoXF'`kqrrqssqrpppprooonppppomooomnnmmxmkmjknmknnmjjhjiiijjihghghhhshhhhgfghhhffgfededeeddaacddc``ad`m^aa`_^^^^Z^\\\[Z[ZXXWVWVTUTVTTTVUW^…N&%&''')*****)-/****/--02023322344444243433434333444434333433435344443334344334434442343323323333333333223324432423222233234354323B43333323232333240332233322202032242332222023222320023320222000/00@-0//-**-/*)-**')'))6*)))))K'''&'&&%&)&&&5'&)''&&'''''&&&&&%&&%&%&&%&&%&&%&&&'')&'))%)**')''**''***)***--//0/00/000330344444458866665866;5;;68;;6;8;;;88;8;;6;88888;888888;<<;;;<8;888I;8;8;<8<<;;88<;;8<;=;;<<;<;<=<=<=<;=<=<<<<<=>==;<<;<=<;<<<;<<;;;;88<8;;8;8866586555343002-/*)!!!##A_N8NPLKNPNNNPLNLLKLKKJKJJWJNJLJLLKLLJKLKKLLKLNLPNNNKNNKNNLNNKLLLKLNNNNNKJLKKJKZNKKKKLLJLLKNJLLNNJLKKLPKLKKLNNPLNKKPKJLLLLPPNQPPKLPPNLFIHHKPPPLNN5A6LNPLNLLPPPPQPRQQTџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџщdzwvwvvwvvwtvs‡tqstvtsq_t™‡Pgnpproqrqrrrqqponnoqomomnnokmonmmmmkkknmkjkjnkjjiijihiiiihhfggghgggffegfffeeddeddededcaada`c``a^`^_a^^_^\\[[[\[[ZXXVWWWVUVUTTRRURVk|L&!!#'')*-*)-)*)*0-*--///000220233343444333243423543354333444444454434432442443343233243343422323442322333334333244333222233433T44225333333222324333323232232202320222234032222022333202H22222202//0-/0-/*/-/****)')E'-)*)*)'')''&)'&''&&&'''&%&&&)'''&&'&''&&'''#%%&'&'&&&%&#&'&%''%&'&%&'**)3)))))))-**)))*---///0022/00233243455566646658886;;88F688F68<<8688688<;88868888;8;;;=88;;;;8886;;;;;;;;;;=88<88;;T<;<<;;;;;;8<;;<8;;;<;<;<<<;;8<<<;8;8;<8;8;6888=66688<<;888;;;888;866;888868<8;;8;;;;;<8;;<<<<8;=;=<<<;<8<;;<;;=<<<===<8=;;;=<<;<;<<>==;<<=><<<<=<<<<;;8;<8;88;;;8;888;6;8666584423320//-)%##AhoLLLNKLPNPNPNPKNNNLLKLLJKJNLLKKJLNLKKNKKKKLKKLPNPNPLNPKLKKKKKLILNNPNLKLLNLNKKKLNKJKNNNIJKKKKNPLPLKKLLPNKLLKKNKJXKPLLPNNNPNNNNNLKPPNLFFFEKKNP\[L/њ;PNPNLPPPNPPPRPRRP‘џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџшizwwxxw€tvvtssvtrrvtsro_ˆ–trДkoqoqrqqpqrqpnnponponnpoopnnnpmkmonmnmmkkki{mhhkiiiijihhhgshigfhffggefeffefggeeddeedcdca`daa`a`^_^^^^^\\\^\X[XXZWXVUUTUTTRUTRRTUHjƒK!#!#&'))*)B)-*))--**--*-////2033032324443334534333534333433424443543444343333452344434333323330H332442223332332202243333432334334434322342222202224032202/2202230200202300220002/222202220000/2200/20-/-*--/)*****)')***')'&'''')#&''''&%'&&'#''&&&&%&&%'&'&%&&%&&&&&&%%#%&%&&'&'&'')'&%'&&''')&)'))**)))**)**----//303/333223334553545555568688;8666;5858<;8868;6;=;8;6;;6;88;;;8;868;8;866;;X;<;;8>>=;=;;8<<8;<<<<<<<<=><<<<<<;<;==<=<;<88<;;68;;;;;88;;68;686656333303000/-&&!'<f>KXLPNNNNPPPNLLKKLJLKKLKJLKLLKKJKLJLLLLKJKNLKJKNNLKLLLKKLLLLLPKKLLNNPPKKLKKLNLLKLKKNKKKKKINLKNKLLNLPNLLNNLLKLJPNLLNLNLZNPNLNLNLNNKHJJIJLNPLP[@84PPP\PPPPPNPPPPPRRџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџчczyxxxwrvtttrtvstttrr{ppsm;>Ainqopqrqprpppooonzpnkpnkpnnnpnknonmmmkkjjikhjhjkiivjjigggfhhhgfggffefeefefffggeccdac`_`a`a_```^__^^[^[\ZZ\XXWWWVWTTTTRTUTRQRQRHnJ%!!##%%*)-)***-)*-*)**-*-0---/0322223233333303434233443424343333455553443343323343444443432322042323334323233333323323532343344444342233333342/@34432323302222222232/2220000000/223220@222000000///-/0/-/*-/-**-)*)))-')))')''''&)&'&&&''&'&'&&%&&&%#%&&&&%'&&&'&&&%%&#&%%%)&%&&&&&&%&''&'')%'))C)))))-))*&-)**))/--0//0/2000000333334445565856888H<68;6888;88;;8666;;8;88;;5;8<;;68<;86868886<;;;88;8;<;8;8;P<<;;;<<;;<;<<;=88<<;;;;88;8;8<;<<;;;88;<8688888;8;;6;;N<8888<;8;<;6;;866;888868;;888688;88<;8;8;868;8;;<8<;;<;8;8;;=;<8;<;;<<;<<=;<;=<><=<;;=<;;;;8<;<;8;;;;8<<;;68<;6868886666643433303020/-'&!##&P<<<<;;;;;<;8;88;<;8;;8<<;6;<=<<<<;;;<;;88;88;888;;<88;;;68;;8868;;;66888888;;68;88;;;8;6;68;<88;8;88<=88;<;<;;;;;<;<;<;;<;<<;;;;<<;<<<=;<;=;88;<<8;;;;8;;<;8;8<;;8888868;66465433/223002/0/-'%#!'=„p3JKPNNLLPLJLPLKJLKNKLPKKKJKJLILJLLKKKJKPLNLKLKLKNPPKJKNKNNNKLLKNNKNKNLKPLLNLJLKLKLLPNLLJLKKNLLKNPKJJLKJLNKKLLLLPNKLNKNNNLNLLLLNIHJJIIKKJNZLNNPNLPPPPNPQPNPPPPQџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџк^zyxvwxtvwvrrrrtrrrrq|rp}fV=Bcxqrrrstqpprqqqonnopqnpmkonmmmnnmjjjkmniihmmnmkjjighhhihijieggdgeegfgdcdedddaacca`a__^^_a`__`^^\\[[XZ[XVWVVUUTRTTRRRQRPPPPPQTczI&!##%#&%))*''))''))*)*)))*-***-//00/023334434334244643544544454334444444434354333434N343444444324344244322434334333254434434433334544444334323242442333223224332434002020222200022332320330/000222220020/0//*-)---**)--*))**''*)-))'')&''&&''&'&')''&%''%&''%&%'&&&&'%&%%&&%'%&%&&&&&&&';'&'&%&&)'')*'&)*))''))**)-*)-*-*--//-/00020033344443366556688;;;8866;;88;888888;;;8<8886<<8;;;8;=6;88;;<;6=Q<<Ho|qpqsrqrpqqponmmnnmpoponmommkoommjjkixiiiimnmjjiijhggfsigffeedefdffdddcaeecc`caa``_j^_`_^`^^^[[XZXVWWVTVWWTTTRTPRPPQRPQPPPTk€I%!!!&&%'')))'')))*))-**)*))-)*-*-/-/000442434444455545564554545554646555455564354544433565544455343344455445544444443444444434556453544443444444333343443433324332433234233233434433433443222232302323220/00///-----**)***))))')*-)''''')))'''&')''''''&&''&'&''))'&'''%&&^''&'&&&')&''*''')*))'')'))'*)**)'))-***--**-**///0//0202202343444446668486666;;886;;;<8888I888;;;8888;8;;;;;<;;;<888;;<8><<<<=;<<<=<<<<<<=<<<<<<;<=<<<>;<<><<=<=<>><<=8<;<<;;<;;<;<;;<;;;<<<8;;;;<==8;;;;<<<<8<88;<<;;8<;8;;;;;8<<<<<<<<;;<;<<<<<<<<<<;<<;;;<<<=<<<<>=<;<;<<;;<;;<<6=;<<<;8;;;8;<8885854432322030333020/-))&##={mPKPPKNPPLNJNINNLKLKKNLNNKKLNKJJKKKJKKLLNKLLLPPNNLKNJKLLKKJKLKNNLLLLKJKKKKLKNNKKKLNLKJNKLLLKLLKJKKJJLKKLJNLKKKLNKLNPNZKNNJLLKLFIJKJLJLNKKKLPPPNPNPNNPPPLPPPLPџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџк`ywzwtvtvstsrtvsssttrqqqq}fVBXtoqrpoporpppnppknpnnomo_mmoonknmmkkijkwkhjjkjjkiijjihfeghhgeeffefefeeccc`dda`aca``^^^^^\_^^\^^Z[ZXWWWUVUVTTTRRRRRQQPPPPQPPUkyE%!!###%''))')*))')'*)''))))*))))-**-/22345355544545666656656566866886655555665644646556655655464455545654545555554456545644555565645454564455444554546544544546455344434443344445564344344443343B3240340300/0/0000*0/-0--<*-*))*-*-*-*))*))*)*')')*)'&')''))'')*&*)')*')))%*'&**)C')')*')B))--/%%*)-*-*-**--*/-------/0//02022200320222345544445688688;88;;;;;;;<<;<;<==<>-=<==<<<>>=;<=<<=;<<==<===<><<<><=<<==<=<<<;<;<<<<=<==;;<=<><<<=;<<<=;=;===<;<><=;<;;<<<<<<;=<<<;<;;<<;<<<;<=<<<;<==<<=;<==;=<<<<==<;><;=><<=><;;<<=><<<<<;<;<<<;;<<;<888;664333220220200320//--*'%#&={}NKNPPNLKNPNJN_NLLNNLLLLKLNLKLLKLKLJJXNLJXKLNLPKPPKJLLNKKKNKLLLLNLPJLKKLLKLLJLLLLLNNJKNKLLNNNZNKKJLJLKLKNJLLJNNKJPPNLNKLLNKNKJIFJJWKKXJKJLNNLNPKNLPNPNLPPPN\џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџдe{zxytxvvtvtsvsstsssrrqqq}pIB>dorqrpnnoqpnppoooooomonon^mnjnnknkkimkhkjikkiihgijhfhigfghffdeeeedefddacaaa`macc___^^\\\^^[\\X\XZWWVVUVVTTRQQPQRQQPPPPPPQTz…C!!&&%&')'')'''''''')))'')')&)*)-)-/00334455655556685688688858666;8886<566655688666;;8=;;886866664658666666666556865656665566668<86886865555656568F6566566555556555565644544445565544555644545654542444220222300/000//--/*/----/---**-)--/*0-----*)******'-*)-*******))****)))***)))/)*/-**-*О'--*-//----0/-/0-//200-002223322323323434556666886888;8<;;<;<<=<<;<=<<<<<<<;J<<=;<=<=>=<=;;;;<<<<>===>>@>=>=>@<0Њ)><====>@>=<>><=@>===>=<<<=<>=>>>>>>>>=>=><===;====<<;<>=<===<==<<=<<<<=>><=>>=<=<<>>>=><<==>><<;;<>=<<>=;<===><<=<<<<<==><<>=<>=<=<<<<<>=<><<<=>===<<<<>==<=<;<<<<8<;8666C30220020202022/-/E0*-)'!#)xkLLLKLNLLLNKLLLJPNLLKLLLLPNNLJKLJLKKLKKJXLNLLLLNLKNPKLLKNNLNLKLPLLNNNJXKLNNKKLNLLKLLNKLKLJKLNKKLJIKNNNLNLLKNLLLLKPLNNLLLKLLLJHEHJKJJJKKJKPKKNLNKKPNNNNPPPPP—џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџе^zxwwvxvvsvvrvrrsvtrqrqpqpfJB>|nqppopppoopoononnnnnmnonkmnmkmmmmjkjjjjjimmkjihhihgfhhhfggepddedefedcdaa`aa``__a^^^h^\\^\Z[ZXZWVVUVUTTPRPQPNPPPPPPPPPPQTqmC%#!!%#&&&&))))*&&))%')'*))'''')')-)--)*--23466566;;;*=-=)@>))////--=/)/>///='<-*--='===-/00@)/>-)>---<*--=-'-<*<*<<--=-=***<**<-<<--=---<<<&*<=<;)*<'=<*<<;;;;););;;;;))<)'88';;'8;);;;888888;^%88;88888865545444434333222000022!2!0!02///02!#200/0/#/#/--/--00--//0-///**---*--/-/0///-//--00/00///00220222022200222344545545454555555668;;);<<;=<=<=-==>>=>A=>>>>>@>=@=@>=>>->>@/>>@>>>=@@>>>>>>>>@A0@@@A@@F''@@0A@@A@@>@@@@/A/@>@@A>>@>>0@AAAAAB@@A@0@>>@>@>>/@>>>@/>A@@A>>@@C>>>>>@@@>@>@>@>>>000@@A@@@0@C/>@>>>>>>>>>>@A/@=>>@/@>>@A>>>@>>>>=<>=@@C>A>>>@>>@@>@@=>=->><=<<<<<;8;8545420/22/0000000-/-00//-)'#!!#8qoL8PNLKKNKLKLLLKLLLNLLKLJLLNNLJJKLLNNLLLLNLLNLNNLLLLJLLKKNPPNLLLNLNLNJKKLKKKLNLLLKKKNNLLJLLNLNNLLLJNKKNNLLLLLLKKNKKLLKJLLLWFHECIKKKKJJJLNPJLLKZLNNLPNPLNPP џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџдdyyxw€xtttsvvstqqttvrtsqrywXP>t}qpnqpqoppoqommnkmnonnknpnpnnnnmjjikjkkjkkmihhhhiifhgffffedddeeddeec`ca`c`_`a^`^^\\[\Z[[\[XZZZWVTUVTTQPRRPPPNPNPNNNPPPRpxB#sC#%#%&'&)'&'&))'&'&'''''&''&'&)&'')*)B//023568&3;/'40//&&&&/3-#*%--&/&/2--//&/3&&33-;6CBA@A>><6F64232////0///-0/-/-/-/-/-))'%!!6wtNNNLNNLPLJLLLKJPLPKLLJLLKKLLLKJJKKKLNNLNKKNKKLLLNLNJLNJLPNPNNKNPLKLKLKKLKLPNJKLLKKL[PZLNNLKKNLKKJJNKLLNKNLLLKKLKJKJJLKLKJFT0FJILNKKKIKNNLLJNPLNNPPNPPNNP џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџй_yvxvtvtswstsvvtsststtsqpowHB>enppoqpnooqqonnmmnnknk^nnpnnojmxikhkkijjkjijijfhghhggeeffgfdccadcddaa_a``^^`^^^^^^\[[XZXX[XXXVUWVTUPRPPQRRPPPNNLNPPPQTj{B!#%#%%'&)'')'&)-')')&''')'''''''')*)')))---/2236QHIPJIEQNNB;EEEK@>BBB6=A>B6=6A52@@5HA4<<4;3;/=>;;IPC66;;483*=5@<;/83;86;/8345662=-3;0/3;;'40A6-4-'')6282>0;=EBHRQFXK4/224&;3'535385466@5;;5)56-88828;@<;;;@@@@'E;>=3>;;33282;>383C=2=8226-=32=->>3;3/E444/34>;3<5A>2<<;3/;3;33&;>4AIA@;4@@A2A5A=>>>AHHCI>HA=IBIA5J43JABA>IBH@<5dHHK=AUCC5JT@LIKJexmooooqonoponnomnmmnonmmkmmknkmmmnkkmkjjimjhjzgihhhhffegfeefpcac_cd_^``_^^^^^^[^\[\\XWZZXZWXUVWTTTRRRPPPPPNPNNNPNPPPRpw@##!##!&&&'&&&'')*)*'*'*'))'))')&)*))**))*---**/02%;fzЇОЙЙТВГГЛ­ЙДИЙВРЙБДМОЗУДМРШЭХЪйдпецсххцсђьц№ьђяыёщщъѓьхъђяъъј№х№мъ№сцящтщьочхсхщщяххсъйцычфпцпхщсчфххцьнццутщхтмфуйссфоосйолсчлтйслйипзнжжузпнаылоозвцхеннзтзндмжмпйгпжмллмпееЮмжйемйдзлвбЯзЯЯвбЮдЮЯЭЬЮЪЯШУТПХОХРПУЛРКБВМКСПУРРЭТЧЧПШЩУОЪЫЧЮвеЬЭЯемЫЬлвмвхЁ%><t§щщъјђсыохяђсєсёјіщфъія№іхђјјѓѓ№№ёѕјђјђђјѕјђјєђыёыњјэєѓјёъѓјьјъььыђъі№№№№ђёїыъ§ъј§цўєјђњэјјъјјчџѕђђєђѓъјјђђѓѓѓ№ъћџєъїјѓёљь№ђјџяэјћњяўєўџђјџѓћѕчџѓџщўяјђјјњэџё№ьјњўяџђђёўѓѓыњњєјђяџџџќјјјьјыэъіѕфссШТЩЧРИЙЧЈЏЏДВЈДЏЏЏЅ­ГЋЋЏЏЏЋЊ›ŸЊЄЄšЄЃЅЄœЊЉЂЃЊЃ­ЉЅВ”А‘vhV/#;6655444452232343334432430223200-)&%&esFwpqppoqqqpppknzomomnkknjokmmn^kkkkmkjjiijhihmkjgghfdfeeeceddcccac``___^^^[\Z[Z[ZZXVVVTTUWVTRQPRPPPPNPPPPPPLLNPNLPRnr@'!!!!%&&)*)***)***-)))-**)')***-*)))**/---)**-//2%-c|ЄЈЏЄЅЈАЇЖЅЈЈЈЈГЉЉЋЋЌЊЋ­ЏЃАГЖЙМСЮШШЮЮЮПЮЯдздвежжйлизйжизппЬзеззззждезжзздгзозжззозжвмггджбЯббгбабддвбгдввгабвваддгдгвЯанаЮЯЯЮмбббабЮЯаЯаоЯЯаЮЮЯаЯаЯЯЯЮЯЮЮЬЬЭЮжЭЮЯзЯзЭнЮЮЮЭжЮЭЮЭдЪЬЮЮЭЪЬЩЬЫЩЧШзЩХШааЩЧаСТУТРРПОЪЙЙЙИИДУЖВВВГДОВДЖРЙЖДИЌЙИКЏЙЛООООТТРТУЮЦЧЦЩЛЬЩз‘[џзлнноопопщптзссуутфуыхцэхуэхчффхцчщмхчхффэяхххццфцхуфцхцлцэхфьххххфууфхфхэуфффххцххлхцччххххсхухуфххлхфхсттутфсдуфяф№тффдтсттуттссяыуяссяеяфясътъъъттссссэстттсђссъстстсзъссопппстпппопополмлуижгаЬЦЪАДВЏЋЈЈВЈЄЁ Ђ Ё ››Ѕ›Є™™™ЃšЃ›™š™™—™Џ™Ј˜™™—˜Єš™™˜Ј™œЂƒe>!;6544564446444443444344563323322/-)#!!5€}JJLNNZLKLKLLXLKKKLLIKLKJLJNLLZKKKNNNKKLNNNNNLKNKKKLLLLLKKNNLKKLKXLKLKKLJJLKLLJLJKNKPLJKNNPPNKLKKLKLLLNKKLLLJNNJNLLWIEEIJJKIJKJIJLNLJIJHLNJJKLLKKPP џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџХgzxttttssswvtrrvtrqrspqroxoVBEvppppoqrponoonomoonyknomnjmkmkkhkmkmkmkjjkjijkjhhggggeddfeccadaa_`____^^\[ZXZXZVXWWUUUURTURPQPNNPNPNNNPPLNNNLNNATrs*#!#####&&)'*))*)'*--***-*w*)-)*-******/**-/***/2/03czЊАЂЃЅЄЄЄЄДЇЄЇЈЈЊЉЋЋЊЋ­­ЏЏБЏГЖЗМЩЮЩШЬЮзЯЭЭЯеззеззззтззссжжзжжзжзеужежзегжеззжгШзжждзжевндеожвдбвгвввбЧвгдббгггЧгапвдгбвбХЯбЮаЯЮвгЯааааЯбаббЯЯаЯЯЯапЮЮзЮзЬЭЬЬЬЮЮЮЮЮЯЮЯЯЮЯЬлЭЬЮлМЮЭЮЭЮжЭЭЫЫЪЪЪЧХЦЩХХЦМЧЧЧТТТСТДПЧОКУЏСДЖЖДЖПГОЖГГЇГЉИЖРЗДЖРЙЙИЙЛОПЛОРРРПСЦУХЧЩОЭЭУeCўЦмммоопощопъуъссяфссххяхуутцђхучхцчхяхццхцххххцфхххцхфхэхфхцхфхххххуфууьхуххустххххчэфхцхђцхттхфутьтээфуттхухфытузуфтхххфуфсытхфсстфсусфутусспспсстссстсппжсттсяппсссзтссэс№пппспссппдооыолйлуиздбзЪТМИД­ЌЉšЖЇЏЄЄЋ•ЂЂЏЈЇœЅˆЄ‹™™™›‹™Є———›š˜˜—Š–˜˜˜™™…Є›šЃ˜Ђ“xfQ!85664435544545334333444633533202/-'#!!%XtK6JKNLNLPNERzw…ЁБЙЮлїћўџџџџџўћўѓяєъѓопьсуусфтуттттсзуыфѓсихтттфутхутхфхстухфуйёуфффхысусутзсстутьуйуффхтпуфусппспссуфттусутъссоуфтсустпфтсусоооХщспсоеспояесщопопнпопосднаоэомцонллмллйззжЯЭЪХОИДВБЊЇЄЃЅЂЂЊ‘ ЁœЊЄ—™ЄЃ–™™‹™šš™Ѓ˜–—™™—Ђ–˜ŒЃš™˜ЃЇ™Ј——Ѓ›Ђ—Йn>)*86656556564546443323324432433220-)&#WoZ;KKKLKKNKKKJKKLKKKLKPNLNNLKN_QKagLTtrif_`^d@IIIJJ8ЈџћџяйиЦЏйђџ§ўџџџўўџџџџўќћџџмоУамфхьјџciy’Š_šzЈвзߘ|‚x•Œq_3Qa`*8jЈЬмѕџџџџџџџєјјщьээсътуффтфууухутхьцфуфуххффтысфхьфтфуусыуђтясятфьуууу№хссссъсъпстсес№хусстсфсспстпъпсжэсносгяепщднспгпсжсопопппссесэснпоппгъмнлмлщнмлйзгЯЩЭОЙЖВЌЊЄЅЄЅЄЅЄЃ ›™Ž——™Ѓ˜–Ђ˜™–˜ЂŠ•˜•———™Ј——”—•˜˜”—Ё•Ђ—Ђˆ™›ššЁЈkW**8858564655544345433444423232200//)'%#TzZ6LNPPNKKLLLLNLPJKLKNLKKNNXLLKNLKIJHIKLKLJJKKKILJNKLNLKJKJKKKLJKKNNKNLNLJNNJKJJJLLJKKKIKLLLLLKKJKKKIJJHIHHIIIIIJJJHKJVIEHIHJIJLKLKLLNŸџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЋotvtvvvqrstvrrpqnooonpqnkjsIQWvozpnoonopnnonpnmmnkjmnmkhhjihhjgiigfeegeccdcc```^^^\\\[Z[WXWUUVTRPRQRQPRPQNPPNPNPPLLNPNLLKKJKKPPNPUƒR%!#%L&)'')*)**)*)******'***-*')***)*------/0///3#!@NЂЗИЏЗЏЏЏЏМЈЊЋЌЊЌЏЏЌЏЏ­ЏЏААКББАВВДИМСХЦХЩЪЭЮЯалгдгждзижейилйлйлиииллиззилйзллммлйлсзхзиилийзжзйййззззжзежфиетгдждггвеждвбджвведдмбавдаввабгдгалавЯбанХйЯЯвгбЯУЯЮиЯЯЮЮиЯЯаиЮЯЯЬЮЯЮЮЭЯЮЬЯЮЭЭЮЮЭдЫЪЪЬЮйЭЧХЧдвХмйзфпнйдЧД”€aRE-/2Fm|“‹tЈvs€pgzpeyVJFEEEFџџѓџўохЯШфџџўџџџџўџўўўўџў§ќџ§уяммнищьџыJ_^k‰nr^{€W„rWqvƒif|ngcfhj[25FI4)PyЂПъяџџџџџјщщос№състсфф№фстхфтффуфуфтуфхххьтххиытхуиссиууххутуфстсссссссязсотуусфъффуттптсссъсоэсЪопсщппсппсоопэсстстсспспщосэсщопщооонмхнлммузззвЫЯРЮУДБЉВЅЇЅЃЄВЂ  š›š™˜˜Ѓ˜šš™˜Ђ••—–•˜™˜˜˜—™——˜—•—••Є™˜ŠЂ›Љ™™ЇЏŠmZ-<68666454554444533444443444322220/*&!!&AZ/JLPKLNJLNKLKNKJKKNNLLKKLJLLNNLNLJLLKKLJIKLKLJNNLLKLKLKLLKLLJKKJKLNJJKKLLLLNLKLLLJIJJKKNKJKJIJJJKIJIHHHFKLJKKJJJIKKKFHEIHJJJKJKKLLNџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЎotstttvstttstqompqopnooyjaUCKvmnnnnonnponmonkkmmnijkkkihhgfhhhhhffefe`ccaa`_`^^^^\[\\XXVWWTTTTQRQUPPPPPPPPNNNPNNNNNPLPLLLLKLLLA_xR&#&%%&)&)))*)*--*-*)-))--*****-**-*/*/--*-/-/-2)AVМСЋЋИЏЏЌЏ­­ЉЋЋЊ­ЏЙЙЙЏЏЌ­БКБВВАВЖСККОбУЧЩЧЭЮЮЯЯбвбжджзжззизллилмлиилмижжзллйилйллизйзииззлизихизизззжижззеезжззжжзееежжееЩежгвагддввдмвгггдгвбаЦблЯбЯЯТЯбвмвЯЯаиЮЮЯЮЯаЯЮМЯЮЮЮзЮЯЮЮЬЬЭЭЫЮЬЭЮЮЬЪШШШШШбилжолщщхпбР–Žg>'=iKJegyzfqq^`pŠqn|gcddzQFCECCHvџџіџъбаЏлјџўџџџџџџўўўџўўўў§џџЩхсЭасхыџџ8faQKQaKR^Vi\i‚VjhhmmgdefdfeddehghPinP*#^›ОоќџџџџџєєъьппухсупстттфхффутфтутххфххтуухђупъфыфуьуыссусфяутуђтттпотсстстзустссттгсуооссосппщпопвщсоссъсостостпппсоосзъспсмаоонммхлмизйобЯгХРЛИД ЈЈЉБЄЄЄЂ Ÿœš™Єœ™™—šЃ˜™”–•”˜™˜Ђ™˜—™™ŒЈЊ–”•ˆ•˜”——Ј˜˜™•БkX'<8655655555433654333344443330222/0-&#!&Lw^4KLKILJLJNLKKKJKLKLLNJNJKJLKLKJKKKJJILKJKJJLLNNJK_KLLNJJKJKKLILLKLK3IJJLJLPLNNNNLKLJIJLKNNKKKKJJIJVIHHVJJLKJJKJLKKFEHIHJJLLKLJKLJLŸџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЎnvsstvsvssqstqqqnppqqpoont`FQHynpoponnnonkjmokjjmkmjkkkihiiggigggeefddaacca`a`^\^\\XWXWVXUVTTTRPQRTTQPPQNPNNLLNPLPLNLKLKJLLLKLR`|R&!#_%%&)')'*)'-/*****--))*-*)-***--*--*////*-//34/=ZДОД­ЏАИЏИ­Ћ­ЊЊЋЏ­АЏАЏАИАЄГМВГДВЗЙМОРРУУШЧЩЮиааЯаавжеиижжйиийзйлммймЯулизйллзйиллзиййизсзлзиййиизллзжзижийзжезисижджеззджожожддгагдвгддвввбЧовЧвЯоблЯаЯвЯаддвЯабаиЮЯмУаЯЮЯЮЮзЮзЮЮжЬЮЯлйЬЭЭРЫдЫбЧЮздауфњоЬДЅd4&!@aIwdaiЁedgh|kseshktjighPfdccaa[LEBCCC0зџџіџхпКЁнџњўўўџџџўўџўџџўџџ§ћџмщџоосуъњџ‚e_^\^^PazWddehhfggfihgfefeefgedfgdehhdo_`RA5*UŒЛоќџџџќћіїчпспсъууфуутффтфтфхххыифутффусффуфхсуъптфтффухуфтусщосъпЯъспстпсспссъсптпсщоппссывщоптсъооопттсъпспснсттсночпчнЯоммлйийсежгЮЧЬАКЖВЖЋЋЉЄЃ­ЃЂ Џœœšœ™›…Ѓ™—˜—– –™—•”—–™—Їš™™™Є••Ё—”•˜‹Ї™Š™Ё›‹‰yF3&56664645464444543423232433223300/*##!&UmW8JLLIKNKKJKNLKLKLXNLLNKNLKLKLIIWIHKKKKJKKKLKJKKZNKNLKKJKKILLJLJKLIIKLIJKLKLLLNKKLNLJKJLNPJLJJJJJIJJIHIHJJKKJLKJJKHEH^HIKJLKIKKLKLџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЊivsstttssrssrrppopopoponmtaTBKwonooonomnnnnmokijkmknjhjvijhfgggggdddccca``a_^^^[^[ZZXZVVVTRTPRPPQRPPQQPPPKPPPNLLNLKKNLLKNNLLLPexX!!%#&''&*)))'***)-**-*****-***)*--*--*/0/-**-000!'@U€ИЬЖ­АЏЏЏЌЌИЏ­ЏЏЊЌИ­­ЏАЏЏАВВДГЖДДЙМООШТЬУШвЩЯаббвалеезжйзйзйизйзтйллълллтллллЮсйцйзйЮисйжйййжиилжзсйизйсЪзйзжджзиижзджздгеезздеггвмвдегмвгпвЯалговбааагдггвавгаовайУЮЯЮиЯЯЮУЮЯизЪЪЮЮзЮЬЫЩезвжжвыуфщтЮЄ„a<&@Uddv`a`czifegffqfedaaaedc``aa_``^^__WWwnooonooonmkonkmkjmkmjziiiiigfgedfeecdcca`__`^^^^Z[\ZWXXWUTTRTRQQNPPPNPNPNLLNNNLNNLLKKLKKLLLNNP_{F##P%%&)'*&'))***)*)**-*-****'*)*-))*)/-0--/-//024)03}АПП­ЋЏЙ­МЌ­АЏААЏЌЏЏ­ЌЏБЏЙВКВЖППДЗЙЙООРСУХШвЬЮЯЯапЯгдожожизййиззйззЮзлйллйллулййиийимэиллиззизийсзийлйжисззззежжжжзедезгегнЩгбеегбемгдсдмввдвлЯгвбглвЯггбмдЯаггбвалвЯЯаЮаЯЯЯмЮЯЯЬЫЪжлпсосцлсћьыоУЖX<)8T\^j^``eedeadcexfeefdaac__`_``a_^^^^^^^_^^^`5ECABC>џџџєјцЧЪ№џќўўўџџўўўўўўўўўџў§њіьыЙєгщъьџџK\^w^[^`dcdefcddcddeadeca`caacdcccdcdeceecdcacsdra^aa_aL8'dšШыџџџџћђщцсустсусусусстсфхффсспустссутттфихффхуссптссосттсоптусспосоосжспоещъспнпсъсосоооппммносоомбмоппопопмЯлнммфШлллжжвбжЪУОКЖГЏЋЈЉЇЄ•”ЂЃЃЂ›Ÿšœšš›——š™™™Ђ—˜Ё—Ќ—•ŠЅ–—˜™–•ЂЂ˜•–‡Ј‚™˜—™Š˜•ЊŠmW&%66656543554434443523440334424232/*%##Ie\-HKLLKLKLLLKJKJLKLLNNKNJKKJKNLIJKKKLLKJKKIJJKXNLLKLJJJJLLKKJKKKJJLJNKKLNKLKKKKLPNKLKLNKKKJLJJKKLIIIIHJIJJKLJIJKIKgIHHIIJIIKKJJNџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЌotsrsttqrtvrprrpppqmppnmmkmFAWvnkmnonnmmnmnmxmmjikkiighihggfgeddpcadc`ak^^^^^[[ZXXWXWVWTTRRRPQQQQPPPLPNNNNNLLL_NLJLKLKLKKKNQh{F!!!!#%&''*'*-)**)*-)***/*-)'*))**-/*)/-/*--/0//024##8goЏХМЙЏЋЏЏБ­Џ­ЏЏЙАЏЏБЙААААБЏЏБВДЗДЖДКООПРРСТЧЪЫжЮЮЯЯЮбджжзезиллиЮйизлийллймйлЭумйийзззмщйзлйлйсизизззлййзЮзйлсзШжззззжддзеожжддШвднддебвгввдвгббаббЯагвалбвбдгЯггввПаойЯиЮЮЮЮЯУЯЯзЮЭЫйсуЦБ™p}ЛЄ{X#>P`c€d`Qc_ccccdddeddddcaaa_^k_^``_^`_^_^^^_j_^^hWIBBAABoџџџџђп™gгхџќў§§§ўўўўўўўў§ўџўќљ§§нЙјцўьыќџE[\^[[^adddeeefdeedddeecaca`accdcd`addcedcccc`ccccdcd`accaaQJ5Z‘вцџџџџјђчщсстстсзсуутххссзяоссстфсттутзхуфутсстппссссстсптспппъссспооссжсоопсспопяочоммхмоппмнЮывннпщопнлнонвмлммлсжмазЪЦУЬЏЖВЋЌГЈЈЖЏЄ—ЄЃЃœ ›™››Є™™—ЏˆŠ™––Ђ—–™˜˜™™˜Ѕ‹–—–˜Є—˜––Ѓ——ЈЈ™ЅЃ’nW))55655454842443354533452324233320/*##%6{^8IJXLKPLXKKLKJLLKNNPKKNJKJKLLKJLLLLJLKKNJKJKJKKKKLJLIKKLKJJKJKJLJKLKLJLLJJKKKJLLLLILNKKKKKJLLLKHHHHIJJKIIIKIIFJLKJKJJLJIKJJLJLŸџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЄhyststrrprstqppnrrqpoqponvrB@>o{nnoonommjijmimnkimjihjggggggeddedcacda_`_^\\[\ZZWVVVRUTUQRPPPPPNPNPPLPNKNPNLLLLLLKNJKJJKKLP`wE#!!%%'&'))''))**))))-*))-)*-)*-**-*Q-*-C-*-0////2##;^ЗСЛВАБЏЌЌЏБАЌ­ЏБЏАЏАБЏЙАЏЏЏЌЏЄГОПЖЗТЛМОРДСХЯШШЮЮЮЮаЮагззжЫзиззлйллйллйлмммлсзлммйлзиллузизийлилзззизйлихсййслиежззипфжЫозжозежднжжвддгдбгдаввЧлвлглЯгбЯвавЧбгЧлбваЮавХЮЮЯиЮЮЮЫйлмздллхp</23'!AR^^€`_`crrdcdwdeacadc`cd`a_aa__^_`^_`a___^``__`^_^^^^gZZZ[[^accdeeedddddodaaccdacccd`cdeec`cc_adacd_`acc_``__dcca``ccm`ak`_J0\ЏхџџџџђячпносуъсуууфтсщстспгссстътссгтсптттсэосогспвотяуътппощсжтэпосссоотягоаланысЯамнлллнмоосвщпчооомлйллхенвадЯРЫЙВБЏЊЈЅЄˆЈ›Ј™ЃГ  ›š››—™™›˜–˜™˜Ѓ˜˜—™›ЄšЄœЄš˜˜•™™šŽ›ЈЋ™™˜–ЊЄ“`\'&663534445434534466443343444344020*%#!!;_&IXNKJLKNKLKNJLLLKLKKKILJJNKKKLKKIaKKXNKLLJNLKLLLLJKNKJKLNKKKKLJKLNKLKKJJILLNLLKNLLKKJNLJLJJI5IIKKIJJWJHKHJJJIKIIJJKIIJJJIKLџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ ptssstsrsrrsqrppopppqppmmg`R>Ffnnnkkmnhjmkkmnmkkjhgjfgffcdeeddaa___`^^^^^^ZZ[WWWWUUUTTRQQQPPPPNPLPNPNNLNLLLKLKILLLKJKKKLPTvB!!#%&&''))*)*)***)')))))-*)*))*-)-****-0///0-//3%-R^ƒЙЗЏОБЛВББ­­ЏВГВАОЏЏАЏААЏЌАВББЏЏЌАААВГРЙКЛЛОЩУУЦЧШЭЭЮЯЯЯЯгжзжжизилииллллмммллуйилййиймиллллллизллммуйисййийЭзззпжежедджиззЫездегегегенгггдевгегдабггвгвбЯввававггвЯЮЯЯйЯЯЬЭЮлжощхуЯЌ“s>#Fijieirdasdeccd^ac`````acac_``^___^_``^^_^_`^\`^_^^_\_\\^____^^haJBAAABЋџџјџйŸ|—сБџџјљљћџў§ќћ§ў§ўўўўџџШыyМЦвўщцџ2>[ZWZZ^addacaeedefcc`accaedadcca`dcd`acdcedcca``Qa`^a_``aa```ccacacadaa_^^R@^ЂоѕџџѕѓъояппусхфттопсссэусоптспьоссттсспъппттсэсппоспоппоьппспсдпопссссонымоЬоэмммнмлмммннпсщспмоомлйиуйиуевЭКСОУДДВ­ЌЋЈГ­ХЯ”Ђ–ЂŸЂ œŸŸ›Ѕ™š›Јš—™šЃ™—™™Žš›™›™˜Ѓ™–Ѕ˜šš›˜™™™–——ЊЋ“oZ-*8545544456445544443543333353322/**&!!'!6nW8HLLPLJLKLJKLNLIKLJKKKJKJKKNKKLNLNLJKNLNJJLKLJKNKJLLLLKLKKKJJLLKLNIIJJWKLKLLJJJLNKKXJKKKJLKKFHFIJKIJIHJJIIHJIIJILIKKLJKJIKKџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ˜ktssstsrqspqrpoqqpqnpomk}q^EE^ykmjkmkmkikjkonkjjhihgihhfeedddca``^a_^_\^[[XXWWXVTTTRRTTQPPPPPPPLLNNPNLLLLLLLKLKJJKJJNKNQmqB!!!!!#%#&'&)&')*)-'*)'-*'*))*-**)--*---)-*-----/00234-Fj…БКЖВВАВРБЏИ­ББМГАВВВВЄЏ ЌЏЙБАВ­ИЏЏААГДРЖЙЛУКПСРСУШЫЮнЮЯаввбнждззззйлтийймлулйчмзллллщлилуллллйзлммлллизтлисизЬзизжжддджзижегезеждггггжвмегдвввддвабгагвбвЯбббЦбЯгдббамЭйймхыяђмР‘f3AP6Kgtgdqeaadcadccc_`^`_^aa_^^^^`\__`^`^`^____^_^^^^^___`_i__\_^^^^cKB@AAB џџїџт’qЏЛIиџџјњњћћќќќќќ§§§§ќџџFУwСеДЧјыяџ08[WXZ[jcddadedeceda`ddaedd`caccaaaccacddddaaa_a``ac^`_a`_``a`_`_aa^c`aa__k`a___E`ПыџџўџѕъѓэстттсоъппсуусъспсщЯьжсссппэсэсъфъсэсоосссщостссщпооспнсепспомцомпоычонлйоонпсспоммъммммнлзжздейдКТМЇРДЄАЌЊ­ЙсУЈЃЃЄЂЁЁ Ÿ›ЌŸšš™›™˜ЄЉ™™™ЃЃЄš›˜˜ŒЂšš™——Ђ™Ј˜™™šЃ‹˜™—”Ћ‘nL*65456445434453334544344445332320-*&!;{`-HXLKJJKKaKKLLKJLLKLKKJKKKKJNJKJLLLLZKLKLKKLLLNJNKKNLKKKJKKJJLNKJKKKILLKNLKKNKKLJLLILIJJKLJJFFHHKLHJIIIJHIIJJJIKKKJKHJILJIџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ›fssrrtrttqspopoqqpompoonicXRJexomnomjkmxkmjmmjikigigghggdeecaca``_^_^^^Z\ZXZVWVUoQRPRQRRNPQQPPPNNNPLLPNJLKJJKJKLKIKKLNPnt>!!&#%'&'&)))**))**))**/**)----**-**-&-*------//23#;j‡ЖЗЌАБВБВВБАА­АВЛГВВВМРББЏЏЏВАВВ­ЏБВВВБДДЗЗЙЙКЛООПХШЩЪЮЯоЯбввбвеззизйхйзйлйиллйЯлййцймнмллмйЮлзлллллллмтллйзииизисйиизегжзджндеззедгдндвдШдмдХоЧвддааввЯЯбагвЧабабглоЯЭзсысоаЙ‡H!>\\^^^[gc…eptR```__ad`^^_p_^^^^^^\^_\\\^\^^_`\^^^^^^^^_^^_^^^_^^_^^`_^^ZPC@@ABzџ№ѕџџЌvЂ–џџјјљњљјљћќќ§ўўўќџе3Ъ‡Ивнгђыџџ'@[WVV\a`edeeedc`caccdacccdcc`ada_ac`a`ddccccnc`za```a^_`a_c__m```_^^```k`a`aa`mra`I@gЏуџџџыъёщспостссутуфссзтсстсптъсоппсссспсспсссосостпонпсосспоссосонононпЮсооллопсщссооомммнонымлззеодлЩдРОМЙВВБЋЌ ЌЊЇЇЄЅЄЂŸ œŸЁœ›ˆЊЉ™Є››Ѕ™™—™™™›™Ђ™˜Љ‰™™—˜•˜™™˜—™ЃЂ˜••—ЄЂЈnK-*6546454554456345534354344443430>-)&!!ra``_``^a_``q_^^\[[^^^^^^__^^^^\^^`_\^`^^\^[\^^_^_^^_^^_^^_^_^f_F@>AA<џџєёџоvЄА^kџџїљџљјњћћњќўќ§џџ„ЉОЮќтяђџџIXXWW[`aaaadadcc`ac`oc`_aacacaa__a`ac``ccdc_c_^aa_````_`_``a^ac_a_`__^__^q_`aa`ada``d…T;-ŒЪўџџѓѓёцонщсссятууутссътсоуъссппосопосспѓпсонпсопгоспсспсщспссщпноопщыононооооогноцнлооммлммзййхШаЭЧТРОКЖГВАЙЊЉЊЅЈЅЇЅЄ ЁŸ­œЇœšЊšЏ™—–™™›š™š—š™Ѓ˜––—˜™˜—™™‰™™—•šЃ˜ŸЁnZ4&564454444444545444446545443443000*'##8wW3IKLNKKKNNLLKKJIIKKKKKNKJKLLKKKLKNLLIWLKLLKIILKKLJKLLJLNNNKLKLLJILLJKKKKJLJKKLLJLKKKJJKKKHFFHHHJJJVJKJIIKKIJJJKJHIKKIJKJЇџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџŠowstrssst}qpqonpqnozoonkkoXBQЉqnnnmmkiknmmnmkihhhgfffgeccda_a``_^^\\[\ZXWWWWTUTRRQQPPPPQPPPPNPPPNPLLLLZNNKKKJJLLKKKLRpj>!#!!%&&&'*))*)-*L**-*-)----*-*-*))/*-*-!4//*//-0004AQ‡ЖК­БПЏЏЏВВЏЏЏАЏ­ОВЏЏРЏКГБЏЙЏАЏАБАА­ЏЏБВВВДГДЗЗККЛЧРТЦЧШЫЫеУЯЯблдесеоздожйийййзллллйжзилйзиллуйитйзиийллзллмййзизйиззсижзезпЫдвжожззсгзгжднфдаввпбавбдгдгабблвбазЩсъоъпМ—W!5E^___^^^^^^^^^d-pi^__^_^`^^_^^`\[[^h\^^\\^^_\\^^\^`^^^^^^^^\\_^^^^\^\__^_^\\\^ggJB@A@џџџђљч‘ŽЅ•3Єџџјјјјљћњњќўє§џЬ™ЙГЁЦСыыщщџхJXXXZ^`dccccddeccda`dda````aac_acac^ccaadda``a`aa`_`_`___c``ca``ca`^`a`a^^`a`__aac``ezfca_K;NŸпјџћяяыооуъпттсссусуовъспсспосодпососЮоыоосссонссвьопссоотспчоосомннноаппнноооЯмноонннЮмллжееЯЮЫШСРМЗДДЏЁœГЉЈВЖЈБДЄЂ ЁЁ“ЁœŸЊ›ŸœЄ˜š˜››™šš›Єš™˜—•™™™ŒЈ˜˜˜™™™–›Љ™—Ѕ•`L4-66555553442444445433555555445300/*'!Й&#8ie3ILNKJLLJKKKKIKL^JJKLJJIIKJNJKKLKKKJJKKLLKKJLLNLKJKLLKLKNKLKJJJIKKJLILLKKLKKLJJLLLLLLKKKHFFFIIIJJJJIIJJJJJIJIIIJIWJJIJNЏџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџzsqrsrsrqrsqrqpoppnmnmmmjz\FC‹ponnnnnjnknkjkjfhfhige‚efacnaa^__^^[[ZXZXXWVVVUUTRQPRQPNPNPPPPPNNNLNLLLLNLJLLJKKJKKJNPmp>##!!%&&)''****))))/-)*/**-<-**-/*/*/-*/-/////-/0/024*A^…ЖОЏББАЙАЏВПКББВАЌЃЙВЏ­ЏВВВВБААЌЏБАЏОЏВВЏБДДГЗЖЙЙЙМЛОРУУШЧЧгЮЮаЯбавдгоззжизиилзиймлуйлизилилйймтилЮзйиийилтлуллилйиийжслжедзиждеЩожежжджсевджгдгбввблаагбвввааоильотХ™p/#%<__^^^_`^\^\[^_\\^hI^\^_^^\^^^^^^_`^[^^\\^_\^^^^\^^\^^_^^^^^^_^_^^^^_^^^\__^^^^\\[^iPC>@>*№џџўчЖЬИпЬЈEvџџііїїяљ§ўџџџџРђ˜ЙпцдухчџЉXVZZZ_a`cdc`aeaca_caodcc____``^a__``accaaa_a_caac```_`__`c``_``^``````_^`a`^`^^_`a^aaceaamdn`P;%ƒвўќўќьоэпоессоуссппъсссъсспппсещсссогмпсътпщоспспесппоътонмоыъамъчпсоссчопыоочповомяллилзовазЫХЫЛИЖОВЏЌЋЈЇЈЊЇЈЇЏЃ ЂВЂ Ÿ‘š™œš›œŽЅЉ™›™Єœœ™˜˜˜™—ˆ™™š™Єš˜š˜™˜œЉ™ДЂ™n^4&5554654445543455434455444444333@/)&%%4re3HLNLNLKNLLKKKLKJJJJNLLKJLNKKKJNKKNKKKNLJKKKJKNJLKKNKJKLKNKNKIILJLNLNKKKJKKIJKLNKKKKJKKICCEIIFKJIIIHJJKJKJJHJHJJJKJIIJЏџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ˜zvsrrrsrrqrrsqonnpnmmnhikz^E8`vmmknkxkkkjmkiigfhgggeeeeeaaa`_^^^^[ZXXWVXWXWUTTRRRQRPPPPPNPLPLLNLPNLKLLLNKKKLJKXKLLPfo<'!!!!%&&')Š'))*-**)**-*)--*))**--)-**/----///**/-/204/k‡ЗИЛБВАААААЏАББВАААЃАКВБЏВГВЅБЄАЌЌААЏБЏАБВВДДГДЗССЙУЛРСПТХЧЙЩЭЮЮЯЯЯЯввзизжззззтлйилймлллзилилйллйилтзсзлийЮлйллммулилижзсииииззоедЪожждздгвдеебвеввалбагоаафмиуѓьсШT%0>I^^^`a^aa_`^_i[\\^_^^[jQj^^^^\\\\^^^i^\^^Z^\_^\\^^\[\\\^^^^\[^_^^^i^___\_^^^\^\^^\[^^^\U6@==2ŸџџёыПзџЛЅВ‡ƒJйџјјѕїј§џџџџџџпџћ›тіысыфѓџJ#XXXW^_a^ccn_c`ca`^acad```^___k_`^___`aaaa``a```a`a`___^`````^`^^aa___`^^a_`^j_aa`_^_ca{a_`dec^\^^^4kЗјџџљх№ъопстсспссъсттсьоссспспссомппсстсэпщпоспсссощспоЯнммЮмонптсђонощоопномоцолилйлцйзгайОЮПМЖЖД­ЊЋЌЈВЇЗЉ”ЏЄЂЃЂŸЂЉŸšœ Ÿ››Ћššˆœ™™š™™™›˜™—™›Љ‹š™œš›™š˜šЌ™šЂЏaZ'*555F553545564553444544455445433//)'!!8deHJKP_LNKKLNNIKJKILJKKNKKNLKLLKNLLJLHKNJKLJLKKNIXLJKKJJKLXLKKKJKIKKKKJJKIKJKJKKLKKJKJLJICHFFHIIIIIJJIKIHIJIJIKJJIKJIJKЎџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ—zvpssstqpo{ppqpmnnonnkikmr^R4[rmmkkkjwkjhkmihhghfgffgeda`a`^_^\\ZXWWWUUWXTVUTRTRRPQPNNQPPPKNNLLKLKKNNLKKLKKLKKKKNQfn<'#!#!!''')*-')****)))*)*)*))A)*--)-//*0//-*-*0//--/06-A[ˆРОМБАЏЏОВВВААЙБВЄОАБЏББЏАЛМЛКББЙЏЏœАЏБЏБЛГВОВБГЖЗЖЙЛООРРРСХХЧШЪЬзЯнбвбгдожжфииймулзЮллулзйиийллизлллйиийизлизййлммлйлйсзййзхизжджтеджзенеддгнждвепввбаЮвйлнщђялЏs2<>'џџєѓџџџŸhИЃЂšџџџџчёѕџџџџџџџџџОЄьћосхцџџHHVWW^_aaaac^_caa_`aa`a__`_j^^_a^```__aa`dca`^_^`_ac_`^^_```a_^_j____k^`^`__^^^_`aa_aa_a`^_dc^^\^`j^^QB8Јмџџ§јщыєттсппсъЭсжоспсостэсщдмощсщвьсспЮсптсощпппомыъммммнпьссовпспоыоаопчомйилммиззсЯЮЭЦТЮИДГАА­­ЋЊ•ЗЙЇЇЄЄ—Ђ ЁЂЂЂŸЈŸšЌœ™ЊДЄŒŒ™™›œššЈЈ›Єšš›‹ЉœЄŽšœšŽ™œЈЈŽoN/66i54455555344544556344345443300/*&#!#6q\3HKPLPKLJLKJLKXKKJKLNJKLLLLLLKLKLKJLLJJLJILNLKKJJKJNKKJKKkKLKNJLJILKLNKKKIKNJLJKJJJJKJEFFHUIJJJIIKJJJIIJIJHIJFJJJJJKЎџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ“itrrvssrpopqnqooonmonjjjjq^RAFymkjkjijiiijjjifgedeeeedc^_^`^^[Z[ZXXWVVWTUVVRQQQRQRR\PNNNPLLNNLLNLKLKLLLKKKKNKLKPPki;&##&'')**-)-*-****)*---*****)'*)/*/----/---0/0/22C\…ЙЦЙВВББЏАБВВЏББЏЏВВЏВБВА›АВВЅБББВГЛГВБВБВВБВОВВРГЗЖИЙЙХОПОРУХЧеЧЫжЯЯавгмвжжджфйзилуллйлилтсЮзлллзхиЮллэлззллййллллйлйтлзйиззйзззггездожддгдШЩседвгааовЯмуьъха›e-*8^^_^^^``c_`_``__^`_^^^^\^^\^\kXj\[^\Z\^\\^^^\\[^^[^\^^^[\[^Z\\\_^^[\___\^^^^_^^^^^^\^^^^^^^\^^^feH>=@*оџќџџџџџЂšЉ™йџџџяБзџџџџџџџей Ифзлщуѓџš#^UUUU\`_`a`^^^`_a__``ak_`_\^^^___`^``_`adac```_aa_a`_``__`_a`^^^_^`^`j^_\_^_^^j`__ac_^_^^`a_cj\^^_`k_aj_^P!4‡тџџјєхыпщэсщоьппопосссптсппппсщооосоопсссосэссдпнонмхлноссосщсппсдночочнмнмммллйсдЯблОТСМЖДБЙЗ­ЉЗœЈЉЅЈДЄЄДЂЂАЂЂЏœ ››ŒЏšš™˜™Єšœ™›‡›š›œЅœŽЄ›Є™ЅšЄœ›œЈЈŸq_*-;8655655644644555553453534433430--'%!5Pg6FLPLJLKKLJLLKKJIKLKKXKLLLKLLLNNJLKKKJJKJKJKLKIKKJXNKKKNNKJNLLLKLILNLJLKLKLKNKLLKJLIIIFFFJIHUIIIKJHJJJJFIIIIJIIIIIK­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ•msrrssqqnnpooopoooonymhjif\QAWtikkjkkjhgjhkighgfeedcacc_^_^^[^\ZXXVVWTUVURUQQTRQPPPNNNNNLNPNPNLLLKKKLLKLJJLNKNNRmp<'!####&&)**)-))--**)-)***))-))**)--*-***--/0/20/002%&T`–ДЦХВГДГЅВББЏБАББЙ­ЏЙБВДРОЏВВКВААЏВООДРВВВАВВГВДВВГДДДДЗЋЦЧООСХУЯЧШЫЮЮЮвбгвдбШгдзеиилллллллзсзиитлЮлллйммлиилиллзйллийлиллллйззизеждгжжождожзжвжгвдлбЯпхы№цР•Q'BP_```___a``_`^___^^^`_^^\[^\\\\\\\\[\\^[ZX\\\\^^^[[\^[^^\^^\\^\\^\^^^\^^_^^^i\[\_^^^^\[\^^\\^\\\[h\gL@==F\џџџџџћџчб„Ѓ‚aџџџжЖ§џџџџідЬЫщЂЧЭХзбьџџT^VUTV\__`_^^^^^_`_`a^^a^___^^_`^^`__`__`_a^`___aa__a`^_^`^__`\^^^^^_^^^^^^[^_^__^`_a``^``^``^`\[^^^_````_^_^P0zзџџџъяыпосьпсссппщоосэпппоонпапосоосотстссяооосспаъмонодппсптьощппогцнмннлфллзевбиЭЧТМЄВВАЏ•Ћ–ЊЊЈЇ”ЈЈАЄЄ–ЁЂЁŸ›Ÿ›Є›Ј‘ ›Њ™­ЇЋœ›œšœ™šœ››™œœœ›Ž™Џœ›ЋВˆp\##!#!#%&&)*)**)**-**-)--*)*)-))***--*----/-*0///0/035&8n‡ДСВГЈДДМВВРГББВБААВЏАВБДВЏЏАВББАБЏБВДГМВВВАЂВМДГВДЖДДЖДЗЙМКООРРУУХШЫЬЯЯЯаббвадджтдеезлилйллйзсзззизтмйлллммлуЯмлйтиллйизлумлллилззежозгежеззенембЯанухьиУˆA2PP__a_``^_k__`_^^```_^_^^^^^^^[[\^^^^^[[\^ZZZX[Z\^\_^\X\^\\[\\^^\h^\^^\\\\\h^^L[\^\\^^^\^_\\[^\^\Z\[\^[hPB==E@Чџџўџјњџъвq“iЅџџўўџђойыщяялпИЛИОлсјџЪ'f\TTTUZ^``_^j\^^^\^``^_`^__^^_^`^^`^^wP``__`^_`__`_^``_^``^__^^^^[\^_^^\_^[^`^`__``___^^``^^a__L[^^`_ac`a__`_k_`NCtлћџџяхощоспщспщощссощоооопдсоспноссстспсппоспыоомоопсопттсссопомоонмлмлмлцизжбвЯЧТПКДДВ ­ЙЈКЉЋЗЉЈВЈЃЄЃЁЃЃЂŸ Žœ›œЁ Ÿ››ŸŸœš­œЅ››Љ™››™Ž›œ™Ž™™œšŸœЄЋЃa^8!6554444655645544444324345333233/-)'#Wf6HKXKLPNKJKXNKLLKJKLLLLNJKLL;KLLKKNKKLNLKLKLKLKIKJNLJLNKKNJLNKLKWKJKKJINKKJLLLIJLXJeJIHFICFIIIKJIIFIHHJJFJIKJIJLJЎџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџksrqrpqnonopopopnn‚ponjigcZR^^_[^_a`\^a_^^^j^`^^__^^_^at^`ji^^83 ѕџђєэосссщнсяпмоосссопвсппооснноопЮпппсоощспосопномообогммллйземаЬЬеРОМЗ ЏЂЌ­­Ќ­ОЊЈЉДЇЅЄЄЏЄЄ–ЂЃ ­ Ÿ› ЂŸЅЊ›™›œ ŸŸЊ›ЇЁЁŸ œ›šœŸ œŸ  ЏЁŸДˆcN=088643484665354545343443335240320-)'!/^\5FLKKKKLKKLKKKLKKKKNLJKKLKKLLLLKKKJKJLLLKKKLKJNLNKLKLKKJKLJKKKKLKJJKKJJKLKIJIIJHIIJIJHIJKIJIJIJIHFIIKJJIJJK­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‰krrsqsrppopnoonkmnnijggfftW=A\oiiigefhgffdcddc`a`^^[\XZVWUVVVUUTTRRRQQRPPQPQPPPNNNLLLKNLLKLKLJKJLJKLLKPTpU!&!%#&)))'))-***--/*//**--)-/-------/--/--///003203&)6g™ЯЯИЙЗИЙЗДЖЖДЖЙЙИДПЖГГБВБЇДДГГВББВВВДГВВВВВБЄЏГДВГДГГГДГДГДЗГДБГЖДЖСИММОЛЪОВРСЭЧЩЧЩЮЮзЮаабгдвтзжзицжзззззллъилллиймйЭзлтизййийиллйзисжоутоцуЛˆ3A^^^^_^___^^^^^_^_j^_`__`^_^^`_^\^_^_\^_^^^^\\^[\^^^^\\\[\[j\Igg\[[^^[[\\[[WXZZZ\\^_^\[^[\[g[\^^[\ZZ\g\fZZdcXWWV_TTQQPPPPNLZB42!APXZ^aQQџџџяъдЦџџџџџџџџџџџџџџџђџџЏnh|kigkXPN[P^R^RRPQTVTQRTTTTRVTVRTTUVUVVUUUVWXWVV[[\\gm[[\^^^^^__\\\[\Z\[\\^[^\\^^^\^i^^`^j^^_^^^i^\gh^\\\^^a__j\^\^^__^____^^i^^`a^`^^_^^R0nЙќљ§ѕооонощомооппмоыосщоЭосоооссоппосщооосноооооолмъчьъаллйсижРажЩУ­ОИДЏЏЏЗ­ЖЌ­МЈЈЈЄЅАЈЄЅЏЂВ­ЁЂŸА’Б Ž‘ šœЉЁ ЈŸœœ ŸˆЋŸšŸ­Јœ ŸЂЂЂЁГАЂt_>*8566545834564444454544534443202/)))##'Kw5HLNLNNKKKNLKKNNLKKJKLLJKIXJNKLLLKNKKLNKLKJLJNNLNKKLKNKKLILJJJKLJKIIKLXLLKKIHFHHIIIIIIJJHJIIIIIFIIIHIKKJKJ­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‰mqrrprqrpopnokmkmomkjgfcck[P@Xwgigffedfecdaaa`_^o\\ZXWWVVTTUUVUTTQRRPRQPPPPPQPPNLNPLKLJNLLKKLJKKKKKLLPUg%&%!!&&))*)***-**-*-/---0*/---R0-*-*--/-/-/-0//203336I`“ЧЧЬЦКШКЗИДРЖЖИЙЦДГЖДГДВГБГММВВВВГГВЛВВГДВВВДГВДОГДДЄВОВГДДГДДДДЗРИЖИТЙИМКОООРРСЦЧЧШЫЭЯЯЯЯаблШджзззижоежжзЬйммйлззйлзйзлиййлтилзтиижунооъђпЋX*A^\^^_^`^_\[`^\^^^^_____^_^_``_^‘^^^^^^^ZZ_^^_^^[\^^^^^[^\\^[[[cm\^^\\\\[\\[\XVXf\^\^_^\[\^\[[ZZ[[ZidcXaW_T^QPPNNLLIIHHFCBB@@>832<\edf^|`3џџџџџуџџџџџџџџџџџџџњџџџЂthdeci`KHIJLN^XX_PP\\PRR^RPRUURRUUTUQVTRTTTQUTRUUWVWUXZZX\\\\^^^[\Z\\\^\[^^\\^\\\^\^^^^_^^^^i[\^^\^^_[\[[^__^^_^^____^__`^``^^^^_a_`^`^``^^\F…хџўђхъоннмооомгпсспоооспснссссспдощопсощопооомнмнмнмммлллзумаЯЬЧТРКДЛА­­ЋЖЋК­ЈЉВБЄЄЈЃЃЏЅЅЃЂŸ Ђ“ЂЂЈ ŸЂ ЏœœœЋЈЈŸ›Ї›ŸœЏ ›œ ŸЏЂЏЁОДЃha3*;68446654444355454444344443B322//*&%/_ZEFWNNLLLLNJLKKKLXJLILKKIKNNLJNLJKJLKKLKKILKKNKJK^JLLKJKLLLLKKJLKIJKLLPJKJKIIHJKLKHJHJIJIIHJJFHFJJJIJJJKJJЎџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџhsonqqronmponnkmmokjkggdaqXNLBtfgfedfdddcc`_a_^^[[[XWVXVUTTUTUTRRTRQQRQPQNPPPPQPLLLLJLLKLKKKNJKIKLKNN^t[%#!#%#&'&))*)**-**-)*-/----//-H-//0*/)*-/---///000245#&@Z мдРСПООЙЙЙИЗИИИЙЙЗЖЖЗЗЖВВВВБВВЅВВГВВВБДДОВДДГДДДГДДОДВДДДВГОЖДДЗЗЗДДИЙИЌЙМЪППРРСУЦХЩЩЮЯЮЮмЯЮЯмдзззижЬззжзжжЬхйлийзтзйлйллийллллтзиесхтэщИk/;H^^^__^`_^`^[^_`k_^^_^^^^_`^^_^`^^^_^\\^\^g\\^^\\^[\\^\\\\^[\gXZft&mf^^\\\X[^\[[fXZ^[^\\^^^\f\ZXcWf_^R^QPNLIIEEEBB>>><<<;866556556220&EX\^VooуџџџџџџџџџџџџџџџџџџˆR&zg[nnj_/@<@A@ABAFFIIUKWN_PPPQPQPPTRRTTTRQRRRTTTUVUQRRTVVWUVWXW[Xe[ZZ[[^^\[\\^^\\[\^^^^_^\\^^^^__\_^^^\Z\\^^^^^\_^_j^`_^k`____^^^j^^`_```__``^^QCNКїіћ№умооцнццмппщппссооосспщпщдсонгоопооппоммпоохмлмачззйЪгКлЬЮРМЙВВ­ЌЌЋКЁЊЈЈЈЅЈЈЄЅЃЄ˜ЃЅЄЃЂ ЊЁŸЂЊ ›œŸЁЂЂ™ŸŽŸŽœЇš››œŒœŸœŸŸ Љ‘ŸЁЁДЃK`>&54656544544454444443333243220220*'#!RnFFKNJLLKJKLKKILJJKJNNKNKNLNNLLKKKLKKJLJLKJJXJNKJJKKLNLLLLKKLJJLLJKLPKKJtJIIHJKIKKJIIJIJIIJFFHIHJJHKHJJKK­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‹^soqpmpnnpokmmokmmkkvighfqV>2Rpeehefeecca`a^`^^^^\XZWVWWUURQRTTTQRRQQPRQQPQPNPPPNLLLKKJLKJJKKKLJKLKNRwT%!!&!!&'&&)'***---**---/---/-/////>0--/-*/0002/200234%)CaЂлгЯТУСРЛКЙИЗЙХИИИЗЖВДЖЖПДГДДДВВВБВГДДГДОДВВДВДДДГДГГЗДВГГВГГДИЗЖИДЗЗДДЗИЙЙКММПЯПГУХЧЩЫЫлЭЮаЯаЯсебееипзззжиизЭиийлллзлзлйллизйииизхцъэяЮЈLBQ_^``^^_^\^_`^^^^`_`a_^\_^__^___^^^^\^^^\^\\[[^^^\\\[\^^\\[^\[Z^\\\gJ`i^_^\ZZX^\[[[[\ZZfZjjdXa`e^[PNKIFEBA@/-<;<888665454444343434222224@C4422A\kЄАЭџџџџщДЋ‚…œBj;@ACCFIJUJVXZPQRRTRRRTRTQTRUTQTTUURUTTVUVXVVVVi[X\g\^\\^[[[[^^^^\^^Z\\^^__\^\^^^[h\Z^^^^^^__^`^_a____j\`aa^^^_ka`_^_^_^_`j^^R{чџѓілммоооноопнпнпоосссмннпооооночпнонспныоцноайфммзйсзЯйЯЮЧУОИЖЈВЏЁЋЊ­ЌœЖЇЇЅЇ‘ЄВ˜­ЄЅЄЂЃВ”ŸЃЂŸš‘ЈЁ Ё›œœŸ Ї›šœЊœ››œ››Ÿ œŸŸАЁŸ­ЗЈ\a<*;6665656444444445355344434432232/-&#&^\FFKLKNJKKKJNKLKJKKLNKKKJJNKNKKIIKKLKKJJKLLKKKLKKLJKJLNLJIJLKIJKIKNLKLKNKIHFJJIJJKJIJKIIIIJFJJIIIKHVIKKLЎџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџŒipqpooopmnmmnmkmihhghhggfkXL<;8;668665566544443344432P4333334!4&>@0@*@-#&3&#2E%/&&A/>&6&66&86666666688;<<<=>@AFIJ`NX^Z[QQRRTQRTRRRTUURTRTRRRRRTRTVVWXX[ZX[X[\^^^\^\^^\^Z^^^\^\^_^^^^^Z\_`^\^_^^^^_`^_^^^___a`__`^^^__^_^^^_`_^^^P>_ШџџѕуцнннЬооочопоппсмнопсщоопоанпнпщпссчбоммммлмлтйлзгбблЪвПЛКЙХК­Њ­­ЏМЊЉЊЊЈД™ЅЅЄЄЂЄ­ЃЃ–ЋЂЃАЇ œŸ ššš› ‹™™›œЇ Ћ›Њ›œ›ЁŸœ ŸЏЂЁОЄxKN%;664464454344445463453420232320/-)'##KnHFILKKNJKNKNKLNKKLXJJLXLNJNNLKJJKLNKL8JLJKJKKKKLJLKLKKKJJKIJIKJJKLLKJLKHFFHHJKJKIJJKJKJJFIIHFIKJJJIIKJ­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ„hpnnmmznnnkkmkkkkjhjihgfdjVL8Tjggffcdd`cmc``^^^[ZWWXVVWVRTRUTRQRRQPQRQQPPPPPPPPPJKNKJLLKKKKLKNIKKL^vQ#!!#&''''*-**-)**--*-)/*-//*//---**--/-*=-0/2/200245))>a­слЪЧЦЧЧХСРПЛЙЗКИЗИГДДДДДДГДГЅВДГГВВУЗДГДОВВВДГРРДЖЗДГЗЙЖГДТДВДИЗДЖЗДДЖДЗЙЙЗИЙЙЙЛКОРТСУЦШЪШЪзЯЯаХХЯмсгжжеззйийлййзилзллллйтллллфсыяѕдšI!C__`_^_^^`^^^^^_^^^^^^^`___^^^^[\^^\\^\i^\^_^\\^^^\^^^\\\^\^\Z\[[[[\\\\^[Zh4p\[\\[ZXcW`ed\[NJJHBA>';%866855554845445865444543445%5');8;;<>>@@AFFIEHHFIIIJKLPPB322*&5<8C@=RRPLKIJJ;HJHHHEBBCA@AA>>==<;;<<'#86666&&';&->A0BEIIKWXZPQQ^RUTTTTUTTUVRQQRRRTTTRUTWVUWX\\\g\[\\\\[Z\^\\_^[_^^^_^h^^^^^^_j\^^^_^_^^`__^a__`^_^``_^`^^[i^^^`p^h[H›ѓѕђхухопоопнгосщомщсоспсщосооооосощеопонмъммлиллчиебааЬбТШОИЗБ­ЋЋЋЏЗ ЉЋЉЊЖЅЈЄЈЅŽЂЂЂЃЂЂЄЄЃŸŸЁ  œВœ›œ›™œœœ›ЇšЈ™Ѕœ›ЌŸ Ÿ‰Џ›œ’ЂЂ­ЃЋjd=-88645455345455444444254344333220/*'%#!LpFEJXPLLKLJJLNLKLKJKKLNNKIKKKKKWKJKKKILJKLKLKLJLKIKLNIKLKJJKKJKJJKJKJKKIHHFIJIJJLJJJKJJHIIIIIIKJHJJJIJЎџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџuspononommokmmnmwjihhhhfecoVL=Rpfeedcdd_^__`_^[[XZVWWWTUTTTRRRRRRQPQQQPQNPPPPPPLNZKJLJJLKLLLILKKLN^zF!#!#%%&'&**)-*)*-)***)65%644443544334445455568668;;<=>>@ACCcHFIJKKLLPPQRTRUUUXeXXWd[Z^^^^_^^_a_h^^^^kZXXhVUWTTRTQQPRE@@LL=JHFEECCAA@==<<;88'''8'8);<=ACCHJKWP`c^TTQRTUTTQRPQTQTQRRRRRRVVXZ[XZZ\^\^^\\\\\^^\\^[\\\^\^^^^^^^^^^^^^_^__^^`a___^__a`_^_`\\^^``^^^^^^\^AсџџїчъосщноыннопппояоощпщонмноспопчмнмнонлйилълззгаазиЧЗОИЗГВА­ЏЗЏЉЈЈЉЉЈЈАЈДЃЂЁЄЂЃДВЃЄЄŸœЈЁЂœššœœœЅœ›ŸœœŸ™œŸ Ÿ›ЁЏ›œŸ  ЏЂДЂwa@%86864443433343444443444322423020/*'##W|54JXLXPLKLLNKPKLXKNKXKJKKLIJLJJIJKKJKKNKKKLKNKNjJKLJJKJKKINKJJKKKIJKKHFHIIJIHIJIHJJIJJEHJHHJKIHFHKJJ­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџutpmmznmjjmmjjmjjhithhhecd_UL=Tpdeeaaa``_^[\^\[XXZVWVURTUTTRRQQRPPPQPPNNPPPNPNPPLLKLLJJKLKJKJLLNKatF&##''&')**))**---------*//-//-/0-//0//-///002002325&J^ЏьъмсваЮЫЩЩЧСТСПМЙЛЙЗДВГВДОДДОДВГГВДДЖУДЈГЖПГДВДИЖЈЖЖДЖИЖЗДЗДРЖЗДГДИДВЖЗИЖРИЖДДДЙЙИККМППТУУУМШЪЭЭЯЮогдгггвжззежззжисйлйзсщйспнуъѓмœQ*E```_`^^^^_^`^^^^_^^^^^_^_^_^\i^^[^^^^\^_\^^^\^\\^\[^^^Z[[\[\[\\^[[\\\\[[\Z\\\[kEma\PLKJEA>*;66645442544453344!545566;<<@>@ABFHJJKLNNNPQQTUaVhXZ[kgghnhg^^dtajjkkmtpfdncsnsacmndtpiprioxoor}an^s—xT^HKWPHQTRQPPLLLJJFEBBC>><;)'88)))<>>ACFIVLLZP\RQQRQRQRQRRRTURTRTUTTTUXVX[Z[\[^[\‰\[^^^\[\\^^^^\^^\\\^_^_^^^`^^j^___\^^`^^^___^^^\_^^^^_\^^^_^A;ТџќєщщцчпонцнпщоооодпощсчцпыдпнсоопоомщлчмилззпжеЯУЭЪУШАЙРДВБЂ­ЋЖЉЉЊЅ˜ЈšЅЇЄЂЂЄЃЄЅ˜ЂЄЋЁ‘œ  Ÿ››Ÿ  šœšœЌŸœГЏ››ŸŸœŸЁ‘›Ё  ЂЋЂЏБjd2-;8655554435334443453323222223400**'#!![`C4IJJLKKJLLNLNNLLKKKJLJKKJKLJLKJKKKK^KKKKLLKJLKLLJJJKIIJWJKLJJIKIKLKIHFHJJIJnFIHJJIIHTFIJJIIJIIHIIK­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ|dpkkmnkjmj{jjkhhgghgigfechRK@BEEIJKJLPPTV`VWVcddjfk^ii_i`oj``tca```acf`cUccNfhhfWVaaaa`dccaR_`R`c``ch›e`afЃЏˆ…œХЧ dhp^m^\[XZJH8;4;QLJHHEEA@=<<*))%%*-=/ACFIJNZ[QPRR_TRTTU_QTRURRTRTVVUVWXZZXXZ[ZZ\^^\[\^^^^^^i[\^`^^_^^`^_^^^^^^^_\__^^^^__^^_`^_^^^\\^^_^^^Q!іџёфммммннщпногоосппобомцгцопппсоомммймфйиизузпЮЮШХРПХЗЗВВАЌЏЏЖЊГЈЇЈЉЈАЄЂЃЄЄЂЅВЃЂА‹  Ђ   Ÿœ ЋŸŸŸ› ŸЈ›Ÿ ‘­ŸœŸ Ё  ŸŸЂЋЁЂДБЂxVP&;5465354485565454443422433342200/*)!#&-'=%%)*<>@EETJKXP^TRRRRTRRTTVTTU`RURQQTTURVWWWZ[Z\[\^^^^^[^^\\^_`a``\_`^^^_^^\_^_^^^^`_^^^_`^`__^^\^^_^^[^^\^6ƒчџџіяллмчопоонньсоыннмцммнососсмвымлмщлзсЬежсвЯоЛТаОЙДОББААЏЌЋГЊЉЉОЈЈЃЃЃ­ЃЄЂЙЁ“З Ј  Ё­ŸЈЂ œ œœœЅšЈ›œЁ­“ ЂЁŸŸœŸЂЋ•Ÿ ЃДce8&<5665534K53444332344322334322002--'!'HaF0IIKJKNLLPNNJKNJLKKLLKKLLKJLKJKLPLLNNKLKKKLKK^LJJLL^LKKIIKLLKJJIHHEFFIFAFJJJKJIIIIUHHFIIIHJJJKHЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџtfmijkihikjghhhgggfgfecddk[PIJVi`ca__^^^^Z[ZXVWXWVVVVTUTRTRQQPPNQPQPPPNNLPNPPPLNKLKKKJLKJJLJLLftC#!!#%#))-*)---*-))-*/*-***)-//---//---/000/000002345'3BcУћђсспмонлжвваЭЩЫЧЧХУРРММПКИЖЗИИЙЙДЋЖЋЖИЖЗШИЖЊДДЗЙЙИЖЗЦЗДЙЙЗИЗЗЗЖИЗДЗЖИТУКИДЖЗУИИИЙИЙИКЛООССЖУТЦШЩЩЩЬЮЮЭагвеждехздевгзззожфхђћ­R@R_^___`j\^`^_^^__`_````_`^__^^^^^\[\^\^\[\^^^^\^^[Z\^\\\\^^\^^^\[\^\^\f[ZZX`T\PKJHBAA;8#'333434222222455&6<=@CFFIKLPQRTVWhZ[fkg\n_j`__R`aKBLNLXgQU•`_o„kjkw{ƒƒ}}{”•€‡‡Š“‹ˆ‡…ƒj{‹k‡ƒ‡ƒk}{w{vwjmjjgeeh[CKLNBPR_R`^QPcwЂВСЗИ‚dzpon^^\[VaTTPNKJIBAA=****--/ACFVLLP\QRdURTTUVVUUUTRQQTRQPTTTVZZZ[\[[g\^^\\^^^`_`^_j^\j^^^^_[^^_^^^j^_^^\^``_^^_^\\^^^^^__^^_^>Xој§№ыннмпоонссссщнмоппооосщппноцмллмллЮзегеЧЮЮЧЦУДМЙГАББЏИ­ЙЈЊЋЋ™ЇЃЂЄЄЃЂЂЂЂЊЁœŸ  ŸЁЂЂЈŸŸŸœЏœšœЁŸŸŸœЌЌ ЁЁЉŸЁ­ЂЃЂЊ ЖТЏZR&86566435544354433333534443232020-*%%)F`EBIKNKJLNNKNLKLLNNLKLKKJKKIKJKKLLZLKKJKKKJLKLKLJKKLIJKKIJIIKLWIIJHFETIE>E[HKJJJIKIJJFJJIIHJJKJJ­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџxrnkmvjihghhhefgffzggfdcajWK36ji_`_j^^^\[XZXUVVUUUTTVTTTRRRTPQPQPPPPLPNNLPNPPNNLLNJKLLKKJKLK>T|A!##!!'''&))-*****-/-)*/-***--/---/---//00000*02202255'&CkДјыъыттопонлЫаЯаЮЬЩЪШЧССССЯРЙМЛЙЛЛЛЙЙЙЙЖИ­КЙЙЙИЖДЙЙККЙЗИИСЙЗЙКЗЗИЖРЗЙЖДИКЙЧЖЖЖДЈДИИЙИКЛКЛООРТУРХЦЧЧЩШЧЭЮЮйгббжжддеемвджждощїмšB%U``q^^`^`__\__a__^_^^_^_^^``^^^^^^^^^h\[\[\\\^^_^\^\\^\n^\\^[^^^[\\\\[^\XXaURPLJEA@<<68654-#-22343334856<@BBFHJNPPTVVX[f\\gh^___^IHNLNIIPW^Lrq€€Š”}‚щ‘­ƒ‘•„‹‡}vtjzk{wvijjmxnjmzyhy{j€jzk„z||}{ƒ}wƒƒ{‚}tz{mkvtshfgfcdUcVUPJQP@LUa``mmtqtqj`o^\WXTQPKIF3A>=<*)*)@BEIWPPPQQQTRQRVQQQRPQTQPTRQ`TRTUd[ZZZgh\[^^^_`___`^^^^i^_^^^^__^^_^^__^^^^^`___^^^__\^^^^_^^_^I&AЮќўіхфоончссосщбоноппоомооомынмлщнмлмзижждлЮЫЧХЮМИДГАБЏИЋЊВЊВЇЖЈЇВЄЄЃЃЂ••Ђ “Џ ЁŸ’ ‘ЁЁЁ’ œŸ­Ї››œЌ  ЁЂ  ‘› ŸЂ  ЁЂ’ЂЂЃЂЄЄЄВПQQ6864456344364443433533343243232/*)&%ƒ&5_EBIVKNLKNLLKKLLLNKKLKJKJJJKKKNLKKKKJKLIJLKLJKK^JLJJJKLWJIJJJKJIVICFFHEABHIJHJHHHJIFHKJJJVJ^IJHJЎџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџwcnkgjhgihhgfgefefefdad`j^VN3%Xi_`^^^[\[\XZWVWVUTRTTTRRRRQTTQQPPPNNNNNNPPPNLNNNLNNKKKJJKKKNPdzE!!#)&)&)--)--/**-----/*-------0////-*2/22/2-2002345'<885434644/#)224458;<@EFHLNPRTWce\g^^^_`_TKEE4B==PffzzœŽ–ВЧœЛДЄ‹ŒВzjQmkXfVgdce`T``R`_^^^^^^J[\^^c_P\\^^\^^^^^^^^a``ccacpfpeppgx€zzˆi€ƒƒƒyy‚|…oj\gghWUaa``P_`ededwrzsopeXVTPPKHHCB/=--'->@CHJK^[Q^QRUQTTRQRTTTRTQTRQRTTTUVWXfZ^^^\^^_____i\^^^^^^\^^^^^^^^^^^`^`a_``_^^^^^^j__^\i^^^^^P'6ЖўџѓснмннппссппоосоогосоооонмммълмчлхззгвмеЩХРЛИЙХВЙЏЌЖЋЈВœЅЊЅšЇ‘ЅЅЅЄЄЃЂЄЂЁЂЃЂЂŸЂЂЊЏ“Ÿ АŸŸ›œš ŸЊ Јœ БЁЂ‘ЏŸ Ÿ”ЂЃЄГЂЂЃЊЏg6;655466444445432424333334324220//*'##6fF/IKNNJNJLKKLKNLJJIKJLKKKLJLJNJLLLJJINKKKLLKJKLNKJILLIKJKLLKIJJFBFHHHHHFKIJJIIJFEHIIFIJIJJJKKJ­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџyrkiigfghgeeegcdefdecca_^WP=LPW^__^\[[ZZXXWWTUTUTTRRTRRQTTURPQQNLP[PPNLPPPPLNPLJLNLaJKLJJLNm}A%!##!)'))6*/-)/**----//**/---*/-/--///-/0-//02332435!)HгџјыхчщчутссммлззевЮЮЮЩЧЧШЧУУРЏЪТССОООООЮМОЧМУЙЙКУЙЙЙИЗЙЙЗИЙЛЛЙИИККЙЙЙЧЙИЛЛКЛИЙЙЙЙКИИЙМЙКОМППООРТТУЮЧЧЧЦМЩЭЯЯЦввгмгбавнпђыС|3%=Ta`a`_^^_^^^^_^_^^__^_^`_^o^^__\^^\^^^\\^^^[[\^\[\\[[[\n\\\^[\Z\h^[Z[dX`_RNJFCB>=;8665432433444#5;=>BEFKLPTUVX[khh^_``TF))0@BHKLNP^TUTRRRPURTTQPUTQRTQQPRUWWZ[[\[^`^^^^^^^^[^\^^_^[^\\^^^^^^^^`^_^_[^i^_^`^j^\[\Z^^[^_P%їџѓэмнмссоппочноопстсопмцнмнллллЯлйздвЯЮЪЦЫРКДДВЏАЂЋЋЈЇЇЉЉЇ—Й™ЇЅЅЅЂ–БЄЄБЃЂЄ АЂЂЂЂ ­› œ œЇ››››ЁЂЂЁœœ ЊЂЂЂЂ ЂЂЄБ”ЂЂЄЁВЋЏneR38563666444543423432434433202332/--&#&FeA@FVKLLKKKLLKNNKJIKKLLKLJJJJJKKJJJWLJNJJKJLNcLLLLKLKKJJJKLKKLJIEFHFHIIIJILIHHJJEIIJKJHIHILLKJ­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџvokhgghfeededed`acd`cc_^WQNNRh[^_^\[XeXXXWXVTRTTTTRRRPRRPQRRQPPNPNPPNPPPNNNLKLLKLLKKJKJKLNfkA###&5)))**H)-/*/-/--/-///---//--//--//-000202343563HaжќьыцщщччцхфссомлсзгваоЮЪЩЬЩЧУТУТТУУПРСРЩРООЧОЛКЛЛКЙЙЙЧЛКЛЛМЛККМКЙММУМЙОМКЛККЙККККЙЛКЛООПМЙМЮРППССТСЦЧЛЦЧХЩЩЮЯанЯабобопђіР|#-B``c`ca_^^\^`^^``^^^^^^^\^^^\^_^^^^^^\^[^^^_\\\^\\Z\\Z[[\^^[[\^^[ZZ[ZWUTQPJIEBA<=;66555434343466;=;>CHK!#2BEJWN[\P^QPTTTTQRTTVUTQPPPVUTVWXWZ[^^^\\\[^\\\\^^^^^^_^\^i^^^[__^i\^^\^^_^^^_^\[\^^^^^`j\^4ѕўќыычпоооопдэпыъъононцоохЯллчллзпвгаЮдЛРРЛРЈБКА­ДЋДЊЈЈЊЈЇЄЅЅЏЃЄЄ–ЃЃЂЄЂЄЌЂЂЂЂЁЊЁЁЁ Ÿœ ЊˆЂЂ“›œœ ŸЂЁЂ ЃБЂЃЃЂЄЄЄЃЂЄРЏ}[<&8566655565543545355343343344200-/*'#с&C>W-HJNLLLKLLKNKNLJJKNLKNLJIJJIKKJKKKLNKILKLKLKNNLJJLLLKLL'!!#&&''*--*------00/------*----///--00/00000243436*'TyОџћхчщъчщцщхххусоолиздебЯЯЮЭегбЦЦЯУУТРУУСЖРРОРРШПЛОМОМОБКХЛХМЛЛМЛЛЪМЙКМОПЦЙЛЛЏЛХЛАЙОЛЛМЛПЬОККРРСРРРРРХЮХЯЯЦЧШдЮЮЯЯЯЯжмяъЖ^/Eca`a``a_\`^_^_p^``_^^\_^^[^^i^^^^\^\^_[^\\\^\^Z\[^\\q\[\\^_\\g^[[edaURPJKFEBB=<;655444435466;<=@CFJNQ`ij\k\fg^`RRN5-J8EŽТохўв№АŸni^@;>;ICLPZVVVWUTTRdPP^PNLLNWJJZFHFIKL;LLJIHEHEHFIVLXLKJJJIIEB=><;=@FFHLNJJHJJHIIJJKLJKLPLPQPPPUWTVTTWWWXLN^_`cdqxˆ€ƒƒi€hca`_PPPNP^^^^mmvmkXWUTPLJJFBA2--&BEILXPQRTTRTQQRTUUQRPRRRTRTUVXX[\[\[g^^^[[\^\\i^`_^^\^\^^_^\^^^^^^^i\\^^^^\\\\\\\\__^^\\8„ыџђщноночоопнгпсщппооХхлмлммллизегЯаоЙЯПОИГЛАРЌЌ­ИЈЈЅЈВЄЅЈЄЄЇГЅ˜ЅЅ—ЂЅЃЄЁЂЋЂЁЁŸЂБЁŸ‘ŸЁЌ‘Ÿ‘ŸЊЁ  ЂЈЁ Ђ  Є—ЄЃЅЄЃЄЂЄЏЃГЖБƒTF';8854653552455345445443423232020-*''!##!PE2IWPPNKLKJKLLJLNKNLLKKWKIJKKKIKLLIKLKKLJNLKLNhNJJKKJKKLLLKUB')>@BFZHHJHFJIHIHFFIIJJHHIIJKJ­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџxmhfgzgfcccac`_c```__^^ZXW\\Z^^\\[ZZWUWUWUURTRTRRRRRPRPQPPPPQPNNPLPNNNPLNNLNLKLKLKKLKJNN^s>!#!!%%&*-***--0/**///-/-//---C-----//000/0/003233K6)*JrЯўќєчъъъщёщщхфхьутсмллижфбЯаЮЮЮЫЪЧзЩЦХУХУУУТРСРСТСООЧМОЬПОПЏМОЛОЦЛПОММКЛРОЛЛМЩКМОЧООЛЫООБОЧООКООРРПДСТУУХУЧЧШШЩЫЫжЮилѓоЗ^'6I^ac`arc^`^j^^_^^____^_^^\\^^\[\^^^^^^^^^^\[\\^\^[^\\^\\^\\^\^^Z\[cVTRNJFCB@=<;6564544434456*>AEIILPUcf^aeefgVC>068LiˆШў§эџаР€pPQBULNmcLHCABBA@BHHJIFHEECJ40-**%3;=EJLPLJICAABCEFHHIHHH8XKJJKNNLNNPPQQQRTQEUVX[P__eod…}}rzrdRaJQLKK^^iwnvfjXWVRPNKHE3A-2/EHKNZQRQRRRRTPRPQRPQTRRTTUVVUVZZ\Z^^^[\[\[^^_^_^^^\[^^^^^^^^^\_^[^^^^\h^^^^\[^^\^_^^^\>zыџџынпоооцмммнщоонхнмннхнлмчзитмлЮЭЧаОЙЙДЃБЏИ­ŸЇЈЙЇЈЇЅЄЇЈЈЈЄЅАЄЇЅЄЏЄБЂЃЂ Ÿ œАГЁ œŸ‘Ÿ  ŸЁ Њ Ђ ЁЉЂЁ ЋЄЌЄЂЛЂЃЄЄЅ™˜ЄЌУy\C#;664444465555445334332233222300//*/%!!CnC-JWKJJKKLLLNKLNKLLLIJKKJKIKLJKKKNKJLLLLLJKNK>=;885544544456;>A6JNAPTWW[^aef^WPCQ!Pw™ХщяћщсЌˆ_I>BFAFCJXWVUUQRRPPPNPNLLLPKKLLIJIVKJJRT'8/))-4<@FJPNKIC@L@>=>>AA@@@>R>;0&%&%#%/5=EIPKNJIA>=@>@@@ABBCCETHHTJJJIIJJKLJJLKNNPPRQQVWWZXZ[^_cop‚ˆ„Œ}hecKKKEC^^^hwn^pg\hTQPKFC3--2BEILNN^RTTRQTPRQTUTTRRURUTUVUXXZ[\\^\^\^[\^\^^^^^^_\^\_^\^^^^^^^\\\^\^\\[[^Z^^\[\h\^^Ajђџ§яъомъвммоцммбннохммнмммиЫевЦЮЬЧУОЛЖОВЏБЏЋВЉЅБЇЇЈЄЅЉЗЇЇАЄЇЄЄЄЄЂЁ Ђ•ЂЊŸŸ’œœ­›ЏŸœЁŸЁЂЂВЃЊ ЁŸЏЂЃŒЄЃЂЄ”ЄЃЇГЄЈЈИПЩ{^E#8656654554445434442442223233020/*'&'!!#&6RC3IJLKKNLLLPLKKLLLcJIKKKIJKNLJKIKLLNKILKKNJJKLJK_KKNJJWJKIIE<8=ACBBBEIKIIKWIJHHHIIFIIIJJJ­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ`^ffedca``_^`_^^^___^^^^[^q`XWX[\ZXWVUUVUTVTRRRTPQPQQPPPPPPPQPNPLNNPLNNNKNN`LLKLNJKKLPn{<'#!%'')--**W---/--*//-///-=//0//-///02023/2244446!NrлџјъъыыыыыъъоыыъччцххспыоммйовдвлаЮЫЭЩЩЩбЧЦШЧХХУТУХУСРППРЪРРСРРРСРОППРШППЭОПОМКБММОПРРОПЛЪОЙОООКОРРПРРРСТСЦУЧУЧаажоъиЇ^6U`_aa``ac`_^_`_`^^^^\`__`^^^\^^^\[[^^\\_^^^^^^^\\[\[\^[[\[[ZZZeZaUQNJFCAA>=<885554433356<>BCIKB_XVg`^__`LKA4KViЂјгџџћй­‚TP30E>LJHVUTTTTPRNRNLKKLJKKKKVJJJTIFFEPCCBAJ4#-)##0H>ELRQKFA<855446666665K5/&!!!!#-4>UPPRNJF>=<====<=<=A>>>CA@@BBBCFHTHIIHHIHIJJJLLPPPQPRTUVWL^_`es‰Є›‰‘ymPKKIHP^^`ssih\jXUPPJF4--%ACULZPQcRQRQTRTTTPTTUVTTTVUUVVWZWZ^\Z\h^[\\^____^i\^_^^\^i^^^^\\^^^^\\^[\_^^\^^^^^^^P{ъџўхнђнъцмнлмнмоЯммфймлззжеоЯдЫлРЏСЖДВББ­ЊЋЉЉЈЄЅЈЅ™ЈВЈБšЅБ™ЄЖЄВЂЊЂЂЌЃЋЁœŸ  ЁЉŸ’ ЁЂЊЂЂŸ ЂЊЂЁЁ•ЄЂВЄЄЃЄЄЂЄЈ›œДЌАУЬŠZ>/'8456645544543434444342B502333/--)*!!#J^CAFV^JXKKLKLNLJLLZKIIJKKNKKJKKLLNLLJKJLLKLIKJKLKLLJqJLKKIIEABBCBCEC3IJJJIJJKIJIJJIIJJIKLЎџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџiihaccac__^^_^^\^^^^\^^_^`k^XUdZ[XVUVWTQURURTRTQR^PPPPPPPPPPQPP[NNPNNPLZKNNLNLKLKJLPQyt<'!!!%%%)A*=0--//----//20/-0///0--/00/00/2232333456)JnеџјъѓьыыъыыыѓыъъъщъцчцхсоснммйзжеевйЯЮЫШШШШЩЩдЧТУУбУУУСРДУСТДСРСРЫСРРЮРШРРМВПОПЛОРПООППППВМООБПОПОМРРСРТРСЭХвХЮЧХгодЌW!;T„gcma`_`_c_j_a``^^^^^^___^^^^[[^^[[\^^^^_^^^[\\\^[\[^\\[ZZ\[ZWVRRPIFCA>=;<;6554553568&<>BIINPRXgЈлЏ‹˜^=-06F’ЧџџџфнЉˆP>24B@PIWWVUR_PPPNLPNLLPLJKKUTTRRQPBNAK>=<6554420'!##!!/H@IPagPIA5%*))*)*)**)*0*%!!!%!%-4ANUWVPJQ;66E;;;;<;=K>@<>>>=<@@@@@>ABACBCFEFRHIIIIIJKNPPQRQTUHXL^RPc‚xОЂР“ok\PN=IN^^_pp`q\eVTPLHCA&30FKJNPP\RRRRUTQTUUTVRTTTUTTRWTWW[^^\^\[^_`_^^_^^\_^^\^^^\\^\\^^^^^\_^^^^^^^o^\i^^\^@‰эџџхлноомнмоммхмлллйлЫужЯуЬЧЦСЮКДДГБ­ЛЌ•ЉЌЋЈЇАЈЄЇДЅЇЇЄЈИЇЅ™ЄЌ–Ё ­ЄЂЄ  ЂЁЁ ЃЊЁŸЈЂЁЁЂВŸ’ŸЂœŸ‹ВЄЌЃЏЂВЂЇЅЈВЊЌАЗЧЪЯP/)84564555654544443444443432330200/'%###6TP0EJJLKLLNKLKNLNNLLIIKLLLKKLXKNZLJWILLLKKKLKIJNLZNKL_KKIHFEQEFFFFFFHJHJIIJJIIIIIIIKJIJKЎџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ`^fda___`_^\\^^^^^Z[\\\n^\^^XEUWXXWWVWRRRQRRRRRQQQPPPPPPNPNNNPNPPPLNKNLKKKLLLLKKLKLPgs*'m#&&&)**-/-/---/--*-0//*0/0-//0-0/0/0020203448#*C{пџјъыыыэьыщъыыыъщъъъщщхцьзсопнйззздгабЯЮЪЫЪзЪЧЧХУЦЧЦУТУССУбХСЖРДЬТУСУССРДОРООЬРЧАПСРРОРЯППЮОМОЛОППОООСРРРТТХЦУСеЮзвЈZ-@Nc€Œfa`a_a`c`^a^_c`^`^^^__^^^^^^^\Z^\\^_^^^^\^h^\^^\^Z\[[^\XZcaUQKHEEBA@=888443345658;>BCIJPRUWXhajЃ‹P=>;8552!/--*')''%#%!!!!0ICNfee_IA3%%#!###)###%'*')/'')''*6FPVjiTJV%%-00022I468<<;=<==<>=@>==><@==<@@A@ACECEHJL^V=8=LLNNPPRRTIK=ViŽЗ  „rWTK=<88554333458)>C5KPRVXe\_`TU@&AЩўџџџж™X0%6E8XWWTTTRQPPNKNKNLXXL[HX[PNA=<;532--**&)''%%#'%!!!########%%%/HENhZrpJJ2&#!######''*--**/-)*4EcgfjVLX3'##%&&'*)*0468;;<<<=;<>>>><>=><=<=<>===>@AHPЋˆRN=;'645443458;>EHLPUWX[hs`RHE'-[{Мџџџџъ”hH2@4BZVVRRQQNPLLLLNNWVJIRQPB><8630/**&&&'#!###%!%%!'#'%%&#%&&'')))**%5=R`d`fB4/-'*''#&%##%#&)*-0/-///'0>Z[dwaU\&#%!%####!&*0034456;<;=>=<=>=>@<=;====<<=;ideecc`a`aa^````_`_a``_`_^[\^^^\\[_^^\\\\ZZg\\\^[[^Z\ \^^[XVUQNIFBA@>@==;8š!445588<@EIKPUWf^i``K8)FŒўџџџвАQ'#-2F@URRRPNLLNKLZNLVIIREBQ=852/%)')&%##%#%#!%##&%#&&''**-/0-*---)/--203!!#88&5%5%#%&!%%40#6HE0'2-'&&!!!!#!%'--0234255566;8<<==>><>@>A>@@><<=<--4EFUKW_QQPLLJJK=LPPQTTF@>@j‹ЧиЄ”dF*FNTdammti^XRQNK82046KLQcQTPTRQRRUTRQQ_TTQQTTTWWZ[[Z[\^\\^^^^Z[^^\\\\^[\^^^^^^_`__a^^[[h\\\\\\^\^^;ЙіјымящмхлнлзжеЯзЪЪЧТАМИЈДВВВБ­ЏЋЊЌЊЈЉЉВЇЄЄЄЈ˜ВЅЄЈЇšБЇВЂЄЈЇЄЂЂЁАЃЌЂЃЌЂЃЄЁЃЄЄЅЂЂЂЂЂЂЂЂЂЄЃЁЄЁЂЄЂ”ЄЅЅЙЌВСОСУтЫЭЮсёя›F>)*;666665543435334533423523442332/-'!!0Z80/302/*///---0/-//////000000224446!Ixвџђъь№ёјяяэьэььэььыыыъъыыычщцчххфсппоомтеЪггвгвбЯПЭЮЬЫЫШЧЧЧШЦЧЧЧеШЧУХбИИЦУТСРТРУУУССРЫУЯРССЮУЫСППЯОЮЫСРСТТРПМйнЛvL0mzddec_```_ca_`_`a`_`ca_^^\^Z\^^\\^\_^^\^\[^[[[[^^\[\\^^\\jj^PKECB@>==<;865&&&458<@CILPTZ\_adX=3%-I›ъџџџџА^f00>PJZWURPPNLKLLKW\UUXEBKP650/%*'&#%#!!!#!#%%'&&&**-024465;;;<<5'%&-)0BA4F55JLA>=;=<<;8<>>0BUqˆvP[N_NL=LKLNPNPQFKLBPptŸлжЬ’`&5;XTefsqp^[dTNI636FINNPfQRRTTTRQQRURQQUQQQTUTVXX[X[\\[\\^\^[^^^^[\[[\^i_`___\_`__^^^\\\Z\^^^^^\_2@иџќхйхмлямзздлЮзЧТОЛКЙДВГВАЙЏЏЌЋ­ЋЉЊЌГЈЇБЈЇЈВЊЉЈЇЇДЃ–Є™ЈЈЃŒБЃЃЂЂ•ЃЃЃЃЄЄЄЃЄЅ­–ЂЂЁЁЁЋБЙЃЃЂ–ЂЄЅЅЅЊЏБДХСИЦИлЯоалхўšH-<88566544324454453343432443423222))%EE;-F[NPLLLKJLKLJIJKLKKKKLLLLNLLLNNKKJIIILJKLNLKLKLJJIFHHFIIHF[JIIIIJJHEFIJJIFEIKJJKНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџbc_^^^[[X[XXXZVVUXWWVTTTPPgWVXjWVVTTTRTRPPRPQPPNRPRPPQ[NPNPNNNLPPLLLZZLNLLLKKKNnm&&!&'-)--//02-/--0-/0=/-/----00-02/2333356#!>ˆъџџѓья№яяяяяњяэьяэыэяьыыєыыщчщщчцчуссссолЮзеобагаЮЭЮЭЫЬЫОжЩЩЧЦЧЦШШЧУТУХЮУЦЧХУУУСгЮУРССТУУРСРРУЬТРРРОРСРПРПЬЩйзР€38jWx‚a_`adca```_`a_`__^``_\^^^^^^\\[\^^^\\^\[[\[Z[\^[[\ZZeXWTQLIEBA>>>=;655454488=AEJNQVd\ikdWH'0™Žџџџџмtv**-ANKUVQPPPNLLKVUIHFPB@;H40/''&%%'/%##'&##&'''-/345E;<>K@BABCB3E2EFEHJVL^cdakgefXmg__^mk\nn_^\^gkmkejjefneiZmiirkqqjofihfa`^^UTHHC@>=&%#&#!!3!0020/302333466;;>@K@>>=<;8<=;;/#8jK`^NLZ`\QK6NIJKNPPRCH2EWtšЌїЙЊ^WIFPVconrt`gXTPK;8-8INPRTRQTTUR_URQRURQRPRURRRWWWZ\\[\\[^[[[_[[\\^\^\^_^`_^aa`_^^^^\^\[^\\^^\^^RRеџѕъмфлиежмЯЬаУОКЛИИЗДВКБЏЏЏЋŸХ­КЌЈЉЈЉЉЉЇЈЈЊЈЄЇАЄ˜ЇЛЉЈЈЅЄЄГЄЃДКЄЂЂЂЃЏГЄЂЃЙ“ЂЃЂЌЂЂЂЄЏЄЄЄЃВЄДЈЋИВДЙОТЧЩиЮОЯгувчјМ;>*<88666556444454544443343443333A/0-)#!0PJ'CJNNPLJJJJKIIKKKKNKKNKrKJKXJKKLNKKKJJLLJKLKLKKLJIEHEFIIIE^HVIIIJIIHIJHIHIIHJIJJНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ`V`^^\[[XXVXVZXVWUXWUTTUPP_TTWiWVTTRTRQPRRQPPPPPPPPQPLNLNPNJLNKNNNNLLKKLLLKIJNz^&&A!!%&--/-*/00//-////-*//--000--/002233356#!P„оџђјяэяёяяяяэьяњяяэьээээыъъъъщщщщщячхуфущммйипегжггаЯЭЮЬЪЬЩЩЩЧШЧЧШжЩУУУТЮЧУЧУЦССТУЦХУТЖССРДРРРРСРРПРПОПШРЧХЪбХŽC0KcaTPa`__dc`aa````k___`a_^^^^^^^^^^^^^^\^Z\Z^^[^[[^\[X\ZdXeQLIFCA@>=<;8544444;8<@EIPQWX^_ccL=%E™ђџџџџЙ{=''IHLWWUTQPNLLNLKTREB><6400%-&&%!!##&#&&&*--30548;NJAACAE5F;JJ>>=<;<;<8<<-@EXHVXN``ZL;66FLJLLNPTF6K5[‰МџмИŽZEABFccexr`\XUPLI88ILPP^^TRRTTRRQRQTTQTRPRUUWVVXZZZ\\Z[X^^^\^^^^_^^^^^^_a`^\_^^^[_^[Zh^[[^^`j^ExёџіозеедбЪЩЦДРКИЗДПДВААЏРЏЋ­РЏЏЏЊЋГИЈ›ВЗЉЗЈ™ЅЇ˜˜ЈЈ›ЉЈšДЈБЄ‘АЇЅЏЄЏЄГЄЄЂЃЂЄЄЄЏЄЁЃВЃЅЄЏЅЇЇЇЈЉАВЖЙвТЦиЭЬЬмгесЧпжёЈ;4*<8664646434655445544344243423330/-)#!!@F=&CJJKLJJIKIJLNJKLKJNPPLNKJLKLLLLKKKKIKKLNJKKKKJJIFEFHJHIFFFIIIIFJJIIJIIIIIIJVIIНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ\a_^^^\XZWZZWWXWWVUTTURTQPTCEVWUTTRQPRRQPPPPRPPQPPQPPNPLNPPNLLLPNPNNLLNNLJKKPmk!'!!%&&***//-230/--//-//0/-//0/00022333358-5;‹чџџьяя№№ј№яяяяяэьэяяэяяяяэьыыъщчщщщщцчхттпмнмлзиззждгваЯЮЫЫЫШЩЧШЧЧШШЩШЧХЙЦЧХЦХЮСУУЦЧЧЙУССУЯЫРРРРЖЮРЩРВПОЛОвлЫ‘K%HdRama___`cccaa__```^_^^_^^^^__^^^`_^_^\_^\\^[\[^[\^^\[ZXWUPJFEAA>>=<<864334#5;>EHLPV\oqc`PC&EœџџџџјИV6@8PKWWCQQPQ\[XVIWEAQ;522*'%#%%%###%&#'&-33P8<<;8;<<<&->BFKWK^aLHI35CHFJKNPQ-E[NLKLLNJKKLJLNLKNKP>===68644335;>BHNQVZ\_`hV@HБџџџџђŒK#5FJWWTPPPPa\cNVHFA>642-*)%###!!%')'**/238>=<885634688!%#=AABCCBB02E@X^F4>=LLNAQPPQTFUWVZdZjoywozxrosk`^^^^^^doefdXKFC-/)#43345868H=PJ<<;;;;;;=-@BFII[[cHC/3EEFEJKPPCF=-;g›лёџЛsI6AHfcaqr[VQPKJ86IKN[RTUURTTTRURTTTRRQQQRRUVXeZ\gg^\^^\^\^_^^_^^^`_^^^`^`^^\\^^^^^^[_^^__^5XЪїсЯзСПОЛЙЙДЊЊВВГВККЏ­ЌЏЖЊЌЋЏУ­ИЈЉЉЉГЈЈБЈЈЊЗЉЋЉЇЇЈЇЈВЈЉЉЉЈЈЈИš™АЅЄДЇЇЄ—ЄЄЛЈДБЇЈЈЋ­ЌВДЙМОЦЩШЫлЮУбдЩзезжихоъёЏ=<-*;;665455435445646454444443323220/'&!!!28<@=<;88644%8=@EKNdWZ^keX>-{АџџџџО^5!/FKUTTRQQ^PNKTFN=863#*'&%###!%%''-248AEC53;>PTX\\^`_ofv–Ž‡tsƒkyp^\[VUQQNIFB@=8&%4%68;;;88&8>FNVUNFB<;4!-***-))*)/38<;;=;<;8A=w‘}PIEFFFIIIIJIIHIIIJJNNPQTWVVZomvyqzp}^^_^\\mcfheLKU30'%#!#344488;6-3LŸђџџГmH)=L`aprhfVRPJ--8KLPcRRRTTTRTTRRQR^PPRURRUVXZXZZ[[Z[Z^_^`_`^^^^j^^aa_^[^^\_^j__^_^^^p^^^QmаонМЛОКЪЙЖРУУЈВВГБАЏ­ЏЋЉЊЋЗ­ЊЉЋЉЉЗЈЈЊЈЋŸЈЈЙЈЇВЈВЉЈВЈЅЅЉЉВЇЇЈЇЈБ›ЉЉЄ•ЃЃ—Ї›ЇВЇЙЏЌЏУДЙОУШОЬжУбЯдеежсзжЭлизщјСPX4*<866644555465563324234324332000--*%!#/5P=BULKKLKJKLKKJKNNKKJJIKKKLKLNNKKKJLLPPLLJJLICFHFIFABCFEIIIHIFHIJILJIIIKJJK|ОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџN_\[ZXWVUBRUUUURTRTRRQPQTRUVUWaTRRQRRPNPLNNNPPPPPNNP[NNNNPLLNNKLLLKNJJILPv\%!!&&''-2>/0/0/0/0000////220000232358Lˆчџўяёђђё№№я№ё№№№ёёяёђ№№№№яя№ё№яяяяяяяэыъщщъщхххху№уомммйзожгпЯамЮЫЩЪЫЫЩЩгЪЦЦШШЧЦЦЧЯХХЦЯЦХУУБУУХУСРСРППЧЫзЮ“P3jgdgqcd_a_c`___``^a_`c__^^_^^^[^`^^`\^^^^^^\^^^^^^^^XWX`PJHEAB@>>>><86466I;>CILQWZ[^`LBTЋџџџџеf25@PXURQQPg^PXKHE@;420*)'&%##!%')-/25;=PAECC66LRUXZ_`c[Š{š‡ˆ—‹ct_[XTUPPPNLFEA>='#!#'&&&&'*-03333328@JQThTIB;53/0-*---*-0/34444344425A=[tnQJFAQCEFFFFFEC2A0B@@AAE6I;JLNP@TFWX\mmvxƒypa_aa\fiahfPXJC*'5#34556N=II<[;=;;;=AACEEFR[WB'FHIIIJKLLQE=;-A’яџџВ^30288JKPQ^eTRTRQRQQRRQQTTRRQTRVUUWZ[Z\^[\^^^^_\^^__j_``^^^^\^\`^^Z\_N^^\\^\\E™лвЦКЛИЙДЗРУГРГГАЏЏА­ЖЊ­­ЉЌЏЏ ЊЊЊЈœЊДЌДЊЌЌЋЋЉЊЇЇ›ЇЇЅЇšЈœДšЇЅЄЇЈœЉЙЇЈЄ–АЈЈЈЈŸДЗЏБГЙОЮХШиЮЮбдмддзйилсизйсуяїš/LA<8;68866555544334542243444324230//)&!/N<*BUKKLNJLKLJKLKZKLKIKLLKKLKJNKJJKJLLKKKLJJ\CAFHIHCEEEEIFIJFIFIIKJHJHJIKIIJНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџM_^ZXWWVQQQUVUURTUUTUQQT`UVXU8VUTRRRQPPPNPPPPPPPPNNPNNNLPNNLPKLLKLKKKJJPmX&%#%**=*%J-0/00020--00000/200224358%*H‡щџіјёяёёёђёя№ёё№№№ё№№№№№я№яя№№я№яяяяяјяыыыыђщчхщцфцфтщохйижзинШввУжЬЫЩЬЬЬЪЬЩЩШЫзЩЧМаЦУЮЦЧЦХУУЦХХСТСТСРУжвБe-=<=;<8543%8-AFLP_W\jaVH*^Œџџџџф™#-IKXVTRUUR[_^KRB>850/*)'&%%&&''-248FI@AB4F0LPTW[^aegi|ЂЈ“У{{_ZXTQQLJHEA@<;);;4!/--'&%&&''&%''-///20026CPa\mZNB822-0-----//>0---/0-E-/05CPZ\ZVLE@BBBCCCECCVA>=<>><<=>BBCFHIHJJK>@ABQUVZ[pˆƒƒspj^\^\eqik_LJ3)&!##556;EJ[RVX^acR='rїџџџъz>&8^XVAQQPR}{LHCA<542--)&%#&&&'-348HJA@B066LRWX^aWif‘™АЃŸweaNL8NLJIF><86430//-%-*)''&))%'&')'*--//00022BA>;;;<;<<=>=@EFFEFHJHIHIIJKL=PBHWZ[pzzzs`_^[[egg[^KE2'#!%55;;=<;<8;<>ACQFITXRFEEFIJIIJKKPC=3I›щџ­Ž/&-JPeЏР“vF<68/8IPPR^RRQUTRQRURQPRRRTPQRUUWZW[^[\^^\_j^^_^^`^\\^^`^^^^[\_^\__^\[^_^^^^@cЬзУВДГВДДВРБКЃПБАЏИИАЌМЏАЏ­ЏЖЋЋ™ЋЂ­Ќ­ЉЉЌЌЈЇБЇЇЇЈšЄЈЅЅЇЄЇЈЈЈЈЈЛЙЋЈЊЋЌ­ЊЌ­ЏПГЖМРУЧЪЫЯЦъдгзежзззЬзйЮзллсоџ\pfN/>8866668664644434233443334322400--)&08TACHWJLLLKJKKJLLJKJNLLNNNKKKKJKLJKKLKLJKLIIIIFFFFFAAEHHJJIIHHJIKVIIKJJIJJОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџH_[XXZWTUTVVUUUPRRUUTTQTTRaXWTRRQQRQPQPNPPPNLNPLPNNPPNPPNNPLLLNZNPJIKPv\!!!!!!!!#&*)--///000///22200220222444882-Qwуџіјђѓѓѓѓђђѓё№ёђђђђђђђђёёё№№ёёђђёё№яяё№я№яььыыъъъщцмчххуосомллЮйждгабЮЮЫЮЭЪиЩЬЫШаЩШЩКЧЧЛЧЧЦЦУЧУУбТУСавжЮЂE2Fm€a^`_aca`ac`_`^___``^^^_^^^_^^^^^`^^^r^_^\_^^\^^\iX_PJEB@@@@>=;8654%8<@ELQTZ^`aVHcМџџџџBFHZVTRPQRdWJHE>;32/-*'%&&&%*-048H>AAC54<>RX[_Thj›˜ЌВ‹…d`EIRPKJF@<8%43!//*)'-)&)-))')'''))*---0/00344443443ACCFFFXIFC'5KIII;KQPU0=!qЩџџсdLs•ЗЊyWC8J;8JNPQRRUQRRTTURTTRRQQRRQQRTcZ\[\Z[^_^^^^\^^_^\^^N^_\^[^^^\^_\[\_^[\\^^_%œеЧХОДДДУВВБВМВАЃЁАБ­ЏАЏЌЏЏЏЌКЗ­ЏЏЉЊЋЈИЈЅЄЅЈВЊЉЉЅЅИЈЇЄЈЈЋЋЊЋЉЊДЊЌЋЌЖЋЏИЂЖЙКРЮеЫЪнйасзезозсйзжзийуммлфєцџПP/-;66545855545543434434332332A3222-*R%0;P=CIKXLNLLKJKKXJK^KLKLNLZNKPLIKLJJIJXKLLIHIVIIIHFCEBHIJJIHFHHFJIHFIJIIKKНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџQ_ZWWXWWVRUUVTTTTTTTRTQUR>VURPNPPPPPPPQPLNPLNPPPPNNLLNLNLPLNNNLNNKJJPvX%!!!!&%3*)*/-0//00/0/20//022233344;%K‡уџј№ѓѓєѓѓђђђњђёёђђђђёђђђёђђёёђёђђёђђљђ№я№яэььыыыъъъъъ№щчхфтоомщлйииужбЯЯаЯЮЬЫЬдгЩКЖЪвЩЧадХЧЦКЧЧЦУСУРидлЏ_3EUafXd`__aa`a^``c_^`\_^`^^^_^\\\^\^^j^_^^^^^^i\^^^\\dVRNJFB@>@>>==;86558=CHNQU[_ng0@ЉџџџџЭh*!0QKVRQNL[`h`EA=632/))%&&'&)*04EHIK>BC8BCEFFFFEHHFHFIIHHIHHI;KKLAQAVX^sp^RR^XqhaPJC*%#66;><=<<;<>BCBFEFXIIgEEaHIJA­оЯВВБЈОВВУДВВАЙ­ЏВВА­ЗЌЖЋ­ЋМБОЂ­ЌЈЈЉЉЈЊЈЊЋЉЊЊЇЅЇЈЈЉЉЈЋУЉЉЉЉЉЋ­ЏЌЗЏЏЏЈЙЧСУЧЭЮТХввжззЬззЫлиийлмнлйииздыџЏKC*;686656444444444444B344332334022-*%!##*K;%BTJKLKLNKLLJLLLJKLLLLNLPNXLNLJJKLKKJLJJIJKIHIFH2FIHFHJHFTFIFIIFJIKJJKОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџE^ZVZVWUWVURTTTRRQQTTTPQTBRUUL8PQPQPNPNNNNPNNNPPPNPPLPNLNNKLNPLKKIJ;68666)>EINUX\_egE#eзџџџы‡!8NNWRPNNP^KIEB=830-*'&'%''*038;I@AAB3;<64!-*')'))))''T--022356543/-----//048<@ABANCCBCAK'>KW[^aoVF60--//34;<=<<><=;8530204=Ph^_knRH6000000/0///002--*-*/30235<=AAPECCFCFFIIHHHHHFEEHEFHHJRVZ\nЈ­{aa_P\egcNJB*%8;<>>J==<<<<>>@BRHJ\%NCZmII;K=NEJ-)BШџџќV/”Їx^dTQL;8HLP\RQPQPTTUPQRQRRPNPQQTRUXVXZ\[Z\[^^^[^_^\\h^^^^^^_`^\^^\\^\[^\^h^[[&mЯбЛВОДГМДЃВВВВББВРААЏЌ­ЋЊ­ЋЏБАПЌЌЊЋЈЋЋЌЏЌЏ­ЈЉЈЈЊЋЋЈЈЋ­ЛЊЉЈЊ­Ќ­ЋЏЙГДИМРХЧгЮЭавгседзийййхзжиифмлййллииціТ;F'*8586655546453433J434433243234300-'&C5F)BTWXKLKNNKKKKKLKL_PKLKKKKKNKJLJJNNJWIHKJIIJIIECIIJIFJJHFIFHHIIIJIJIJНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџE^XWXWVVVUTTPURQPLNRTRPQfQUVUNLNQPPPPNPNLLNLNNNNPPNNLPLNPPNKKLLKHIN‚Z&!!#!!##%'**--///-/0000/3/-332433358&T}ъџљђћѕіѕѕѕѓєєѓєѓѓђѓѓѓєєѓђђђ№№яя№ёђђёёђњђёёё№яяяэььыъщъъъъщхцуффспнмлЫзозжебЯбЯЬЭЮЫЭЮЫЪЫЫЪЦЧШаЧЧЦЧХЬЮзгЃL*J_dnaa`ac_`aaaa_a`_____^\^_^^`__^^^^^^_^^_kk^^^^\\[dgRKHCCAAAT=J<<65;;PV\TNcˆЉПсЧ hP8F@JFA<6400%*****)**--/033668;>>=@@=84/////0005;@PFFHHEEHHHHP*>Lffh_n`H;/---04;>@ALAA@@>=H8654!@@^^z’ŸvgaQZX_\LH3#%';;

>>><;;-PFpT@;8*>CHf\IIJJPP>0_оџџЙ</BH\g[XWTNK5*JL[\PRTTRQTRQQRPNRRPQQQRVWXjZZ[\h\^^^\[[^^^^\[^^j^_^\\\\^^^[\L^\\\\P6ЉаЬВЧЇГБВВЛГПКВГВЛВЙЏЛ­ЗЏЌЌЏААЂЌЌЊЊЌ­­ЏЖЌ­ЋЅЈЙЊЉЊЛЊЊЈЇ’ГДЋЏЗЏЂГЊЩБШУШЬЭЯалдгжжжхззхзЫизззлщйизмщмЯчоџ­I6&)68886644554444C4534333334534220/-'#&)B88BJKNLJPLXLNLKNLLNKKKLJLLKNZNKJIJKJLIHIJJIIIEBEFJIJJHUFFHHFHIKIJKIKKОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџM^[WWWUVVUVTRTQRPJ8QPPNLQPUcaQLQPPNPLLNLKLNNLLLNPPLNLLLNNPLLJKJHJNz\&!!'#!%%%%))*-//002/200203/23334446*Rъџўљђѓєєѕіѕѕѕєєієђђѓєѕѕѕѓђђњђяяёё№ђѓђђёёђё№я№ёёё№яьыыыыыщъщххчэхсппомйизеждвЯЦбУЬЯжЮжЮЪЪЩЪШЩШЧЧЧЧвЯмгУ6@P_``_``^cpd_a^``__`a_^^^_^^^^^_^^^_^^\^jP^^^a^`^^\XV^LFEBA@AW>@<<6;&>BJNRW\_neK<\Ьџџџў—'IB>)%2#-&*'*)*-0/00244;<==AACZCEEEPB<84/0---/05KdgXengF6-**038=>>AA>>>=<<<==85=^gdknkUH832322/0--***-)))&&#'&&%%&)*/33556;@RL>=<>*BQ=<<88;-@HHHJJHJKPQH'>Јџџњs&5PN^y\XPPdI48NPRRQRPPQTQQPQTRPPPPRQRVWXZ[^^\o^[[^^^^i^^[\_`^_\^^^^[Z[^\[^\\^^^[<_ЦШМБВВКБВВЏЏЏВБВАЏЌЏЏЏМЏЋИБЙЏ­ЌЊŸДЊЋЊ ­ЌЉЈЈЈЇВЊЙЊЉЈВЈЉ­­­ЂЏВГЦЏМССЦШиЮпбвнЩжЪзиизиййциззйлллтлллъмлњъАL5&<6<66665564544434344334333333320/)%/5;8CUWKKLLKKLNNLLKKKLKLLXLLNILKJJJKKIIJHHIHFFBEIIHJK_HIIFJIJIIIIKKHHIНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџM\XWUVVTTTUVURTRNPNPQPPPNNVZZUQPPPNNNLLNKKLPNNNNPPLNLLKLNPNLKIIINhd#!!#%#!)))-*=-//2/00322223333558*Hхџўђєєѓєєѕѕѕіѕђѓѕєєєѕєєєѓѓѓѓѓђђѓђђђєєєєђђђђђўѓђё№№яяьььэјыъъъщчххйфпоомйлззждгЧонЯУЮЭЭЫЬЧШЪЩЧЦаШШЧеиТ”K-Wfa`\^^``_tpec_`_a`_`_^^\__^^^^_^^^^_^^^^`a`k^__i^[aRK6CBAA@A@>=<68&;@CJPTW^cfX@&*щџџџцe3ZNXTQLNKKZQB>632/*)<&&'-0454&**26;<>>@A@>@>>>>>==84PKPRUh_E<855686420///-**'''&&'%%##%%&'*/0/0246;=K>A@BCBEFEFHHFCECECCCHFEFFHL<5@LP|‘TKQ\WUQI2%'&;=@ALAAA@C=>A>><;<>=A[ZIHIILPPH-kџџоk;2-';;85564555434445455342233323302-%!/A6'A[KNNJKKLNNNJKKNNKKLKLKJKKKJWKJKKJHFHHHFQCCIIKIJIIJICHJJIHIJKILIKНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџIP[WXWVVRRVTUUQTPQPRPQPLJLTgVVQPPPNPPNNPNLLNPPPPNPPPNLLPPNLKJHHNsQ%!!%&))--/-/-/20022H23433446%Jнџјљѓѓѓєѕѕѕііїїіѕѓѕїіѕѕѕєѓѓѓѓєђђєќѕѓєѕєєѓђєєѓѓђђђђ№эяэээьыьььыъщщчххыуонмйтижднждЯаЮЮЭЪЭЫОЫЫЧЧШШШвелОh*8apya___^`^_ca`_^^_^_``j\^^^^^_j^^_`^^^^_`\^^aq_^^kXRKICAA>AAA@>=;66%AENPVZ_cfRB%QЃџџџџŸ>4CJVFPNNLTQC>8420/*'))-%06;=JAAA25NFNRL[zАСыПpP<@;<4/&&#!//0-%-0034668<=>ABCEFHHJJJIIJKJKJIFB=542/20/048>CHHHJIJHFHFHCCN<*/))&'<>>@@AAA20A0@@@/><%!-C3JF'8<<<;;<888554330202-')'&&%%%#'*'&')'*/22468<>K@@APFFEEFEEFEFFEECECEEFHI<<6CEBA@>=<<=>EQEIJHKJNP==ŒџџжJA\^infWRLJ5IKNQQQTPRRRRQQPPPRPPRRRRXeZX[^_^[^[^^Z\\\^iNh^_^^^\^^Z^\^^^^^^^^\\;dГЬШААКБЏА­БОЌЌАЏЂАББЌЗИЏ­ЏЋЌДЋЙЋЖ­ŸЌЌЏЗЌЉЊЉГЉЉˆВЉЋЗ ЏВРЇЙЛПТУШЩелйлбезужжйллймйЬлййзлзлзиициммлцЩх№ЯAN!<88565665454455444445235443B22//*#/368AUWLJNKJJLKKLLKLNKLKNXKKKKJKLLKJJHHHIHCBAFIHIIJJKKICHHIIIJJIWJJLНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџC\WWWUUWRUTTTUQRQTTQPPNLL=QURTQPPPPP[LPNNNNNPPPPQNPNNPPPNLKIIFLrV!&!'!!%%')-*-0-/0/0/23222332446*Aƒфџџѓєѕєѓѓѓєєєѕѕїїііѕѕѕѕѕєѕієѓєєєѓѓѕѕѓєѕєєєѓѓѓђёёёђђђђ№№яээээээѕыъъъщхффуснлллхЬжзжгЯаЮЭЪЫмЮеЫЫШЧЯйсжЈPAA>>=86'852//*-')'-25;I>@@B66PH^LC_›Ч№о›^<3C=E@*Ì#--0023C56;<>@AACFFFFFHIHJJJJKJKLIIIRC<6302////45>NCEFHHEE4C222224--/'545;HFFHFIJLKJKKKLLKKIJKKIH8FB-3%&*'AA@@@@@>=><;<;866443/*-)''')'&&&%##&&'')&2356;;=>>AABCCEFEEEEBEFEEECEEE5FHJ=<>BeС‘ЙŽ[VI\WTPI0!->>K;>CFFWEEA<<<=<>APFHHIJ;LACL5nџџђj3Uc`o^WRLJ5INP\RPRPRPRPPQQQPQRQPTRVVX[\[[\^\^Z\^[^^^Z[^^\^^^^L[^[^^^[[\^\[\\\&‡ЩЧКВКВРЏЙБАЏААЏАЙЏЋЏЂЌЏЌЁЏЏ—Џ­ЌЋЙŸЋЗЏЌŸЛЌДЈЉВЄЇИЊОЂЏВЖЙЙПДУЧЫЭЮЮбдШвезеихйллмлийзищтзйчтллЮлуйлиучјВT2*;8888565645345563444444543222/3!!-06#BJKLXJKLLNKKJLJLKLKJPKKLKKLILJLJVFIFB-AAFIIJJKKLJJFTEFHJIJJJKLKОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџH^XdVUVWUUTTRTRPQRQQPPPPQ>PTPPPPPPPPNNNNNNNPP^QP\PNNNKNPLKJFEJqV#!%!!#!&C*---02/002//232344438*Hщџѕџѕєѕіііѕєєєѕѕїјііѕіііїјіііѕѕієѓєіѕѓєієѕѕѓєіѕѕѓђѓѓё№№№№яяьэяэыьѕыъщхлхуъммйллЮзиижгввЯЯРЯЮЮЫзЧЮлуМa5@adccaaa^___`^`_P`a`_^\_\_^^^_p^`^_a__``_\^_^^oo^ZVQLFCBA@B>@@>><88*BHLPX^`cfI/@{щџџџбP'LPVRPN[q\FA<%330****-%048<>AAB36BICE3kЁжџжŠZ8ACJC>)02/22444566<>@AACEFHFIHKJIIIIKJWJKLLKLJJHC=83030033#6>AB268;;55JLLNPQR^Rf^efigjXkdkdd[[ZiddddiiXhdidZhcg`henmd^^RPPPQPKKK58624322A@>><;65523/*))''''&%&'&'*)*--/0036;8I=>>ACCCCBCFFFFEFFEHHEEIIII;;@6`Ÿ˜ДmTK^ZfQI2%)=6KBCEEQECC@@<=<=>EEHFHHJK>8ArэџџБ<2@Ja`omZRNJ;;LPP^PPQQPRQQRRPQQQQRTVUVX[f\[\[[\[\_^[\^[\[^\[^^\\^[\Z^\^h[XZ^ZZL\ДУЦЏКЏВВАБЃП­ЏВАЂЏЌИЏ­ЏЏ­ЗЗЋЏКЌЌЊ­ЖЊЈ­Ќ ЊЌЈЉЉЈЌЋЌЄГЊЙПССХвЭЮРалдчеЩозфжисзйлззйллзЮхлзллтЯлммуйзєј­C2-&886666586664433546343344243/-*!!*488CIWLLNLLLLLKNLKLXNNLKNLKIKKJJNNJFFFFFEBE[IIJIJIIEIHFHHIKJKLJJJОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџB\ZWWUTUURTTTRQRRRRQPPPT^PRUQNPPPPNNNLLLLNNPQPPPNPPNLKKKKHFHJ_X&!!#!%%&*)/-020Q0020@33323445#Hˆщџџє§ѕѓѕїїјїіѕѕѕіііїјїїіііїіїїіїїіѕѕѕѕєіїєѓђѓєіѕєѓёђѓђђђђђђяяяяэыьіыъъъщххтсомщлчзизжШдвббнбоЭЫШзмЮ“;/V_cdac__`ca`__`_`^_^a__P^^_^^^^^^_```_``^^^\\_^\\aPKFF@>>>>>>>=;';=@FLQW\aegC-/™џџџџЄ=3HZVRPPLJIC=630/-)))&-248<>@@22;PFRH[kОяџзvF53A83''!4222263466;<=>@@BECFFI_LKIJLLKJKKLJNKJLLLKJIFC=;!5&6#%'>AEIJNQTRT`VahmZi[[h_^^^j_^^^atckkqqmrq_``_p__^jak`cac__`^`_^h\m^gkfdikcj`e^RRPNNJ;HFB0><85320--//0***')&'*''*)))//23458<=>>A@@BCBFCCHFCFECEEEFFH8J388LgПмЂˆKVR\hPL4)<>ACEEQECPB@@<==>@CEEIHIKLA=#;иџџЛ^;K`ms^WTPJI;L`PQTRPPQPRTQRRR‚TUTUTUUdZZXZ[[[^^^\^[g\[\^\\[^^^[\\\\\Z\X[^[\[J2вХШЏЏЙБЏЏМЁББЏЏЏБ­ЏЏЁЁЏИšЏ­ЁЋЋЊЋМЉЈЋ­ЏКЊЙЌЋЌДЌЂОГГЙЙРСХЩЬЯмЯввгЧедздозжйийлиЬзззизсЮиимлймлмлцичхќРKC'*86866866555C533464533423222/)##BA56BULJNNLKKKLNLNJLKKJKLLJKKLKJKKKCBFQEACHHJJHIIIFHHFIHFIIJKKJKKОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџAP[XWUVTRURT_QRTTRQQPPQTTTVTTRPPPPPPPNNLNNNPPNPPPNLPNNKLJC6XqC2%!!##&'*---/34300223454448#!Aъџјєіїѕѓѕііїііѕєіјјїїіііѕѕіѕііііієіїїјїііїієєієєєђђђѓђђђђєѓё№яээээээььыъщхфупомлннмзждждвббвЯЮЮмснОs/PUaacaa``_`aa`___^`__^^_j`_j^_``^^_^^___`a__`_n^ea^LEBA@>>@>@@=<88@@FLQW\_e[Q8™џџџџŠK-AJ\URNNLTPA<43-/-)*--24F=J@@A5555@@@BFFFHJIJKJKLKLNLKLNLLJKJJJKIIFHC3&2&BEIJP`Q^iaXj\^\^_j_a_^_niy€ss‰tsxroxwwnwxxzhqwnvgpyvnryz™|syszzzatkk`kj_^___^^^g\ggkjijfd\NKIF3*-'!564320//0-)-*)&&'&)-*/3468;8>>@AAACCEFEEHEECFFEECEF8I<<6QfЙЏЪB;HghPH/#'>ACEEFREQB@>>=<>BEBFHIJJLPC*=СџџЮj-'Qc`^[WRLJI;LPRTQPPPPRPUVVRRTQRQRQUWZWZZXXXZ[\^Z[[\^[^\^^[^[\[[X\ZX^[[ZZ[\\BZДХУЌ­ЏЏЂЏ­ОББЙЏИАИЏЌЌЏЏЌООЉЉЊЈЌЋЉЊЋЋЏ­ЋЖ­ЋЊЋЏЃРГРЙПЖЮЦоЯаЯвбвгвоппЧЧзиизииззжисзйллзйлйфммЯиуЮлйя§ЏF;''8;886565645555464433333332/)%*@46CULKNLNLNKNLLKNNLKKLKKLKNJJKKHEFEB0@EFEIIIFHHHHIIHIHIJIKLKKNОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџC^XXWWUUTTRRTUrUTRRQPPPRPRUUR^RPNQPNNNNNLLNNPLLPPNNLKLKHEEKoZ!#!!!!&)*)-*//3222032234456!FяџџѓўіїїіїііјіѕіїјјјїјјієіїїіїіїјјіїїіїіѕѕїіѓєієђѓєєєѕќєђѓєѓѓђђёяяяяяьььыщщщхфуооомомийзжодгбмЬлзд–63Pdccca_``_``a__^^`_^^`^^\^_^`_^_^^^^Z[_^^a_^`^\\XQLIEA@@>@@=<<;;)@@@BBCEFFFUIIJJKLXJLKLJJJJJJJIHFF6-8502KPQ^_ic[\h^\^j`_pq|Œ‰yrpkjmXXXZWWXKIXHRTQPPPPQPPTRRQQPQQPQQTRHWVVXXX\^mgkktmmpzxozpyi^azdc`__\\Xckjedj[NJHC->-;655642/*))&%))'')*/224568<;=@ABEACEEEEECFFEEFFHFF53/23ešХлЂQ;HZVaK5#@@BFHFFHHFAA>>>=@CCCCHJJLNF/џџџzF@F_jheWQNJIINPQPPPQRQTRRQRUTTRQRQTVWXe\[ZZ\^Z^\\^^^[[^\\^^\[\\\[[^[[Z[Z[\Z[3—СЩЛЌЖ­ЛЏБЏБЙ Џ­ЌЖЌЖ­ЖЌЌЋЈГЈЊЊЈЋДЋ­­ЌЉЋЌЋЋЌЏЏОЊЛРТЮШШЭуабавдгжжфизжжзииЪсщипжийиллЮлимфммиймлулйђјШB35/<886658665585365545434332-'%!*08'A^KJPKKLNKLLKKNNKKKIKKKKKJKKHFTFCEFEFIJIVIIHIJJKIJKHIHKJJILИџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџB\WVWVVVUUUUTTQTRRQQRPPPNQUVTQPPNPNNLLNNNLLK`PNNPLNNLJHEEKoZ%'!!!!!&&*-=//322303334565#&‚ъџіђѕўјјїїјјїјіїјјјјјіїїїіїїјјјїїјїїјјїііііїіѕєєєѕѓђђђєѕѓѓѓѕѓђђёяяяяяяяяяіьыъщчфутоппнммлззжгвжмяРecŒZaa``adca`aaac`^^^__^^`_\^^^_^`_\_^^^\^_j^_^^\hTPFCC>@>>@@=<<8;ACC2-3RE3T^ДџџиfC-=<4/'&5466;;<@>@AAAAAEEEFFFFJJJKJKJKKLKJKKKIHFEE68/58LNRTaZ^^^^`adxˆ|zyz‚wvff\ZXXUURRPNLLHHHFHKQZZ>/5C3BAAEF3CCFECEFECCFHHHICEIL<8A;PNjЄДЛЁ[=UiXQJ)-*ACCFHHRFFCBA>@==AABEHFJK>P*#cеџяŽA=B_^^XWQNK5IKP[QQQPRPQRRTRQQQQRRQTVXZXXZ[^\^[[\^[\^^Zh^^^^\[[^[[\[Z\Z[X[^\CUОТМЌЌИЌЂББЏЏЏЏЊЊЊДЊЊЋЉЊЊЇЉЈЙЋЌ­ЊЌ­ЌЌЌКЌЖЏР ПУЮПХЧЬЭЮСвдвеШддЩдззжзззпзийизжйллиззйзмлймЭтлиллиищџКAP*>8;;86655656645334444233e/'#-36&C[LLKNLKLPKLLKKJKKKJKKLKJKHFFIIHFHFFFIKIIJIIJIVJKJHIJKLWJKНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџH\XVWVUUTVUUTURRUTRRPPQPPPURTRQNLLPLLPPPLLLLNPPNLNKPLI3EKiZ3%#%!!!%&#!!#%&***/0/20222332368!Ezъџџќїіїјјјјјјїјїіїјјјјјјјјїїјјјјјјјїіїјїјїіјјїўієєєѕ§ѕєѓђѓѓѓєђђёяяя№яя№яэя№яьыъщ№хттзссммлйзпжныл­4#[З…[dacccdaca``_ca^^_^\_^^`_^_^_`^^^[\^_p^^j[^\XTNJCBAAB>>>><<88*@FKRZ^ceXB#PОџџџо^=2IQXUQNLUV>;420-////36<=@BB483RK8>`ˆџџЬ6*%>E#%!%588;<>AAAA@BACFEFHIJJHIIJKKJJVIJKJJIIIEE664;;8888;;;<;<<<><;;<<>@=%@EIQN8ECEHHFHFKJJK>NPPPQRUVWZenkpwrzj`q_\i^^\cfdc\PJF3/)!43#-**))*)')-/223456;<>=@ABPCECECEEFCFFEFECFI@032TЈЪУXJU\VN40-0AEEFFHFIFCA@>=>BEECFIHKKP4-8vЬџпz32LN^\ZWTNIH8K[\QPPQRTRRTRPTURQPQRRUWZ[\[\\\Z[[Z\^^^Z^\^\[^Z[ZZ\X[[[\X\^\[N/>™ЛМРКЋЏИПЏЋЛЗЊЉЉДЋЈЈЉЊЈЉЊЉЌЌЌЋЌЉЙЌЋЌ­ЂЏЏКВДЪВУХЪЬЮЬЮвсевнгЦжжжЬиЭфззжзйийлййлсиййймммлймиумфуииѓяТ6;!-;;686666565444353343452/*#!-336A[XNLJNNPNLLKJKLLJLXLLJKLJHIIEHFFBEFHHIIJ6HIJJHIIFHHKJKJLПџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџFZWUVUVVRgUTVTTRRRQQNPQQQRUUUQRNJNNPNNNNPKKNLNNLKLNKICFFq_&!#%!!%!#%#C/**-00323V32446P&#F{яџњ§јјјјјјјјјјіїјјјјјіјјјјјјјјјјјјјјјјјјїјїіїјѕєіїієєієѓђђѓієщђђё№ёђ№я№ёяэяяэяьыыђ№цффхтнммллоыэШm=CŠŠоaeaadcccdccaaa```_^^\i^^^^\^____^^^\i^_^^^fcRPICBB>@>A@=>;8;*>ELRU\crU@!JОџџџОN-EQQZVQPLRB<5!220--#25;I@ABB56>HN<_”ёџх€B!652#&'&66<>>A@ACBBBCCCCFFFHJJJKKIIIKKIFHHHIHFE&4;8NQTVZ[\`apf€˜ˆƒ{t^ZWWRTPPLIHEBA@*//=<)8#653300006>FQEWTLE=86544886666645664565;635AIPCrRHC@@A@AA@CBCHCHFHFJHINKLNPAQTUZ[m}mgq€zj\^ZZ\ehogdXKFA-'5!0///--)**-/00355;58<=>@ABCCBEFFEFEEHFCFFHH<2&2P™џдƒEC^ZTK3'AAAEFI[JJFCB><>>BCCCBFHJKP>!TњџџX48P\\eWPL;IILP\QQPQRQTRRTTRPPQRQQUTXe[\[\\\Z^[\\^\[[\^^[[Z[[WX\X\Z\[^[\[^InРЦЖЈЋ­ЋЋЏЌЌЊЋЊЈЈВЉИЊЉЈЌЋЉЉšЉЋЋЊЉЋЏЏАББДЙОТЮбЬЭЮЯйасЩезддтжзЬхйзежзжиЮйтлллзйилилуйуммллмммлЮзф§МKE!>>;66685564544454444433/)#!!626'BUKJXJKNLLNLJKKLJKJLLLKKIIHFHFBB*FFHHIJJJKIVHVJJJFHJKKKLНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ@[WVVTUUUUUQRTRTUTQPNNUVQVXWQPQPPPKLNLLNLLLLPNJhLLLHE4IhX%!!%&!#&'-**-FK22B344368!Fwхџџѕїјјјљјјјјјјјіјљјјјїјјјљјјјџјјјјјјјјјјјјјїїїѕєѕїієіјѕђєєєѕѕєѓђђђђђђёёё№№яяяяэыыъщцччяфтснщхяќИU0NinZaiVdcc```__ca_``_``^^^^_^^^^^^`^^^^^^^^^^\eUPJFB@@>>@>@>=;8;@FJPU[_d^B#NОџџџй`!>U^[TTQLHA;4!0/-03248=KAAB4-4CC8FwвџџК^/23-')#';<@@>AABCBAECBFFFIIHJJIIJJJFIIFFFCCC2'/2=PTWZ^`Udp}ŒЅxvk^WUUPLJIHC4B20)=-*<<<;<<8;<8553320035>Lf[^iPC=666666866666544444223436EP`WUQLB<<<;==<==A@AABBCCBEFCFCFHIHIKLPQQQTWetfypnh^\Z\XjhcdNIC>*'%!0//--/--022446668<<=@>ACEEFFEEHHCHIEFX-362'!jЅщМs/E\WQJ2&@AEFL‚HHFEB>>=>@AAC2EIIJ>;&5mуџџ02JP^\cUQP>@L@>>=;8;/ELPU\`af=!LоџџџОF8IJ[VUTPWIC85300//23;<@LBCC68CICEdЁџџЫa)%5-%;8;>LNCBBBBCCCCCFEHHJKJJHIIIIFFFCCR33435=@@@BBA@@@>K=;542220035BPZ^jpUF=;;;86;<88686555444222028Jee^fXNC834454688<;<<==@>@@AAB@@AABBBBBBBEEHL>QRRUZjjntpg\\Z[ZXefcJFC>)!#2220//00234466;88;>>BAACBCCEEHFHIW-@>=AABAEHHI>8TЛџџЂZA>>>>@=<<=EJPUX\d[I'Мџџџуa0AUPWTRNKF@;#200/038;=@CEC25=EA3B‹ђџхŽF)2')&)8=AABCBBCCCBCFRFFHHIJKIJJIIHFEBBAAA'3)>>>><<>=<;8845654432022;LW^^`kQE60/2/233334535868<;;>;<<>>=>A><=<>->@*EFEJLPPQTVcnqxza^^[Xjg[^JF0*#4330334434448688<;>=@@@BCCFFFFV*;LABFEH4%<”џК‘P'^XQJ'24EFIIUJHFEBA><=ACA0BEFIJ@%6WШџЌˆ0%C[[ecVQLK5JZPQRRRQQQQTRRRQTTRRRRUZ\[\X[[[^\\\[\Z^^\\Z[[X\[^^Z\^\ZZ\[\ZE)KВЬЙЅЖЊœБЄЄЈЈЇЇВЈЊЇЇЈЉЉГЊЋЋЈ™ЈЙЏВЈЧОПТУЧЬжЯаЦднжжеохзззисЭпзсЭситлЮлЮлтйлЮзцизличллщммммнлфийьъў­>B--;68<655455454455543/)#!#/245A[NLKKNKLJJLJKKKKLLJKJHFIEFIHCFFHJFHJIJKJLIJJ`JHHKLNLНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџэF^XUUUWTURQnRTTQQPPPPPRRPNQRPQNPNPPPNLL_LLNNNKKVIE0IfQ'%!%!!!0!!#!#%'--03R4N45548*Jzщџ§ўјјјјјјјјјјјјјјјјјњљјјљљљјјјјјљјјљњјјјјљћљјјјјјјјјіїієщѕїїјііѕѕєђєѕѕѓѓѓђёђђђђђђ№№яяыъъъцэјџѓЁ4;Kcc`acaefgva`aa`a`a_^_^`^^^^^^__^^^^`^\____^[XULIEA>=>>@>>@>;*>CJNV[`dhIJЖџџџжP0CP^IUPPVF>6#203!248=LABE468CAF)pЗџџйW)%3**&*>@ACCCEEBBBEECEFHHTII^IUIIHECAA@-324>ABAABCCFEEEEIIHJIUHEFEA@;522//00238FT[^k`cI@@B@>@>A@<<<<<6686554433;<;=<;;;<==BEEEHILL=RV[wwzˆ`_\ZXXhfPJC@%434354466868<<<<<@>ABEEFU<;>@BBBCB5I2TдџГe4C^WP<34BFHHIITFEB@<<@AA@VBCFH=52[‚џџ`%=ZfeZUPL<;LPfRQRRTPQRRPPQRRQPRQVZZX[Z[[\ZX\\[[\[Z\\^ZXX\[^hZ\\\\^^[mZ[2%–КИДВЇДЇЅЅЈЇЊЊЈЗЉЈЉЉГЉЊЈЌГЈЈЉАГГИПТУЦЧОЯайЯаезздУззизззизйсйзщйлхилтиллтлллллййулйанмлмннлймйђєЋ88=;8P886684455544524/)###*04#[\KNPKKLLXNLJKKJJKJIJIJHHHTEEF4IHEHJJKKKJIIIJLHFJJKLОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџь>\WVVVUUTRTQQQTQQQPPQQQQR4>QPPPPNNPLPPLJKLLLJKLICBIqn*%%!#!&#!!!#!&%''//00445458Kхџџїјјјјјјјјјјјјјјјјљјјљњјјљџњњњњјјјљњџљјјњњћљљјјјјјїјјјјїјїіііїїіѕєєєєѕѕєѕєєѓђѓђђђђђяяьыъёєџџнp>edccaaacegeeecada``^_^^_j_^^_^^^_^^PДI`^^`^heUQI^2>>A==>>>==<=AHNTX_neN86Ÿџџџзq2CP^XTRZUE@84234248<@NECCC-0V><>Žџџѓz&#*#)*)>APEBCEECEECCCEEEFFHHFFFFFEEABBA-'3@>@@>=>@<<8<;;;586#=LX^achRF622/-/*///0//002234545466;66;88;8<;688;88<>>>@ACCHJILPPQUjfx}zp`\\\cekZVE0*#5443545888888<;;<<=@ABT;;<>@AAPCCC4F=-#pцџœQAJZUK-ECEHIJIIIFC>>==>A>>@CXHJB64KЧџџp8\^eXURLJ8PQRRTQTRQPQPQTQRRQPRTVVX[\\\X[^\ZZ^\\\[Z[X\Xg[\[^^^_\^^^^^\HaРРЅАЅЈЄЅЇЈЈОœЈЇВЇВЈœЈЉЈДЈŸ­ЅГЗОРЮЦбдЯивЯЯбвжедежхжеийжпЬжиЬтЬззЪзхйсиилумумлШлищмммфлмнмнлмичїТKE//=J<;6665544445543E-&#!#-24=QJKNNLLJNKKKJJJLJKKIILJIIHEFHHFIJFIIJKIIIHJJJIKIJLNОџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџь8ZXVUTRTTQTQRPQPNQ^QPPQR_TTPLPPPNPPNPPLLNKKLKJTCBB^sH)&!!!!!!!!!!!#!#%%&--//334556&0=ыџ§ўјљјјјљјјјјјјјјјјјљјјјјљљјјјјљјљљљљљљјјјљљњљљјјјјјїјјјјјјјїѕєѕјјїѕѓєѕѕіѕєєєѓѓѓѓђђђђ№яяэъѓџџРJ)Qddcdedcdaeeeecadd`^`_`^^^^`^_\_^^_^^U˜Lm|^^\cTLHBA@>@>>>=@=;-AFLRX^dfV3;‰џџџуx6FR^WRQNJA<&423234;K@BEFFF6>>><[ПџџКe#&*3-)=>@ACFHHEFCCCEHFFFCEHFHHHECCBB>@-0425RIPHNqŒВаъØ^<06;63000-22546@W>@@@@=>==>>@<<<5=Nc^``hTE<5532344302/002202433353666666;;888;68888;;;==>=>BBACEEFHKLARWxˆ^ t^\^\[f^ZIE0&#%556868;;;<<;<<=>@L;8=<<<@AABVCEBFH;&JŒџЯv0>\WP<-5HIJJKIHFB>=>@AAA/@EHICTKKLLKJKNLNKLKJKJIJVJHHIECFEHIJIKJLJIJKHIKKIKIKLKШџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџэ=ZVUWVRRTRTTQPPPPPRPQQTRWWWUNPQPNPPNLNPLLNLLKHB@@<>C`)%%!!#!!!%!!%#&&*-0044456&-Q|ыџ§ѕџјљњћјјљњјљјјјјљјјљјјљњљљљљљјјјјјљјљљјјљћњљјјљљјјјљјјјјјјјѕіїііїїієѕїііїііієєєѓђёёђёјяјјџщ)>eedddddddececdedaaaa^^_k^\^^i_^_^^_^^^_``^^[XTNFBBA=>=>>@=>=<)FNRX^th_35Aџџџя_&6PQZTQNIC<5332248<@CQQCC43/*%048QWnAJa“ЊвхЌ‹RC&><;;FECCBBBCBCECEEFHHHHJKJJJIJJHIJJJKJIKKKJIIIIEB<6400-//235F8*Jf\_apdKB@B@BAABBCCCBAABBABBNA>&=NV^^aiTF>=<888686545334204424344685688;;;66;6668688<<<;<<=====>@>ACCFJ>PBdfp‰€}s^\ZkfgNI3!%'65658===<=<<<>K)<;<=>8<<>BCCCBCCE5='^тџГW2^Z_;56HIIJIJHQC/@==AP@)ACEJRLNJKKJJNJLJLNJIIIHHJHIFECFJHHIKJIIKIJJKJJIJIJKNЯџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџэCXVTVUTRTRRPQQPPPQPPPUTRXZWUQPQQPPNLNPNNKLLJ[EA>;4!@P*&%####&!!!!!%#''L/222358-%Cwфџўџјјјјљћљјјљљљјјјљљјјјјљљњњњњњњњјїјљљњљљљљњџљјјјјјјјјјјјјјјјјїјјјјјјїїіііїіѕѕіѓђђѓђђё№№яъїџчWKdedecddfeacaccdccc`_`^^_k^_\^\\^i^^\^^_`^^^dUQICA>>>>>=====<>EKQX^chZ;;rјџџјt8@EFFIHFFEECCECBCFCCFECBA@>=<*)-2;PTNJBQ‹­џџч˜PN23A>><<><886666544443344455556888F655468668;;8;<><;<=<<;<==>>>BEFILNQWn‹ŒˆaJaT^hmPJE*'6688<>><><>R)=>><<<8===>@BCPECBB2<-6Дџ_q88^VN6-5IIIIIHECA-=XBA=-ACFIKAeџџсN/K^[jWRP<;KPRRTTRRRPPRQPNNRRQRTTVWWWZZ[f[ZZZZZXX[\XX[Xg\ZZZZ\[\[Z[[[C#ZЗЖЋЇЈЊЇ›ЅЉœЉКЉЊД­ЌЛБКЇРКОТХЧгРлУааагШщздддззфеззижжзихзсзихЪйЫймуитйзслййлизлллмщмммннмммйияјЗIP-;88666685564422*'%!'//34>TLIKKLKKXKLKNIJKIFEHFHICFFKIJIJJJJIHILJIJKJIIKLЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџь=XWUVUURTRQQQ^PPPPQQQR_RWZVUTPPPNPLNLNLNLLKHEA=638@P!-'#!###!!!!!!%&&&*--0245=%JŠђџџіјјљјјљџњјјјјјјљјјјјјјјјјњљњњњћћјјјњњњњњљјјљјјјјљњљјјјјјјјјјјјјїјјїїіїіѕѕѕіѕєієђђѓѓђђ§ћџџџК@'Wdcddeccedcddadcacc`^^`__^_^`^i^^\\^^o\_a`^kWTKFA>@>>>>=>>==>AJQW\`eiF6ьџџџ‹=4Z`WTQLTA;640045;AEFFFEF8>I>;WОџџЩJ&&-0BEEFIIHHHHEEEFFCCBCCCCB@@=<<<)%)6PVRPJiЃЯіМw='28@@>=<<;886;56443555544435565443345588;;;=;<<<<==<<=<<<>==>>0BCI@CCXpzщpTI^[`cNH2!&88<<=@>BR=@A@A>==><=<>@AAAECEBB5;-A3оџЋPFPZQ6-EFHJUIHFC@A)=>>>=>CHILV#!wуџТ4A^g\XVPK<6NQTRRQQQQQPQQPQPPRRQRUXWZWXZWWZ[XZZX[[ZZ\Z\ZZ[[X^[[[^^^\[L%CЅЙЉЅЗГЉЊЊЊЋЊЋ ЉЋЂЂЄГИЫОСЮЧжЪЬлЯааггЩжтееоезйЪзсиЬзсзззйзиизззлллЯлззилуумлсзсЧмлмхмллымфмйзыјЦI0))>8<;8665655532*&!!!#-2/3#LZ\JLPKLLLKL^KJHFEEFFTFAFIJKJIJIJKKKJJKJIHHJLLKЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџэNZWVVVTTTQQQPQQQPPPPPPTQVcURRQPPPPPPLKPNKJIEA>63048@Q!*&%%!#!!!!!#%%#%&')-/0356%*>Žщџ§јјњљљљњњњљњњјљћњљљљјјјљјјјјјјљљљјјљљњњљњњљјјјјљјљљљљљљњљњјјјјјјјјјјјјїјїїієѕіѕєѓѓѓђђђёјјџќƒ=Zfeedecfddcadddanc`a`_`^```___\^_^^^^^^^^^h[TPHCA@>==>=<==<-@HNT[jcgH0>Эџџџ™48Q_XUPLIA;%32246=ACE^HI82;F>6xыџџˆ%&&22@BCRIHJIIHFFECBCABBB@@A@>=;8;-2JQWUJXnЖяёгˆV%36<>;'J`[ZjpmKACEFFHFFHEFFHIEFFIFFFEA!=\_[^`oWIACCACBABBBA@>>><;;;6865P545445455655332245688;<>===>=><<=>===<<<=<<==AAEHNP3BP|ЋˆdL_\g^ZHB#';<<>@@;AB@CBAA@><=>>>>A@EECCCC465)'CЖџš_0QZQ<35FIFIKUHEC>==RA<*@EHK50)œџџ*4=X\eXUQKJJPRPQTQQTRQPQPPPRRQRQVVcWWWX[Z\XeZXXX[[W[\[Z[[[^g[[^\\\^\Z8УЗБГЈГЋЊДЊД­Џ­АЛШЗКЛПУЯШЬЙЮЯЮЮбвнежеЛнжХчисйсзиихизхлззйхзлллллйиззйЯлфллЮлмъмлфлллфЧмммлхьїЫLH5-;;68666544522*&###!%&*@0--4AHKLPNKLLKNKLKJCEFEHHCAEEIILIIJIK^IJJKJHIIJLLLЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџэCZWVTTTTTQRQQQPPPQLNNQQPUXTRPNPPNPLNNLPLKHB><83456<@H/'%&#!!!#!!#!%%#&'*)-/535##Awђџџџњњњљњљљљљљћњћњћљјљљљјјљјјљљјљћџљјјјљњљњњљљјјњјјљњњњњљљћјјјјјјјјјјјјјїїііџїїііѕієѕѕєђђїџџл_Kffecccacdeedaada_caa_aa```__^aa^^^^_^^^i^\\cQJFAAA@>><>==<&@4LQV\`fT2&•џџџВNCJTZTPLH@)63335&@NEFRHF/4<>;FёџџŠ%'0-23ACFHFJIHHFEFFCCEB@A@@=<;;;;%'*'8;\dgiqttT)BEEEHFFRHXFHIFFFEFEFFK8W_UKd^dHAPECCBBBACBP@@>@><<=;888568554544444220/2335566<>>>AL@@A>>A@<=<<<<=;=<<<>AEEFLCCZpоxpQP\[VQI0-<>;'J@@BCBCCCA@A>>A@=AACBBECBBC4-!‡џяw85XR=53FIKWKJICB)@@><<*@FILN50Уџџk*K\feVTP=JLPQQRURRQP^RPPTQRQQRPVXWZX[^\ZXXXZXZZ\[[^\[\[Z[^^\[[[\X\XE`ЛКЏВЉЈЋЊ­Њ­ЏЏМОДЗКОВУЦЫЬЮтУиббудеЦмдежизсжйийийлЮйтижзхЫхйлтйлйлйсихлмлЮщичЯллилиллуйнхлмлтіЇF#!=;68665654540-'#!!!#'&J8#&%3>XKNLKKKLNKJKIEEFEHIBCCFIJVIJJKIKJJIJKJIIKLKKЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџэLZXVTTRPPPQPPPQPPPPNNNPPVWTQPLPNNLNNLPLJFB@=522556>>8-)&%#!!!!!!##!!#&&&3)024H#!H€щџџџњћњњњћћћњњљјљњћќњјљјњћњњњњњћљљњњљљљљљљљњљјјјљћљљјљљјјјјњљјљљјјјјјјјјјјїіѓзєјїјїїіїієђјџџР5Wdeeaaacedecacadaaaa__`a__`_a_^`_`^\^^^^_^ZcUL4nAA>=>@>@====BJQV\jdXF*oџџџйC%CQZVRXEA;%35!58LCFXEH58;C_>QЏџџвN#03EFFIJHIIIFHRCCCECA@A=><;65;'*4IQLF6UЌРџзЄ_!*<@JIJJHFECEECEFCFEEFHIHHHJHIJHHHHHUIFHFECECECBCCBBAEA@@>>><65432-/N)*2U236<=@R6-EHH555@CECE4CE5F5FFEE4ECCECB/'-‚ЮXJ*-EQCEBAABECBAA>@@@@@=>;=<<6666454544300/00232348=@>A>AAABA>@>A@==<=<>=*<=>@ACI<3[PŒЊЂŒhN_\V\KE-=<>BABECBCCEAA=@=<>ABAACBABB35/-%Xщђ…F=^VL5*FFKJJHRCB@=>K>;*@EII>5>ЩџяV%=[[fdVRL<6202458@A=/*&%!#!!!!!!#!!%#%%&)*>3%>qјџџјљљњњљљћћњћћњњћќћќњјљњњћњћћћћћњћњњљјјљљњћћћћњњњќњљјјљњњљјјјљљјјјјїјјјјјјїїјјјјїіііѕєє§§џџ“2eedcdddccaffcccccaac_`_`a_`_`_`^^`_^^_`^^^ZUPIE2@>==@>A><<>@FNUX^dZCRыџџмc8=R[VQPIA8%84%=<;;8545A0HPKB=UЄыџџ™A&B;NKJJHFHHEEECCCEEHFHFFFIIHFHHFIFEREFEEBBCBBAA@@>>AA>>>K=;;;;85424A2-**--0#6;<<)*0/#&*''68IJJJJ=KNL>;NK=L<>@===><8<;885644320/002///036;<=<@A@A@AB@@BCB@L=>AA@@====<;<->3F8B@^˜ЗœЃ^KQ\`\L52*>>@BBCEEFQCBBA>><=@=@ABBCCA>25=&%IЛџЏJ>>>>)&AQIL@#Qщџ=>Z^^eVNLIKPRRRQRRQPQRQRRRQPPPTUUXXWZZ[Xf\XX\[\X[X\\[[\^\^[[Zf[X[[[2&ŒУЦВЉ­ЊЌЏЏЛЖЙЏОЫУЦаЪШЮЮЯЯбЯвддмдгсожфжужзЬзЮчйилищжжжхщзизлмйлЮззщзйййййилЯммллмлйлммннфииьўЛC<#/;885654340*'!-@^<4-&/3ATJLNLKKKLKHHIHHIIEECHEE4FKKHIIHIJHIIJIJINNЯџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџьAXUTTRRQQPQPPPRPNPPPNLPQ_QPPRQPPPNKNNKHC>=642548;@BVK0'&####&!!!%#%&'''-04!Cˆ№џўџњћњћњњљљњћњњљљњќћћћњњњљјљћњњћћќќњјљљњћњљћ§ќћњњњњљљјљљљњџљјљњћћљјјјјјјљјџјјјјјїїѕѕѕѓђёџџц^Bdegeefae`cddddocdcaaaaca`_a`ca^`__^^^_^_^ZWRJ84->=@=>>>>=*>FKQW^`fE;6Ёџџџ–;;V\WQPTA84435;@PXIIIH54EE<;;5545#*8PA@;Q›ШџџЃV#!=PNLKJHIHFEEFEECCCEFFHFRCCEEEEECEEECCAACAAA>@=@@@<<<<<;8;5855344443!%'#B56HJJNNPP`a\^fgggge`ggXhcdi[\\ZXiicWgggffioWWW_aPPNLLJI;5-2)00332@@AA@AAA@>=>=<<<885533/00-//--//386;;<>A>@>>A@AABAA@AABBABA@>><=;;;<=A4<84H–ЫЏfER\a^L6&@@@BBCEFBCCCBB>>@>=>@ACCBBCBAC;4!AЊџЧJ'IUP85HIJIKHHC@>>>K>*-CRJ=@&‚зџŸ!'P_^\WRNJ;8865543)&#%!!%4>_E>5---5AXLNNLKKKXKFIEFIHHACEHFFIJJJKIKHKHIIJJJIKKЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџсCXUTURRQRQRQPQPPPPPPPP^QRQNPQPPPPPPNLHC>=P243666џџџјњћќќќќќќ§ќџњјњџќќћћќќњљљјјњњњњњћћњјјјњќћњћњћќћњћќћћћќњљ№ћњњјљњљјјјјјјјјјјјјјїїјїѕі§ѓјџџТ@%Qdfefedqedccaaaacanaa_ccac```c_^^^`_^^_`^gZTNHA/’@@>==>=>>>BHPV[_aP<5…џџџ84H^XQNIA%42235C6Tпџџy6*2/8JJJKKLKJJIUFEEBA><<68466%6>ENV>HJъџњ’N!4BPLKIJIIFHFCCEECBCCBBCCEECECBAAA@@AB@@>=<==><>;;<<<;665<6455444#%!#)&-)ABEHK`Zi^gfjZZmZ\g^\\\fZ^^ZZ^[^^h^j``avŒ^^\y`^\[j`_^^`a_\\\[jdcgWif_^R\QPLKIFF20B32@BA<=><=;<886444A222--**/24488;<>>>=@@@>BCBABCEEECBBAB@A>;;;;;)@XKJKLKKKJHFFFIIXACEFIJJJIJIJKJIJJKIIKLLPЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџйJWWTRRTTQQTRPPPPPNLLPQ^QQLKL`PLPPPPNJC><82!4488;AEHUT'%%%!%#!!!#!!!!!#!##!%#'')'/!!#Bїџўџљљњњћ§ќќќќћњњћњќќќћћќ§ћљљјјњљјњћњћћћљјњџќќћњњќќћћќћќћњћџћќћџљјњњљјјјјјјјјјјјјїјїііѕєћџџЏ=>Zedggeegeeefdcaa_ccaaam__`a````_`^^`_^^__\cTKEA>@C/<>>=>=>@ELQW\ae00fхџџнI6JaZUPUB;63458@FZVJJI65JB88644336<)08C@2BrђџўАP%'6A@KKKKIIIFEFFEECCABCCBBABAABA@A@=<<<;=<@<<<;;;88<;;;;;65565668%')-3FINPQ^_`ahXg[^__^`|kpox{xv^xfewjrnnrnnkvyyqrq^nk}woet‰rwwz|’zjonh^o^^\^^[^\\ZcXf_dca\PLJ;4*)B2>>=<;86544532/--'*)-0235;6;;=<=AA@AABBCEECFECCBBBAAA@><;;;8;<>C;8@;•ЂЦœ[LJ\VQ;*/2BCEeEFFEEEP@@@@>>@@ABECBA>@4=3yџмU2@VQ2)HHKKIJFFB0>A>8>PHINF0TпџЯ8>L\jXTPK;KLPRTQQRRTTRQPQQRPPPURVWWXWXZZXW[Z[Z[[^Z[\[^Z\f[XZ[ZZZ\[#6ЄгЭКДГЗОПУЧЪижУмЯХабдджезотоожеЩсйзззпипжзлйзззщлЬлижЩжййилумлЬизйилмлиЯълмлллмлммййймйлцѕјО@6/<;88553/'#&!!#%*6AXIE@=4-*-!@RJKLKKIHHHIJHEE2BHTFIJJJJJIHIJIJJIJILLLЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџкIXV`RTQPPQPQQPPPPPLPKPaPPILNXI0PPPZKH@<633345<=AFHIUX!*'#!#!#!-&##!!%!&%%%&'')*02Fєџџјћћќќ§§ў§ќћќћњњњћќќ§§§ќ§ќ§ћљњћћќћњњљњљјјљћћћћњњњћќќќћќњјљљњљљњњљљјљљјјјјјјјјјјјїјџјўџџџџz=gfddfdddfgceddcacdcaaa`a_`caa^___`_`^^_^^[VPIB@=>=>>>===>>BJPV\^dPULVQ^B;%32!5<@EeJKJHJ5FE=Vиџџ*!6KJKNLLPLKLLLIIFFC@=;543454&*&5CB8=pЯџџТ^!*-;@LLIKKIIFFFCBBAAA@A<>>AA>@><><<=;<<<;888<;==<;<;;=<>;8;;8)<)-CHJNP^hgW[^^_cmajpyz|zzrzh^fZWXWVTRRRPPQPNPLPPPPPPPPNPPPQPPPQRRUVW[N^[ZXisonxyyqzq^g\^ZZXWZZZdc`epQNJ8E42)*'8556420-))))*/024556;;;===>@@ACCBFFEBBCBCACCBB>>@@><8;*-@4/33I‰ЦЩŽkHH[UP;*0BCECBFEHFFEC@>>>>>AABUAA>>*0-aџџm-N[TK-HIJVJKgFB>>J;6%AQII30Q§џЄ6EZ\ZWQK;;LPRRPPQPQPQQQPRPKPPQTVWWXX[[ZXXZ\\\[ZX[Z[\\X\\XZXXXW\\Z6ЮЭЧРЙЛСЦеЬеРипЯвагддхзоЬжддеузжхлижЭзйзззсззйЧйзллжзжззлллльзсзиллмлмлллуйллллммлзммлиллтјЮV@);865630&#!#_%!!!#&&5A[JI@AI30*-4>RKLKKVIJJIJJHHBEFHHIHJKLKJJJIIHKIIIILLЯџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџз6VUTRRTQQRTRQPLNPPPNNLJXWJJII8!K\6LIC>8322368=AEHJJIU-'%%#####&!!!##X##!!#&&&''&)0P‹јџџјњњћў§ќќ§§ўќ§ќќћњњћћќќќќќќќќћќ§ќќћћћќћћќќћћћћћћњљњћќќћќќќќќћќњљљљљљљљљјјјјјјљјїієіјіњ§џъZ;edececcdddeddoccadd``_a`^_a_^a_^^_^`_^^nfcRNHA@==<>>>@><>AHLTXiaZ42^щџџ“<C6Wаџџ„-38;KNNPPNNLNJKJIEC@@<8432235;*5LW>=>@<==<==<<8;;8888;<;;;<<<<>>=>@>;>==/0346KPQRZ\\\\^cwe€œ‡Žxp\g^^\XTTQBRAfNJLJIIHFECECCB0@@E@>>A>===/>@@@AA@3F2/3BV8>JNPPPPQTUWXZckinswnnoh_kk^PzZca`m^[PKFB-)<8%//**)*-//2233566;<<<==BBAACCCBBACCACBCBBCAC>A@><==<-A4<6;K}яУ€U=IZUP;)3ABCEEIIFFCCCA@@AAAAAAA@A>>25!Zѕџ{3;XQ<-HHJJKKIRC>=<<)833326;=ACFJJLIU/*%!#!#!!!!!#!!!!!#&&'%))*-Aўџџјњћћќ§§§ќ§§ўў§§§ќћњћќ§ќќќ§§ў§ћќў§§§ў§§ќќ§§ќ§ќќ§ќјдџ§ќќќќќџћљњћћќњњћћљјјјјјјјјјјјјјіѕђџџЫ8;w[fgedddeecfdddca`aca``a_``_``^^`^`_^__[\[UNHCA>=@=>>@>>=@ELRX^cfL-XяџџЪE;Q^WPLC*63234'AQTVVIFI5FJ*XЯџџ)%33NLNNPPPPLLKLIHEB@<88532245&0KCF2IˆџџџЄ0>P=KLKIJJJHHEAB@@>@><=<<<=<<<<88;888;<=;<<=<>=>>@A>@>@@2/C3JLPTWX^PTf…”gš‹•zto[WWTQPPLNNKJ;IFHE5F5CCA@0>>=>>=;886666566%4444445%55%'0N›”x|Q5AAABCCFHJILKKLNPRTTRacnywyg^g\Z[[dghfa_KJE0&#*&/*--020034466;<=>@ABCAACCCCEECCAEECCAACBA@>>=>-AF8-0Lет‹CK^WQ<30BBFFFFFFEFFBBB@A>AAAAB>==>A52Qэџz->ZQ6/HHJWJNIC@==Q<zBQIN>4AиџдX&XJKLLJUHHIHFCCFIHJHJJKJIJKJJJKIJJKJKЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџеAWVQQRQQQNPQRPPNLPPNNKC@@@@B2Q˜ѕBK8!0465<@ABEFHKJI`#-*&%%T!!!!!!#%!%%&&&))--@–џџџџћћ§ў§ўќќќў§§§ў§ќќќќ§ќћћў§ў§§§§§§§ў§ќќќ§§§ўћљќ§§§џњћњћ§ќћњћћњћ§ќћњћњљљћњњњњјјјјјјјјіџџџЂA‚œzheeedaddededcc`_a`a_````___^^___``_^h[cQKEA>>>=>>==>>@CIPV[`eZ25œџџё['Fa[RJE<5!4!5;AWJKJJH5/C@;XЮџџŽ'*6>KLLPPPPPLNKKHCB@;8520244)EAKI=fЮџџУC-5NLLJKLIIFFCCABA==<<<;;88;888;8;<;<;>==<>=@>ABB@BABB2346INRVXZ^_cdf‰™“ЏЂ’a_LIVTQLJIFFCEBCCCCCFCE3CBBABCBA@@B@@>==;<;565;5864544443454535@Ait_FJC<;<@=>=AAA@AABCEFHIJPC@QTWXiwnovgZ[X\ZXahfd`IC-%&0/-//0-0034688=<=>@@>ABAAECCBBBCBABBBABBBA@@'=<-/046#!jЧмЈX0`X_Q;E4BCHHHHHHHHFCAA>A@>@@L><=/-3EШџ53ZU4/HKKLƒLIE@>>='RKLLIBBCCEFB@FIIfJJIIJJJIJJHHIJJJKLЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџеAXUTRQRPPPPPPPNNPPNPNKC>=>>4<6œf)8H32!458@CEFHIIKJEU%0)#%&%#!#!!!!!#!!######%&&%'*)%@Žњџџљћћќ§ў§ўўў§§§§ќќ§џќќ§ўќћ§ўўўќћќћќќўџў§§§§ўўџћљћ§§ћќќќќќ§ќћћ§ќќћћћќћћљјљњњњљњљњјјјїііўџ§-;_™vqhccededddcedcaa__a_`c_aa^__^``a_``^heVPJE@@>=>>>=><>BFPTW^aWE-XяџџЄ56VZUNI=63235'@QUWKKL5;AEHXЛџџ”*&48LLNPLPaPNPLKJHEA=;543224%*/=<;86688;;;856;<===<>BBCECEEFEEEB@CC@AAA@>>>>==8;;8<8886665665656536FQg^[UJC;88=<<<<>@>>@@AAABBQCE4FFHHHJLNPQRachhs|^vn\^[[W_ccLF@'%&2//-0003358;;==>>=@@@BCBACAABBBBBABBBEB<>=>=;)-A3*)T„пс<3NWQ=45CERFEEFIHHFEAU@>>@>A>>>>-05&_снd8[^U@QUT3U/@@@BACEHJJIJHKIIKHJKHJIJLKLNЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџеHVUTTRRRQPP\PPPNNPPLLLEB@>>*`џL)5653C6;>@EIFFKJKUE^6/*&%#%#!!!!с!!!#!!!&##%&&'**/C‡џџџћћ§ќ§ќ§§§§§§ўў§§§ќќШџ§§§§ќ§ўўќћ§§§ўўќ§ў§ў§ћќ§ќћќ§ќќќќ§§ќќќўќ§ќњќќћќћћњљљљљјљњљјјјјўѕџџяPNgQhj{geeeddddaadc`__``aa`aa`^__`^^^_^_igdRKFB=>@>>=>>=>@CIQV\_aR%;ЮџџоU&I^cPIA842248@WUVLKJ;3;LBIЉџџЄ2/5NPPNLNPNPNK^KFCA<65320248/2@J6=[лџџГN0>LKLJJHHHEEPA>>;;8'8546546888<8<>>@>ABBCCCCBECCCC4E-6LQUZ^VPgz“ЄнД‰d_JJ>BQALJHFA-'&F334355;>=ACBFCEEEFEFCBBBBAAAA@@>>>>@==><>==;;<;;;<=<;;83;IUf\_dPE;;688;;=<>@>@>@@>@>BABBBBBBBBCEHHHJLL@QQVinfˆqqi^^gZiodaWE@##///-0456668;==>@ACBBB>AAABBBBCCCEP@@@@>@<<<*/36-NЈџЯt4A\VP<3CEHFHIHJUFEBB@A@@>A>>==@=@5'<фџz;F\T;5HJJJzJHB>>>;)BFJ<;!=РџЭE6KZk[WRN5LЮџy;65648<=BBCIIHIJKI5P&2W)%%%!%!!!!H!&!!#!!!!!%#%#%%&&&'-%5њџџљќ§§ќќќќќўўџўўў§§ў§џџ§§§ќћ§ўўџўўўџўўўў§§§§§ќќћќќќўќќќќќќњќќќќћќћќџ§ќќќњљљњњљјјјјјјјџџџщH/s}ifeegfdefeefdd`c`aac`aaaa`aa__``__`_^\[XPICA@=>>>=>=>>AILQZ^aUPoўџџs86QWRWB<4336=EJLLJJH->J8H’џџЖ&0APNPRPLNLPPNWIEEN;843233;%%;F=)BЂџџј{-/AcLKNKJIFEEB@@=;6565…%44488;;<<>>>>@ACCBEFEFEEFEC58JNQVNPNWo™КЏБ”€fXHIFP@PJIJIECA>;653220248<<>@@CECCECFCCBBBBBABBAAAAABAA@AB>@BA@@>>>@@>@=>;<#)JV[`sgQF<;68888<<;;;>q<>@@ABB>A@@AA@AAACACFFEFF8IKLPUFZvˆˆz^\[X[ioodWH@&#222334556;88<>>==>>@>@@ABBCBCCEA@@A@>@>><;)&>C3*/pРџЅZ4PZR=45EFFFIIIIIFECBB>><=>@>><=>C'XУџzAPZP85IKzLKJFC->=6<>=A@CIIIIJIJIIKJLJJFIJKJILЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџйIVTRTQRQPQQPRPNLNPPLNNLiIA=3'ЋЋ;8448;>CFHIKKHIIKLJd)3/)&%%!!#!!!!>!!!!#%%%%&!&&)''/2Єџџџњћќ§ў§ќќќќ§§ў§ўўўўўўў§§ўўўќ§ўўўўўў§ўўўўўўўўў§§§ћёћўќњћќ§ўўў§ќќ§ў§ўў§§ќќћћњњњљљљјјјјџџџА%-`€ngdeeegeeeddecaca`a`_`a`_a`^``_`c``_i^jVNHB@>>>>===e=ACIQT[jcR0FЮџџРN0NXULE*5!2!8LKIJJJIHCCA><8;844345&868==>@@BBCCBEERHFHIIEEF/<>PVNLR\rМЄЙМˆhdPC;;QNKIHIIFFFEAA=86422304488@>@A@BBBVAEBCABABAAA@A@ABA@@I%*L`\^anTF<;;86668888;8<<<>K>>>A@>@A@A@AAAACABBCCEBC4IFJL=RVVcmvg‰^^[[[ke`NH2'#!33444668<=;;>=>>>>@BCBCCCCEAA@@@@=>=<<<;%'28)!UЌўЯ_CLL`L53EHEIIIKIJIFCBA@===><;=<<@F-cьнa4PeP20NJJVJHE@><6!@QUKC2Eџš<'A[\ZURL<>N===<>BEHHJJIIJIIJIWIJJIKLILKЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџкAVRRPQQRPNPQQPNNNNPNNLKWI@>34%V6<666;=CFHJJKKKKJLLKc'50&%%&##!!!!!%#!##!!#&#&&''')*/HЄџџџћћќўўў§ќ§§§ўўў§ўўўўџў§ўў§ќ§ўў§ўџўў§ќўџўўўўўўўўўў§§§џ§ќќќ§ўў§ћњћ§§§§ў§ќћћќ§ћћњљљјјјўџџџ‹Ui[jhddddcdecda`dd`cc`_a`^k_^```ca``a__^fWTJEBA><>==>=>>AHNTZnadC3mџџђI%>LVPI>&335;BTVNNLJI'C@NqѕџЮ><=PPQRPPRPPPLJHFC<5532334''2NE;>|§џџ‘-2@CACEFFHFHFIHFIHFF40LQU[AFWoАлЙϘ[BC><>>JHHIFFHCEEFECA>=8642A32236<<>@ACABBCABA@AABA@BABBBBBBBEBECBECCEEBBCBBCBBCBBB@J5=>>>@>>A>AABAAABCCCA@0BBCEHJJLPRqevnja_^^khdNFA=)%#5445;<888;8;<<<<@@@@BCPA>>>>A@@>>=><<<;8<)C2!oхџŠA2PXQJ3EEEIJJfKIFFEA@>@<<==<<<<03*nтУf=^WN04IJIIJFE><<5'LEI>;)tЛнŽCEўN#0;65=>BCFJJIJKKKKJNKe@83&'&###!#!#!!%!%&&%'#&%'))#<Єџџўќ§ў§ќ§ќ§ўў§ўџўўўўўўўџўўўўўўў§ўўўўўўўўўўўўўўўџў§ўў§ќ§ўў§ўўўџў§§ў§ў§ќќќќќћћћќњјјљљјјўўџџnLvjefd`adddcecdaaas`aa````a^_^```_c_a__\ZVPIE@@>@>@@>>@@BHQWZ^aJ'8ЛџџЏ0@`ZRLB842348AHVLNNK<0FI4Pзџџh);VPQPPTPPPPZJJQA=;542546&F->I;-™џџ§„!4ENLNKIIcEBA@><865534446465<>@CiCRHHHIIJJJHIHF80/PTJ8@FsЃзъЖŠmB<6ANKIHEFHFEEFEECBCCBCB=85422032248;<>@AA>>@AA@A>@AAAA@ACABAEBEEECFEFCCCECCCBABAACBB@A=!'XWZ^`hUF>@>>=>>@A>@AAA@>>@AABCAA@BCHJ=PUVm‘Ђˆn`N^^h_`JC0)6686868866<8888<<@@EP<<<=@A>>@=>>>=>=<&8)-B8#TЏџЭL3KXR35FIHJKJHJIIHEBA><<;;;<<<`==@C*џš3=;65>AEFFHIJJKLLLKKQ^>4)/'#%####!!!#!!!#!!###%#&#&'&')0JЈџџџћ§ўў§ќќ§ўџўўўџўўўўўўўўўўўўўўўўўўўўўўўўўўўўўўўўўќ§ўќ§ўўўўў§§ўўў§§§§ќћ§ўќћћќ§џћљљјјјїџџыJ)Pdgffdda`ccocdad`a`accnccda``_`c`adca``^iT>A>@@>>>AELTX^ceH-ˆџџфe-F\WNH<%3346>FVLNLK;8@KAPАџџv<<;8858445568;<=>@CCFHIIJIIJIKJHH/8@RWPLB`Ѓыњб’`R455@JIFCECQCBCCECCBABBBAA>L<543/03034F<=<>>====>>@@>>>BB@PCABBBBEBEFECCBFBABCCBCCEEBABBBBN=&A^X\^`i`F><<=;;8;;8W66686556686;8;;;I=>>=>>=>=Nf>A@@=>@A@A@>>=>>=>AFJNFJ^zˆ•”pcP^[icZJC%=<868866;58;68;;>PB<8<==@=K@>@>@=K>><;;;<&/52“пџf;N^VP<4HHKIIHIJIFEA@>>;;<<=;==25-нЙKK^V;/HIKKJIE@PHJA0^Ры‡*5X[eXTPK<=AFIIFIJKJKIIJJIKHKKNKKKЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџОCUTRPQPPPPNQPQNN\NNPNLLJFAA)/^r=-868ACHHHIIJJKKKKJK3pЧ03)%#&#%%-#!!!!#!&##2%%&&&')*0=Јџџџџќ§ўџўўўўџџџўўўџџўўўўўўўўўўўџџўўўўџў§ўўўџџўўўўўўў§§§ў§ўў§ўўўўўўўўўў§ќ§ў§§ћњћћњњљјјџџџЮ;)eadeedcceacacccacsc`a`caaaac_```a`aaac^\XTJEA@>@>ABBAA@CKQU[adR!NЦџџЃ2>`XQVA833&>FULP_KJJ2FCJŽџџ6#6CPRQQTRTRQPKJF@=;43333;&/=FH)WЯџџЛCCQLLKHHFECT>=665554466888>>>BCCCHHIILLJJJKI;<3AUNN5IzЉщњШ™X=0<4;EEECCCBBBCAABAAAA@A@@>@><=84/02002448;;<;<;<<;=<>>>@ABAACBCEBCCCCCECCCCFBABPPBPCCABPB@BBB>')ZV\_aiVI>>>===<;8;85645554444644586686;8<<;<==@=>>>=>=@@>A@=>=;;;;->BCHJPFW^|™ŸdaJ\[fRPF//);;8;6;;888<*A>;8888=<<<>@>@>><==8;*>38'#sЯў‰2>PUN68IJIIKLLIIFFAA><<;<8;===B0&5ОнtF`eP8/JKJKJFA><;!6LQH@=6‹УВU#KW[ZVRLIKNPQPPQPQQQQQPPPQQPQVXUW[Z[f[ZXXXZ\[ZZ[[XXZ\[[cWWayrUBЯђщгфежсйзжХжйистйййлтйлйзяЩллтиймлйллЬлйззлйммйллмлуулмнтХтймщллмфмцзЬзсиммуйймймймфтзїсZK&&&##!#!!!&*4<`HKLLLLKPKNLNKJIHC@=34;K>>>=>AIJJKVHJIJIKKIJLJJKLLKJЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџОFTTRQR^PNQPPPPNLPPNPNNLKKIK6<'4K*=<@CIIJJIJJJIIJILINU&-3*&%%##!%#!!!!!!#!%#!%%&#&&'%&))//@Љџџџќўўџџџџўўўўџџџўўўўўџџџўўўўўџџџџўўўўўўўўўўџўўўўўўўџўўўўўўўўўў§ћўџўўўў§§§§ћћћ§ќћњјјјџџџЌ/0T`_aamadfddccdada`c`_````acc_a_``a```k^fVPIECA>A@@ABABBFNTX_sfC@=<;866556688;<@@BCCFHHHIJJJKJKII-<@EN=6FЋнјыˆc6))5=IEB@>@>>AAAA@@>@=@>>@>>=<<;8654320/003445668888;<8;<@=@>@>@@AAAABBCAABECCACBCABBBBBABBAAACBAA@'/ZW[_a^VH@>=>==;;<868665552432333453446658888;8;;6;<=;<==@>>=><;;;^;;;)=>-FHK>=Zz‹ЌЇ€dNT^XTPF//<;;;8;<8<>=>>A@>@@>>><;8C0-BЯв^CadP08FIIJIF@>;5=PFJ45PЙтnI@nXZWTPJ;KP\PPQQPQPPQPPPPPQRTVcWZ[Z\WWXWWZXZW[[ZkXXcV^[LL&E-FA=@EHIHFJIJIIHIKKKJJJLNKLLЯџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџОHUTPRPNNLPQPNLPPPNLLLNLNLN{xdff\EAAEFJIJKKKJJKKIKKL>wJN5*&&'#!#!!!#%##%%#%'*')')/JКџџџ§ўўџџџџўўўўўўџџџџџџџџџџўўўўўџўџўўџџџџџџџџџџџџџџўџџџџџўўўўўўўўў§ўўў§ўўў§ќњћћќќќћњљјџџџŠ;^ZZ[X\^^aeec`ccca``c`_`_a`_dac__ma`m``^\VKFBBA>@AAAAABCIPU\`fZ2@Жџџ’<;_ZQIA&!236@R^PPPLI2@KCPОџлT'0=PPPPQPQPPPPLIB=;64E456-4KJ@=<;888;;<;<<<=>=ABCCFFHHIJJJIIH;2@CJPF6fЌхця•>2*;>>>==<>=@@=>===<=K<=<<=8<8653220/-/00043435665688;<<<=>>@>>>>@B>BBAAABCBCCBAABBCABBAi[BCCBBAAP#>Pc[^_haI/>===<<<<688885545332232002232355455466888;688<<>><=<;;58>88888;<=@A3E;@>CC=<<<<8;;<<<<;<<>=>A><=@<;;;6;*2H<@АџпZ0JXP04JIVJJHHIJFEB@<=*;6;;=<>C2'NВеpF^aL4FHKJJHV><;!%@PIK2'‹Л@/A[ecUPJH;NPPQPPQQQQPLQPRPQRRaWWWZZXZXWWX[X\[[ZecV\KEBAAA0@A4БѓфесздийслЮзцлллйизилмимфлмиуфйййзЮйзжЮлимучзЮлЯлммммычллййЭимлмлэЯйтЯумлййщйлийЮлйиизџњf@!&%#!%!!!&#'0<0f4WLKLKNLNNNLKKKKJIFPA}j_ECEFHJJKJJJIJJJJWJIIJJNLLKЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџРNWRQPPPPNPPPNLNNNNLKLNNZLL>PPfŠtIIIJKKKIKLJKIKKJKKK>s=V5-''#%#%!!!!!%!#!#%&%&&&''))*0CЌџџџ§ў§§ўџџџџџџџџџџџџџџџџўџџџџўўўўўџџџџџџўџџџўўџўўџџўџџџџџўќ§ўўўўџў§ўў§ќўџўў§ќќќћћќќњљџџџq6Z[WWWWWZ\\aa`a`aac`ac`_aa```cacaaadaa`hdRLFAAA@>>BA@@BFKTX^dgT6mјџјh'LZUNC)4!!5=65446;=4;H=/jџџџ{4QNJJIFAC@><88;;<<;<<=>>@@@AAPFEHIHIVJIJII0;8KP3J^УцџџŒE#&-JEB@>=<<==;<<<<<<=<;<<=<>>;;<;<;6643220/0-0000/02B34556888;8;;<<<<><==AA@@@@AA@C@AA@@@BABA@B@CBAB@>>@=%=^am^_hfH/>>=<=<<=;;8865885444233202322323455568568666688;;<;<;;;;8<;8;;8;<>>@<>@B686@N‡ЂЏАmLH^hTN540=>>BWV@>@><<<<<;;;8;<;<>@@>@>><<=<888@05)!Аџс^4PVPK/6IJKKKWJIHEBA<6686<<85;BFK>CPЗн`6BVddWRKIJPPQNPPQPPPQPPRPPPQ`TWWW[WZXVXWWX[ZZdV^KE@===>>=A&„лЩеШШьЪхпъйииллилийфмфйлллййълллицтиииттЮщллйллфмфмллмлмфчллйиллулмйлнщймлЯмлтЬлллийлзљс^6&%%!##!!'=EeIKLNKLNJKLKKKLXKIJJFA3ƒнaKEIJJJHJKLJIKIHJLJJIJKLKLJЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџРCUTQQQPLNLPPKNPNLNNLJLLLNKKLN4@KJKKKKJKJJKJKJKLKLKK>kPF5*)'&#!#&!#!!!#%!%%%#&#&''))-0NЋџџџџўўўўўџџџџџџџџџџџџџџџџџџџџџџўўџџўџџџџџџџџџџџџџўџџўўџџџўўўўўўўўўўўўў§ўўўў§ўў§§§§ћћљџџўZ@XWXWVXWUVXXNx^^`c_^aaa`aadaacacaacac`^kWPIECA>@@>AA@/CFNU[`fh@<џџЄ;;PWQJ=%344ATQRQQRQPLLFB><&5;568>C>Z=B{џџџmBCPLJFEBB>>;8<<;>=>>=>@@@BBCBECEFIUIVJIIF/>PIE8/22222334553668<8;<<<;;<;;=<=<<==>>@@A@>>@>>>AAAA@A@@@=@=>=<)[TX\^\_H>=>====<=<>>=;<88;;68665544223344465568566886868;;<88;<;;88;<888;<;;<;;;<<<0E5=;By ЙЙkPI^xVN;2/CEAAL==>K@@=>=<<;;8<=;=<>=>>><<;888;<>E0…эђg2PZT=4FIIJJKHIIIF30<;68;8;<<@5U'‡о„KXUN56KKKJHQB>8!3JEF=23ŒЮ…F0JZ[XUPJJLNPPNPPPQRPPPPN\QQRTVcWVeXXZ[WXXZheNF2==<@=@@ˆЙЫчзЯРЦБЗАУРжзсллчлйлйуфйлзйлзййисзмлЭцйлиййчачмилщйШллммйфллйлуилйлллумммЯмъзлйллтЯйлчллоўѕwL!&'&!##!A#!&&)3K5o6KKZLNZNNLLIJJNKLLJF3H)42IEFIIJIVKKHIIIEIKIJJKLKNKLЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџСLVRQQPPPPPPPPPPNKLNNLKLJNLNKNKJIJKKJKILKKJNJIJKLLLL5qPU8-*'&&&##!!#!%##&#&&''))'*-AЖџџџўџў§§ўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџўўўўўўџџџџўўџўўџџў§§ўў§ўўќћќџџњџџс4JXZXUVWVWWUVŽJX[^```_ac__aaa`a``ca`^_`^ZTLFBA@@@A@A>AACIPV[chQ2Uсџѕt*P[UPx&2#8@HLNNPLJ8>IJUЗџЧJ4@PNRQRQQPPXJFC>;8666<<@4;J@3qџџя_5PNKIFCCC@=<;;<>><@>BABBBBCBEEEEHUIJIIH;*2==E6*XЙџџВz'#-A;CA*#q@)8668;<<<;<<<<=<;8><=<;;<<;<8653222/--//0023444456;6;8;;<<><888;;=<8;<;<<==>>>>===>=>@AA=@=<===<==;;%P[LRkiaF=@@>@=>>>>@>>>>>===<;;;886555246556646668;;868;<;8;<<<<;<;;8;6888;8;;;688888<*>A6<=AnŠд I<^\eP;3&0A>=>>>=AL>>>>;;;<;<<<>=====<;;88;8;@38хмv6FZR84FHKKJJIKIFEB><<5668<<@36-I АJ[X^=4FIIIIICA<4!8VHJ>6{ЌЦ[@KZdXUPKJJNPNPRPPPNPPPPQNPPRTWUdXXWZZ\[XaRJB>@<=>>A{џџџџџџџџєѓјъ№иТДгислйилзйЮлллзсилллзлзлуиимлуцШфммЯЯлилзлйлймиэлцлмуумЬиллилмфмйЮллЫсллллЭлмуъьщ0&####!!%##%'-4WHg0WKKPLLKKNKLJNNLKJKIFIIJIIFCIHKIIJJJKJUFIJJHJILJKKLЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџРBTRQRQPPPPNPPPPPKLLPNLLNLLLLKKLKKLJKJJJKLLKKKJILKLKCzV_=/*))'%%%##!!##!##%&&&&%&''-)/CBЂџџџўўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџўўџџџўўўўўўўўў§§ўўўџ§џњџџјјіџј/;[XWTWUVWVUHUWVX\^_a````dnc`c`cacc`_^dTKEBAA@>>AA@AAFLTW^dsF3wџџИ;=RXRH/##&3xјџјq!@PLJHHB@@@===<><>BBECBBCBBFFCCCHHIIIIIHH-p=JC8[Мџџџ…<36J4@=<;<;8Ѕ68<<<<=<>>>><>>><=====><<<<843420//-///04556;888<<8<;<;===;<;;888;;;;;<;;=<*->=-)>/0@-*#@*0##@*/)=;-Qg6)&>@>AA>>>AA@>@A@@@>>><;<<8;;634555444565666668<;<=;>><><===<;;8;8;8;8;88;8655865'*0586@dРоЉˆ@JLZUN4'@>@>@>A>@A@@==<<88;=<<====>>;;;;<8;;=B6!oяу_)>ZR=/HIKKJIJIIHC@><;658;8<>B83`ŸŒHZVQ0FHIJUHHC>5!!PEJ<0;ЇЭo8;VZca^N=>=<>%”џџџџыџѕћј§џџџџџќѓЮиИЧзиллййиилизийлисзййлмлллймЬймхмчтллтймъйлййЬзЮииилмйийззтмЯциййзЮзЮтллилмлзфёяn!&&#!!!!!##%')*8V*z8KNNXKNLJLLINLNLKJJHIHIII4FFHJHJKIJIKHIFJJJIJ8LKJLKЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџРEVUTQPQ\NNPPPPNNNLNLKJJLLPLKKKJKKLLKKJKIKJJJKKJKJLLE€^k@-)*'%!#!!!!%'&%&#&%&&&*')-*NПџџљ§џўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџўў§§§ўџў§ўџ§њљџєђяјјѓяўфПšT*\WUUVUUVVTUUWV\_a`cadacacdcd``a^\XQJCB@AAA@>@@AEJQW\aeX@8Аџџ‹-<^WNF)#4>FVZ[[NNJ2@FKgвџЌ5'>PPPPQPPPPXHCB>=;;8=;AB5;ZI2iљџьX;NKKFEAA>=;<<=>@A@BCCFFFEFEEEEFFEIIHHI85>@L;>@<@B@AAAAAUBA@@@A@@>;8553Q0/---/32556;;;<=><>>>A@>>@>;<;;><&<-#B-2/CCC5EFHHJIJKKLKLLNNNLNNNJKIHFHH82'''!%33&A2@@@B@>@BCN>A@@>=<=>;<68685565455566656;88;;>=>=>=@>>>>;;8688;;<;8;;8866544556&)=C&'>@<=;=<<<=<><;;;88;;;;<>AI^ђџz@E@I|ЄeC[VN4FFJIUIEA80&;WH===>@8џџџџѓщыяЯРОЙЛОЯфцѓјџџѕнЧЩжсйллмлзззллиЮззллйммйллллмнмуЮийллллилмулиисзйлулийлййлзйлйийзчзимлэШийзсн№ї};&###!##!%')/A>A@AA@4JQW^cqR6kъџеW5BXRJ@!335;6;<;>>@I;I<@=<=<<@ABCFHFFFEEFEEEFEIIJIHII8K>I@68tлџџЛL!0=F3@>>><;;;;8<=|rA>@ABABBABBBCECBCECCCPAAA<;;6302*0--03458;;=>@@@A>A@CBR/A/3//44EHFKKN[Q^R^^^e_Uf`agXcXXXXcZXdZ[XWWWg`VakiikVd^QaPPNKI;883)C'/3AA>@A>=L@<<;;;;86655655456556568<>A@A>>=;;66888;<;<<<;;;;886664434%#>52)=}ен—VPQ[`P8C2@=>@A@AUAA@@>=>><=<<<;<@86[Р’RFZQ03IJJJJRA<5###[QJ@<>Aџџџ№яУБЋœ”xT`eK=”ЮлХмьы№ьХУзпййлмйййлллсийлтллЯлллЯмхлЮмЬийлллллйхмлйлиилмлззлллйсзжзилхЧииймммлйиЮсйсђщr3!&2%!#!!!%&'-/2>E^xJJKLLJKLLLKKKPPLKLJKJKIHIHIJHJKKHHJJKIJIJIIJIJKKJKЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџУAUQRQQPPPPPPPNPNPPNNLLKIJJNNLNLKKKJLKLKKKKKKKKJLLLKC„ciH&2/))J'%!!#!&#!!#&!%'&'')'--0VИџџџќ§ўўўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџўџџџџџџџџџџџџџўџџўўўў§џјєёї№ндЙЉ…{ ЖГЪКХощџџмE6VVWVUTRRQTV\jmac``accccaa_\UKH3C@A=@@A>AACNUX`pgF-Šџџ™3@^UZB)#2#;BINPQPPJ;;IPrЩџ”22>PPPQPPPNXLHCA=;88;A@AC8BKC[йџџ>NJHHC@>>>>>>=@ACBEHHHHHFEEEEFCCCIFHIF;3AC>/ZЖмџс€'20FB2@>>>@>=><>>>@@//AECEECFFECEEECFBCFHFCCBA\<85420*-*02356;<[@@@@@@A30566NNNQRfTd_VfahZX[^^^\[^h\\\g^^^wo^g^h^nh^ƒp\g^h^^^anaa^^^\[ZdXjjiihe^\PPKJHF243-0>>><;;;;;;88566653555666<;88>=>>@>@=<;8;688;;;<;;;<><<;;;85543323#8/53->’УЧ’U=^XRLE2>>>A@B@@>BAAA@>=<<=;;<<<;;8;;8;<=>>B5!PщсaBNXP08IJLKKJIVFFB>;5455688KWXiVQP=<>>>ЈџџјжЅ˜Š‹xPxo8zˆЇЅИЂвйояєчзГззййълииллйилмлХллйуйлфммйчулиищнмлфлмлйзллммфлилймллйззййлйзхтлмнлйлйлзйзуъў„4&&####!#!!%%*-35AKUwIKLJJNKLNJKJKLLJKKLJHIKHFIJKIHIC/HJHJIILKIHILLJJKLЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџИKRQPPPPPNNPPKPLKLKJLKKHKJKLKKNJJJIWJJKJJLNLKJKLKNJL8ƒhyL3//*'%%##&!##%&!'&&&''))--#CЋџџџўўўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўў§§ћјѕ№ыхоеОЉ‰qƒ–ЂмЯМЁЅКОУоџџ‰-WWVRUURQQUX^``c`a`adca`^Z^KCBP@@>>@@@BBH>H\dghI6Јџџz4P\TK@!!!%>XWPPPPN8=JHQЙџУE'6RRPPPQNNLHFC@=;;8;>BBC6@NFJЁџџ!@ABABBFHIHHIIHEFFFFCCEEEHFF05EH20Šъџџ—<%46FB@@@AA@>@>>A>@AAACECEEFHHHFFHEFIFEFFCEHEEBC>>85420-/-/0456;=>@/'238ILPRTUX[^^`Q^^_jih^mqzr‹ƒpo}xfnnnjresfjmnjsjjfgxnvnnswp€|€sr‚rxrh[^^^[\^^XZfZaed^QPNKH2/2*/-=<;;;666556665554;86<=<>==@>=<;;8688888<;<==>>==;<<;884332/04'/456fУоЙr>C[UNHEEA@>BNAACACAA@=<==<<86888686888<<>@B;%jЙзP;^WP25JJIKWKJIHEA<8444568)>*=J™СfNZR06IJKKIFB=2##6RFI<AA>@>ACJQWc|T'^ьџгR5TXRI*#!4ACF;PKC2•џџ 44@KFBA>>===>@BCEFHTI\IHHHIIHEE\ECEFCF62BI>0RПџџлc-36EBBAABBBAAABBCBCBEFEFFFEHIHHEEFIHFTIFCEEEECCAA<6630//-023%8=*/25KPRVWXX^\^^ad™‚‘Є’{rwoddXXZWUVQRQQQPRPPPLNNPLNNPPNPPNLLNPLNPAUJFWZXWdjmhmtyzwˆz^p„_\[[ZXeZgfd\PZJIE3->-);88655434344656;;<<<====<;666568;;8;<<<=>@<==<=<88543000!6BBCCAACBBN@>>-=*;;68865668;8<;>BE;/'zџС>0^XP-HJJKKJIIZFC>8443566R=@0/fйqF\`N-5IJJKIQA6'JEH=<^—ЁcBFXeiURK<;<<<3zџ§яхШ‡ЁЉ–z’cгѕџћјўўџќцЊЇШймьъєЭХзйзллмллфлйлйлмлмлммлтйтитЭйлщммлфлмЭълмлмлймллйммултзщйлйззлзйиЯлуллллййхжјя{A&%#!!!!!##'/35@>@>@ACLRX`‚Ÿ[*”џџ–-=PUPF'!6AHL_PPNL8=JPW­џаF5@PPPPPQPKHCA<;;<<@CCF84FC6џџС;3>>@>>ABCFFHHHKJKKHIFIHFECCCBBC48AF/5ѓџџ—-/50F3CBBCCECEFCECECCCEFFIHUHFFHIHFCHHHEEFFECCCBBB>@K;432!4''@EILP^XPcUTegrˆ™‘‹‡‹xnd_\XUFRCPLLNNJJIIFFECE4BCB2ABCB2AAA@0AA0AAAB!/BIPQRPNJJPTRWWWX\ntox€qy\^\gZXXghda`NJF0-/<855544466566;;;8<====<866566;;;;<<<>>=>>@A@><;;86533203'>F-#=ЉяЯwAC[UNI22BACCABCABBBB0˜>;<;865556;568;=@ABE8;}јЧBfЏxFJV[daTPKJN\QQPQQPNPPPPLPPNU><;=;;>џџмсп›‹™ЉnyЉиињэяяјјўњќџй дймпєѓРЦчиммлмммлйумлмлймйилЮУлиллилммллмйллййЯфщЭллуЯйлфЯлизиизлиизззллйзлйиЮйихйъїѕ‡F&&!#!!!!#%'06;0ZW-ŽJLLIKPNKIKKKKNLLKLKLJFJIHIJ\HFJ==KJVJIJJIIKJIKKJJJеџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЊJVTPPRPPPLPNPNLLNLPPNLLJKKKKJNKJKLKJKKKKJJKJKKNJKLN*ˆˆ„d0@;5/*)&##&#%#%&&#&))))-LЛџџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўџћўячплзгбвиьђџўџћћњџђхїяДЄ ЗВЙвџџ!TUTRQRTQTW_cca``i\VPIEBAA@@>>@>AENTZ`g_A#ЄџџfANZRJ>!#%;BUNPPNN<3APK}Яо}03TQRPPQPLNJEA><8;<=AEHH;HL8[пџђV0=JCA@>=>=>>BBFFHIJKJKJIIIFHFCQCCB@B4-&I›џџуw%00;6CBCEEFFEEHFEHEEFRFCHHIJIJHIHIIHHFFFHHFEFEEEBBB@><86&!#>BHNRVW\P^TenвАЋЈŸ‘ys`^IWEBRQPLKKIJFFEEBA0>>@A@@@>>>==<=>@>>><<;;<=<*<865&=FPThPHCA@@@AACCFIJKNNPPQQTUWcdmsxkfo\ZZWZXXid\PLE3/)'55855866;;<<<==;;854558;88;<<=>@>@@N@>=<=;;65332>-/036-C>%/sјт–E=^XRJ*4CEABBBBCBC3B@><>88655565888;;=>@EH/5лџЃBN^R35HHHHHJIFCA=84222466=@IAZЄ˜CZfP-EJKWJJF=4!'5VHI>@sˆˆP4V[WXVPK>>>BIPU[mfZ8VаџЮN%QZPH<4'BTWPPPLJ<5IPXџЙF*@@PP^PPZLKHB>;;8;=@EEF=EI>IШџџd'@JCC@>>@<@@CEFFIJKKKNLLLVIHFCEB@ABA'45I@4IЮџџК>-3HFFFHIHIIIHEFFHHFCEFEFFFHIHIHHFIFHFHFFFFEEEEEBBB@@@-02BFK\`X^QWfh‹ˆЏ™“­pWQC@PL;H6EEEICEBA@>@=>>>==<@>>>A@@>@=@ABA><==<<;@@@ABCBCCEFHKKLPR_Tgkis|}ho`\\ecikcNKFB*#!5446568;;;;832-/345688;<=>>>=>@@>>===<;84//2*'*/446)0;&FЉэЩ[RKŽЛ`KWd[jWQK@>@>A>BJRW\dfV4nџџЃ<@[TXB!;PVPPP\PJ3C\Lnџмz)-QPP^RPPNKFB>=888>==>>ACETJKKJKJKLLNLKIFFCBBA>@'JBA)3џџџ™-6JHHHHHIHIIIIJIFHHFFEFEHEFFIIHHHIHFHFEFFCCEECCCABA0ABC3HLPUW[PPihsЃЉРЄc^\>BHCA=IIHHFECCABBA@A@>AA>>=>>@@>@@>>>A@@AAABBEC@>>=>>>><<;<<;6CNTVjVKC<858<8<;<=<<>=>>>>==>>AABCFHJLPQTWZt‡zn^hIXZdagdNIC#'%&56444432-)''*-03558=<=>@=>@AA>==><<;52/0**')-0446;0F2'<Ьм‡CF^VP-42AAAACCEBCCQC@>=<865344548;=>@ABCJ)EдџxA_ZP6FIIJFIFEBA<842/3558Bt…_BIXf[WRPJJPPRPQPPQQPNXF62236<#џџцллд“•ВЇ)‡ШУєџћіієѓђђёђђ№№єћЉгхъс№ѓЯезйллзилийлЮлмщмзлиллттилзллййлймйЯллжззймЯилиисййЮиЯтЮжихзлзежзЮсйлийилцийзжпё•>&&%%!!!#&'*3=HIBjxX”LKKKJLNNLKLXKNJJJKII^LKJKKJHIKK!џ’@JWKIJIJJJKLP`PPпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЈBQQPQQPPPLNdNLLLNLPPPLKKLKIKKNKKJKLKJJLLKKKIJIKKKLL*ЁЂP[PF;0-'&##'''')))'*-2LЦџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџў§ћјђјолздлпчјђєѕіѕєѓєїјјіѓёёјџєЄЁРУПсџyA@RRRTRRW[pfWPHEAA@>>=>>@BELRZ`fjJ;џџˆ4PZRJ@%>FLP[PPP8=WJPЂьЖA2=PPPQTQNKIEA=<;;=@ERI;A@AEFFIKKIKKKLLaJJJFHCAB@@00;C30@Ёџџџe)@JIHHJIHJIIJhIHIFFEFFEFFEECHIHHFFCF^EEEQCFECACACAA32H<@QX\PJgnŒЃЛПЂpt`C;>CLKIF50BBBBBCBA@@@@>AA><=>>><=@>@>>A@A@AAA@AAAAPBCB@@@@A@><<<=Af!;Hac\^dNC;665656588;;;;<<<;;<;;;8<<*->AAFHJLNBUVcnt}ry^^Z[Z`cZKE%'%%!/**'&&%'&)0/368<;<==@<@@>==><>;8323*-)***0256<;/C83%oщ№ЄL<^UPIEBBCEBBBCBHCBBA>=865443448<8>@AACHI#sяЊPC\_K-HFFIFFEBB@<5322258=>Fe‡kšJNLLPJLNPNKNKKNNNNLIKIKIFJIIJJK0^PJJJJJJKJJLKLKLNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЏLTQPPPNQPNLLPPKLNNKNKLKJKNLJJLKKIIJKJILKKKKKLKJLLKQ#ˆЈЈ‡_i`^03/*&&'&&%''))//!VЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџџџџўўјѓэьлгвЩиуыјђѓіўїїїіјјјџїєѓђёџџЙТХЪХџџ-ALRUTTTTRUTLECA>AB>@>=>A5NUZagmT[Эџб^@HXPF;!6BTXNPPKI8@\\jЯуz04QPPQPQPXJCA=;8;=ACHIH8QLKgУџЮK2;FC@>>=>ABEEIVWLNKLLKJKLIHEEEBA=>@06AF26ВџџсR8<BF==IIEBA@@=>>@>@A@@@@@>>>=>=><<=<==<>=>@BAABABA>@AA>@AAC@@ABAA==@><>=>;*HTZ^_jPE;54445566656666;<;8<88;<;<;8=<<=>@ABCH6INPQT[yˆŠ|vs^\^Zgd[JE>#''#%#%%''-048;<<<<<<>>===;3330-*-)***04688;=A;*@ЏсЈ[-FZR<3BAABCEAHHECCBA>;885332545;<<>@CEI;j№й;NWR06FHHTICCB@<8320346;VZk\cUPJPPPPPQPPP^@42233#Юџялцм™ŒЇДZуумјїєєђёђёяёёѓќѓђё§ћ‘ЭыьххыЬжхйъйумлЮзчуЯуийззззйилтзЮитзймфмйуллуЮйиЬллйщзЮйизлзйизйсхйпЬззйихзсзййзззжзсчј•6'%!!#!!!#')>PX[Ft{r•LLNNPZLNPLLJNKJJLLKJIKIKJIFIJLILŒPKKIIJJKKIILLLJLNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЎIaRPPPNPNZLKNKNKLNNNKJKJKJLJKLJJJJJJJIKLLLKLKJLJLLL‹ИВvzpk*82))&&'')'))*/!RЬџџ§џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџўџјђјоШбТХляяђѓѕѕіѕєѕіїјјјјїѕєђјџЧ™ОдПъџЄCNPTQQTPLIFCCA@>>A>>@>BFNU\cfV=PиџЏTJPVZC#<;8)ABHII;AH>C’џњZ/4>EBA@=@AACFHJKJKNIKLLKIJJ[HEBAB>=/'<=;/AЏџџЦ0%6>KIJJJJLJJIIJIIIIFFEFEBCCBBCCBCCCQEECCCB>AA@AA20*5>QXPLPXŒЂУЩА”gFA>AJKEB@@=-==<>===<>>>><@>>>=<=<<<=;;<<===>>>>>AAAAACAA@@>@@AA>BCAABA>@=<>@<<<<>>==>=>>@>)ACCIKQCVZzƒ™Œ|ra`^\X^ZI0%!&%%%#&'-0258H<;;;<==>>==<;444-0--*'))*/356;;<>AE2A™џсv;IZUK'0CABEEFECCCB@@=<8533434686=>>CFEJK#<ʘ[C\WP/EEFHHFCBA=;633234;=AEJ@}ŽRKXP45IKWJJQ>!>PJILU}ТNXI[m^XR>6KPQPRQPP[=44334џ§мзщО•ЈРЇiџхпчяўєђёфёђђёђєєџёэџœЏх№фјэлЩцЭлмЯззиллЯйъилиллйллузллтззлШмммйлфллзсллмлззййЦсиЪзййлЬйЬзЬзжЭйииилииллхззсзя§—Q'&%%!!!#!%%&0Lw`cF‚ˆsšKNNNLLPLPNKLJKLLLLNJLKWJLJJFKLKKN=NJKKIHKHHJKNJLNNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ­IURQQQPPLKLLLJLLLLPNKKIWIJJJKKJJJJIJJKJ^JLKLJJLLKLL!ŠУИ™y‹‘ˆ3/4-''&&))*-)/3Pжџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџўў§џѕёѓЪУЮЭбміёђєііѕѕєѕіїјјјјјїіѓѓџвˆЂ­жојџ#5RPPQPPKE>)<=@@>A=>@ABIPU^chTL„ъј>H[TK>#6BTXPQPKI/<>;>>AFJKI3BJK„ѕњ•>->>@CCEHKKLKLJKNLJKJHFFFBA>>=006H5/XяџџЋ8ALKKJLJJJJJIKIJIIHFFCCEBB@AABBCBCBBBBBAB@A@@@A2038PV[UPUsЌХРЦ…gH/C@IE2)&));8<;<<;;<=><<;=<=<=<<;8;;8;<8;;;;===>>>>>>@@@AAA@>@A@B@@>@A@@A=@>>>>=I!=KV\^`^TF=643344445566<666;<;;<==><=<>>==>@=@@><<<>==AB4F;;>@E3dтђ{%E_`N84CCCCCCECCBA@>=;843343558<>AACFHI'2FЙзTK\UK*BEFCCEBAK;;53233;;>EH6ZШ\dT<3HJLLWT@68UR8>Ip…^FEX^kWRPKJPQPRQN\;323440џєЬдэЌ ›ВШ^щђхъяёђњђђёђёяяяђѓђљџАЃщтэфмЏплйулзйтиитйллЮиэЯмллйличмззслмлъиййутЮиХмммЮйзсйззфжзийцлысужзжфЪзслиитЮззийлхчћš;&%%!!&!#%!#-5%Wyinnx‰kЊKPZNNNNNNNLKLLNLLKLJIHIJLIJ6JKKHIKJKKJKJKIJKIKKLNPпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЋZVURQPNN_LLLKKKKKPPLKKJKKKLLLJKJJJJJKJKKKKLJJJJLXKL)…ЩЈ˜ š•ЉJ&6/)))))**-/#^ЮџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџћіђјѕКЮЮТШтџѓєіјієєѕіїїјјїјїіїѓђџиДТўіоџ’IUALLKC<6536<@A@A=>EJRX\mg[=”џџx>QXQH*>CKZPQNLH/AN[yЭИf)C@KNNPKKHFB><;R@AEHUJKBLFUСџЪA34F@<;>=@BBFIIKKJLLLLNLKJIHFCB@>L>*2KE<'^фџџ•*@=JJKIJIIJHJJFHHHHFEFBACAAAA@AAB@BAAAAAAA@@A@355NQXBACy‘ЙяСš^J<3@IB)#&68668688;<;;;;8<;<><;;;<8886866886888<<>=<>>>>AABA@AAA@@>>A@@@AAAA>>@===<====>=@>>=>>>=@<><<;<<>A>>ACEJNQXgt”Оgda_e^^IA#!'&&*0445##)<;;;=;;<8400*-*)-'**/04488;>>>AE8&_сџЊ@E[WN-'BCCEEEFAEAA===;65342445;CI3KqrL\VN42IJXLVV;5!THI=BIx_BVWekZTN&’жРЙЌЊВРR/<0**)))--/WЯџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџџџџўўџјц№јќЧРЯазђњѓѕіјїѕіїїѕїџјѕіѕііђђџхЈ№цђђнє№@@AEKRX^aeLRТџЯX=NUNC#!@ZNPQPNJ;8ERZŸф“H6ALLKNNWJFB<;8;=AEFdIJ=IIFƒџьr/42=;;<@ACEHUKKLLLKNLKJIIFEECB><<*0=F;3^ъџџ}->LKIJHJJJJIHHFHFFFFBCCAA@A@@A@@@B@A@B@BA>A@@36I4>;6%43555686;<;;;<;;;<;<<;=<<;;88;556;8888888<><;<==>@A>>>@@@A@>>>>AAB>>AB@>=<<==<;%-LV\^`gTH=886666FF655;6;65868;<<<<;=<<==>@=>>=>><<=<;<<<=;;856)>CJLF[`Ї’‰haP^ajVC<!#/2'%a%;<=88;843/00//-**)--*246;;=<=PBE<2Tчх–>;^WK40BBCCECCCB@A@>;<8444446;<>BCEEJF0)0жA[yP44CFFECB@><;64346<>BJL@\З`[a\I5EKZZ^F@6L[FJNW’„[>UZfXRQ=ILN\E832248>ОџйзноЂБtјWXtџъяяэ№ёђўђјёёяь№јёњџyyыьфчјђгЖуЯмлллилцмлйллзЯфЩлмллллйитллилллззллзззлЬтилмлйлтлихззжЪуееЬзйхзЬзизллЮЭзЮлулсос§ˆ/&'&####!!)4B&Švzm}€—K›LJLLLLPLNLNKLPLKJNP`KHLLLJJKIJIIHIKKKJIIKLJJKKLNJNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџœHUTRQPPPLNKKNLKLNLKLLKKKKKJJJIIJEHJJKKKLNLLJJLKKLJN›зеЧЖЖРЯ‡K340/***--4&`пџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџјц№ўїмжбЯЬяџєіѕѕїјіієъѕјїѕїїіѕєўџОƒхуыљозџseW\TN384233234<@BFKTZ_tfALNLNKJFA<888;=BFIK;;EF;^Эњ”;6;2<;;<=>BCHHHJJJLLJLKFHIFBAA>@<<=/6E35sђџџt<=KKJHHIIIHIFHFEFXCEFBA>@@@>@>=A@NAA>@@AAAA@366PVE=;^ГэџоT3;=@83-853334546888;<<<<==<<;<<=<;=;;;8;666655566888;;<;8;<<<>r>>=@@=@>>>@@AAN@@>>>=<<<<;<;%=^V^i`hVH>;<8;8;8866666[68;6;<;;;<;<<=>>>>=>=;<=<;;<<64300---/28=BJ>I^ˆД‘’zeT^dfXF/#Cпщых#%<<<<<542320-0/**--**0468<==>>BAC5%2КџЉN<\fN4CA@CBBCECBB@><;86522358;=ABCCFHI8EЈАeIZTI2BCCEFBAA@=884456>CHKB=Ї^WX^K36LNZKRB8#A[HIAVss\UH[jX`QLIUB843226@>мџлзслЄДsТ>Їџџээя№ё№я№ё№эяяя№эќџ-їыђъхчъzіщйфлуйммйчлмсзймулчЯмлйцйЬлЯчЭййзззлилйлтзслулзЬтлилизпХзпифйЮйиззижхйсзслуЯХйзщцїЈ<&&%#%%&/;Ld“}ˆ€ƒ‡“ŒNNLKNKLPNPNPNLLNNQcdJIILLK^IKKJVKIJJIJWKJIJKJXKLNNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџŸZVTQQPNNLKLJLLKLKLLNLLLXJJKLLJJJCBIJKLKKKKJKLJKLJKN‹нЯЪПЧОЯЄi*3//-//^вџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџѕмэїїЯЪаЮЬчџђєєєѕїїііѕіўїѕїјієђ§џЄpЖллохзџy}yd[UK>#2002248/FNQ[efRC\Уџ‘JN[TI<;5668=CETI<=JFLŸџб^682=888;>@BEFHJHIJHIIJHFCCA@>=<<<>35B@4dяџџ€/4JHIHIFHHHHEFFECCCAABA@@@>=<==@=@A@AAAABA-44%/8@8E@<84242323566;;8<=>>=>>>>=><>>=>=8<<;866688668;8;8;<;=;8;;<=<<==<==>==>==A@@@<=><<<=;;8<<8>NVZ^_naJ>=>@=;;88688585888568;;;;8;===<=<>>=>@J;;;<888420/*****))*-!5)@FNFAz˜О˜zWK_g``J4RЩыџџџД*<>=%543222//*/--)*--35<<<==>A>ABH3>вџВ<=^WP'/CCCCCBB@A>@>;;66445456>@BCCCEEH<4cЭ‚QZeL4CCFFEEABA<;55558PBзџтиизДДJБ|Rџћѕыэяј№№№ёёяяьяљыџмГџџѕьђмэ=ѓлллмилтхзймЯиЬтЯмллммлмЬзлцлмтитйижзийилйЮззллсзийЪйзлзйззЧилцЮизпижЭзйййлулсижжчяў­I&&%%&'03Z‰„„ˆ|™ˆЈNNPLLKLLPNNPNNKPR^LKLJJLIKJJIIIJJHIII8LJKKLJLKJLLPпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ–LWRPRPNPLKLKLLLKNLNKKKJKJKJLNKJIFCHJJJLKJKLKKJKNKLNŠчРЯЧЦЦиУ–I3//02%Wнџџ§џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўў§џђоыјђЫдфЯ“Оџэ№ђђєіѕѕѕєѕііѕїџјќџјђ‘€ОедыйжџЇ<…e\UK=220224)FP`[cЃn8џлˆ;LXPF)AXWNPPLI42TRcВЧ•<@PKKJKIFB=85346APJrљџ‚-45*)68;<@CBFFIIHHIIHFIFEBB>==>;=-/0FB)^уџџ•3>IIHHFFFHEFECCCCAAB@A@@>=><;>>=<==@AAAACBB&JRKK8<зџѕСk*!=NI2B@<<;6543433466;<==>>>=@@>=@@>A>>==>=;;<8;;8;;<;8;;;8;888;888;;<<=<;>=<<<><=@A>><<><;<<;<<<;&=L`X^j^VK@>>PN=<888;866665866888;6;;;<<<<<<>=>>;;8844330/-**))*)*)***)*-!#=3I5H^‘иГ—kWP^hF*6аџџџџДBK<864232-00*----*/025;;<>>=>AAA3F'-ВџЇ@@^VN63ACBBBA@B@@>ABBBCEF;'>‡›_EZ^L*BECCBEBA>J;68885&cIJ>RZvoIHVXdXQJB#336>FZEЮџзмтфхВn—Џ-џџђыъсыэј№ё№яьтыыђџx@{ђџњэщоџџпулмлллЉитлисйлмлмллмллиллЮтмЯизхссЪжззислйтиллийлзззтизхссилллыЬзжззлщизхиллззззТ№џД=%&&#&*!0k›‡–…ˆ‹Œ›”ЅPPLNNNLNPLNNPKNP^PLLLJKLJKJJHJIIKKKJHKKJIHJJLLKLLNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџšKTRTQPQPNLLLNLKLLLLKKKKKKJKLKKLJIJJIIJLKJLKLKKLNLKL{эЭЪЮЮЭзмО\5200!Pсџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџўў§џэоъљчлгцЫP[џ§яя№ёђє§ѕѓєѕііѕєєњџбП–ПдЧзздџЪBƒz`[cE%0023'CPU\^TUCщхqC_WPE'6BTWPZNKH->WWcЛЭeAC>JJKIEB>;42246=AEFI;AZFNšыЪP002*88;<@ACHFIIIHJIHIFCCBA>>;<;;--5A8=KУџџv)#>JEFFCCEFFCCABC@A@@>@=>>=<<<=<=><>>AAABBC48>F=0KЛџџОz&4;LIFCCA@><;56433324568<<>>AA=@@>@@AA>A>>@=<<<=<;;<=<><<<<<<<<8888;;;;88<<<<;;;=<;<<<=;<;8<<;<;<<<<<5=Lf[\o^UJ@=>CP===;;;<8666656868886888;<;;<=<<;6;86886;<>>ABABBH6-Z›ЂP[XP8CBEEFCAAB@<;68^=@CIK>WsZWhL5IJKWJE@;#)PZIKPUs^WHW[dWQLC%#KBI\EбїЭщщсђзo’=ЋџџыыъныэяњэыэьыєџўЏyлџџѕщэџјзлйймлйсззлтиллфлйммййтлллззллллйУллсийлзийчЯлилцйзитлйилЮилиззЭзеъзлйзззЮййхзизздуъыЉ<)''0\‘Ÿ™‰ˆŠ˜Ž™›ЃNPLLNLKNL[PPN>Qa=LLKLKJLNKKIKIIWLKILLKKJIJJJLLJKPPпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџHUUQRQNNLKLKLJKLLNNPLKKXJJJJKKLJKWKJKLKKJKKJNKLLNLNхЙЮоойЯуЧˆ!!3&%jмџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўў§ўўџџ§џелоъ№нехЈяџєяяяёђѓєѕѕѕєѓєѕѓџќŠ—мЮбдзжєзIdecmeH;2!3'CPV\jdI8ЃџСPC\RJB&)BUJLNKF5/B\U’ЦЂQ6RLJIJIF@<55335;AEQHF8E_Nrхў{=-3-868=@ACEEIJJIHJIIECBAB>>;;;<<03CH)Lтџџ‘&;HHFHFCABAAA@A>>>>@>>@>=====<=>=>@@AAAAB*<86442033446;<>=@AA@A@AAAAAN>A@@>>>==>==<>==>>>>>==<<<;;;;;<86;<<<=;;;<;<886688888=<;<=>==<#=W`X\^\`I@>>A>>>==<;;;;688865556886668;68;666632//0-//-*)'*')))))'*)))*'))-)))-0=E45R‹ЛсЈWPLQA‹џџџ-8554432000///-*/-0204;;==>>A@>AABH*=—џЈ6E[TJ52ABAA@AA=><;<=;8;<;;68<=>>ABBCF=*`Њ|PZdK5BEJEBCB@><<88<>CHNNA\ŽN[jP5HIWWIFP<8P^LBFFH8>>===>><===>o>>@=A>@BACA04LHE)/‰ХџџВ\)64LHFFCEECBA@<<8655222245688<>>@AAA@@@AA>@B@>>========@>=@@@>>>===>>===;;88;8;<;88;88688855666666<=;<=>=><'\Q`dsidF>=>=>>@=>><=;<;;;668;6568558866655340/-***---))*))))')&&&'''))')))'')***&#/330HУщ _TNV4-єџџ[855533A002/0/-////-344;<=<>>AAAAAB86>ЂџЏ;N^TJ2B@AAAA>@><=<;=<;;86;<8;<>NBAAEH5A›ƒPZaP8JFEEBCBA@@<;<<=AILL>WqXgQ;6HKWKIB@'%AcIK>Rew\EVidWTNI5LcaBџзфллмтсŸ[2цэъыяяџћјёљ№ыђџiЊЯъящт№я[єјелйнлйллллйиЭлйииЧйзцЯщиизййтйжзсжзцмллцЬлисУсииищйййзцсЫззхиижйыийхЭжесиЫзззепцззецјКNNZ•ЊЃŽzˆ™’’‘ЂœLPKLLPPPN\PPdTPLKLLLNNNJLKJIIIHIKIJIIIWKLKJJJKLKLNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ•KURPPPPPN@–>LLPLKKKKKNKJLKJJJKLNKJKKKKJJLJJLNLKLLLPŽяШнзжмЯаьа‹nщџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўўўўџџџфхщыьћозIьџђыьялРлтхфђїїѕщѓvPД‹ЊполизењщH`XRJCB@BKRX^rXPZВјPP[QH*#AEHII6>[RzЩ§805'8;<@CEHHHJIJIVJHTFEC@>=====>05@@;@Јџџ­'*@KFIEFCCBAA@@>>=@><===>>=@>@>@>@>@BBBB0-2AJ;5\Иџџоp--88HFFECCBABA@A><;6534222348;<<>>>@>@BAAAAA@@@>>>=>>=>>>@AA@AB>A>A@@>@@>=>=<<;<<8;<;8666588656868688;8;;=>==;AHKPeaeB<@@=>@>@>>=<==;<888886664535434430//*)'*)))'))''&''&''&&&&&&')&&'&'&)'&'**)^!'*;ƒЪь›T;[E џђ;'54543222020-/-/-0-2568;;<=>@>@>AAEI6>™јBH[RJ5A>A@>@>=><<<<;;;8;;8;;=>>@AABE=@KЏzJXgL*CECCBCBBBB@==>A@F\L8%/Z`64455CXIKKLKKLKIJHHFBB@@A>@>@A5;HA=”џџО4!6LIHFFHCCCB@A@>==>>====>>AAAACACCCAAA32>><864443303358<==>>@@>>AAAAAA=@@=<<=>=>>=>@ABAA@A@@AAA@>ABB@>==<=<<-''-))!)#00*@--2AABAAA3B0&/A#0&#>A=<>>=><<=><;;;6;88554432220-/--)*'&&'')&'&)%%%&&&&%&#%&'&%%%#%&&&&%''&&)))-™kZAЂђо—[JP8^ОQ286564342332--2-//00024688;<>>>AA@BECI58УяqEQX^H-==>=;=<<<<<<;;<<8;66;;<=@>ABEH3<ˆŒP[XQ8BCBBBBBBAA@@<=*@FIWLCkdUcfP/FHIIFC@>)/cWK=>[z\HUWZWQPK8HBvўъђыэдВРл^ˆv^ЂџџцЯэытхєјџџџџнУЙ^ŸБХёсхѓџh0;mўэфилтллЭсзцЭммхщйийулихЬмлЬлцллиичиизззЮзлтийЦхзззчйллззЬжпзисисизйзжлзжиххихззззповућЭ0АДœ­z|Ѓ”•ЌŸKPNNNPP^AR`_NPPLLKLLNLLJLLJIKIJJFIIIJJJHHKJJKNNPLNмџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџœIUTRRPNNPPNKNLKKKKLLLJKLLIIKKKKKKLKKJKKKKKLJJKLLLKP‘уКбожнжуицо–5mэџџўџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџAїњя№яђџЧz™‘ohтќяђђђђњѕјњ§џџџџџђЬ‡ЦумннмлџДIjL3ABINU[`aUJƒсд„E_XPB'6AQHIRB>**R^\ОrB>PLKITQA>8445;@EIIJIKA^UzУЫv=6-*<>@BEHJLKPLLNKJJIFFCAA@@BBCBC6H<5vџџз5*BKIJHFEFEBBAA@A@>>>=>AAB@@CAABCCCECCBC4>B<43€сџџˆU)2;IFCCAAAAA@@@@>>==<8443222243566<=<<=>@>>@@@>@A=><<=>>>@@>>>>B@@@>@>>ABB0@2/0002256HIIKJNPP[[QQ\\a\aa\\\Qd\Q\c^^kf^g_QPNLK65F2C04&20/=@=<;8;;66555332200-))))))'')'&)''&&&&%%&&%&&%&#''&%%%#!%#%%#&&''&'!QУПЏУ‡FAЏЯШt6;C@@@BBCCCH3RллNBPUN50==<<<<=<8<8;<;;;886665;<;<@AAIAWŸˆ[ZRJ00ABBAAAAB@@<<==@EJNN>kdVjQ80@ACEBB>)R_K=Qi€fHTWcWURLHBЇыћсїђПнКПF^pџџџџяЙуѕџџџџџџџџƒƒСЁШысф№џ@R>sџћиЮйлутзицйлщлимлЯэлзлилчЮиллЫийжжйзлхзйиисзжсжзжжзиууизжиЮйлйжззсииссйЪзйзсйзфзззобнєЧB”ВБА„š‹ƒЃЅ˜­šLNLNPL\QRUhANNNPLLNLLKKLXKJJIIJJKHIKIHIIIKKJJJNLNPпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџœLWURPPPNNNNLNKJKKKLPPKNLKLJKLKKJKKKLKKJJKLJJKNKLKLNыШйдздехлыяТvёџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџўўўќџџџ;њџѕяяыљфЪИЁŽ›щіъјіщђчєјўџџџџџџџб’нсьопмыџw#BHECHPW\^dQJnъЯ^IPUN@#-4TcoБ^6;LKLJHB@8865=>FJKNNK@VPWŽщбP;40>@>AFFVLLLNNNLLKIHFFBBACBCEEF6@F-ZѓџџQ-4=IIHIFHEECCA@BA@@BAAABCECCBCFQEFEEFE6-C;<'IРџџЮc35I2BBBA>@A>>@=>;<<<;85542200223245;<;<==>>@@>>>>==><<<<<<>==>AA@A@@A-B05656JJLPQTTfWaXhZd[ko\g^g^^^\\\[Z[[XWZWZZ^^Z[h^`ap\[icfhedTca\PNJHH343-#-&;6554202/-*)''))'&'*))'''&'&%&&''&'&%&&&'&'&&%&%#'&&#&&'')œЫЧЧЋВЧ“Ђ/vЧзЛT*;QZQH*)6655433300/200/-/22346<8;<<<>>A@BAAEH2gШЫUA[_K0-;6;86;<88;<;;8;854343358;<>@F2;ys[[f[E>BACABCCBB>=<<>@FVLPyZXd^I--=ACBA>;)HVL<@TnkVBUcWWQZHFцьсуўЬr ^sџџџџџџџџџџџџџџџџ Њп№ъєџЭ8QV@џјтзйлйзлтиЯллЯлмлулйтЭллллтзсйижизлллйзиЮйтйжпеежзиияулзлихЮзйийхижЩийжиЩзйжЦзХзеднбыљЧЏЙЂ}Œ}“Ё—•ЏšNPNLNPPN^dPPNPPLKKNLLKJKKPJJJJIIKIIIKIJKKIFHHKKKLNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџŸLWURQPQPNKZNJKKKLKLNKKLLLKIJLJKIJIIJJJIKLKKJ^LLKLLNъЪлжеддлнмуліџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўџџџўџџџџPиџїяяяўїтъŸ–nТџџџџќјыјќџџџџџџџџЋЗэхспщоыџ&-3;>CIPU\^`gU›зЊcEZTL>&>CRIIHB>-JW`qи—Z6PKKJJTC>;868>FUNZPPNCXX^Ђєy><5B0@AEFHKNNP[PPLKKIIECCCCCEFHFI>J@IЮџџ^*6KJIJFFFCCQCCABBBCCCECCEHFFHIHHFHFFEFJ2UA=4„ѓџџД-#3ICACA@@@A>@=<==<<8;8866532-0//22324586;<<<<=<>>>><<<;8;<<<=<=>02'568;KNPRUVd\^m\^avardmmqqsroy€yooxxxzvpyonnnntxmwpgry‚„ˆvj`i^\^^[[[ZZdhgiedcaPNJFC-)*'!/&-)'))')')*'**)'''&'&)))&&&))'&''''')&&&''''))*!<ссЦЭРИи­Жќјi&šџсŒ;@JXRH3-8885330200//--0/002588<<<<===<<@>>@2H-2kіГHEH@X{LX^L40>BBBCECPP@><<;@CJL@VŒXZgJ0*<>BC@L>)B^FFLQw^ZHTckU^LHтџўйяђŸЏЉšndK`џџџњ™ЃдэѕџјцЙчЏ=БЄЖвожџџ*PPTX=„їхейсЫзилллммфллмлзЭълммммйзилзХззйЮииххзлйсЭзищлззилйищисйзлззЬлиедззззззйзцуеезодеещјnЂЁБ‚Š”Ќ•ˆЌ’P\PNPPLNLPNPLPPLKLNLNKgJLLXJKJKJJHIIJHJJJKKIILKJLNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ”LVTPRPPLLPNLLLKJKLLKLKNNJKLKKIKJJLKLJKJJKKJKLKLNKNNхЬлзоеейъцнуџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўўџџџ`54›џљэ№№ћъ­ЄˆgђџџџџџјќџџџџџџџјџЖСщмоъпнђ§'*4A<><>===;;;6886544322//=/0/22344666888;;<<<;8;88;;<*!*&2HJKNPT`WZ\^\\ctex}x„ƒ‡‡Šzyrv\XZZZZXXXUXVUUVTQQTQTUUUVVWVWZX^^^mktowpywvqqnnh^^[\[\\ZWWgacXJHA>&!/-*'/)***--)'))'')))')'))))))*')*))))'***-0…УвцуЮЄУъџямымj>ЬџмT/J\eL5#;&5342220/00/0/0235588;;68;888;;I<=@H-5сCKfNC66554688;;565553463354458<ŸџјзийзйчлщмллмЯмиллммхолмйлтйлзиицллилЮхлсЧийллтхЬззйззйиЮлллсзщсзжЩисзезсзизжззгжщелч_ВЂЉЏ‹‚”Ј–ЄЄ—NPPN[NLNNLPNPPPNKLKLNKKINKKLLKIWJIJJKHJIHIHVKIJLLLпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‚KVUQPPNPPNPZLLNNLLLKKKKLJKLLKLJIJJLKIJILKKKKKKKkLNPпШвжзеЩцнцмвџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџўќџџџ_#IFKђџыяђџїЧЂСБЅ…Rџџџџўсќџџџџџќзф§зЮмнсытъџМ#%'5APX^adJVЖсЃBaWNH-CJ6jјџЛ42AKJFFCAAECCCAACCCEFHHJJKIKLJKKHHJIF;4<>8%oчџџО//6ECCBA@>@>>>>=<<<888868653000/-*-//00333358486686;888;;<)*#6IKPTW\^__acc`vˆ‡‡ƒ–{zzpo^ZWWUUFQPNKKLKLJJIJHHHIHFFEEFEEEIFFFFIFH;245&0AAPBhTUWhddettppqnosk`^[WZkjek`^UHA=%///0-**)))-'**'))*')*))*)*)*)*'*-*-/02ЄъжџхђгвцфqŸВЁэЧџЯAміŠ@;^aPH2<6442200/00000020366;;865644434668)A//HГЦWJ[cJA)54455668866655654232345;8=ABI2U„\HXcJ30BBCECEEFC@<<=<@FL@U{dVmN3=A@BECK;>>/ABJQU{XRUdZcRP%џџсђсщЈƒ‰‰™Beт№№џџќіџыыяяјЂЄосђџџ)LNPVZ[^jџофзцфмйлллфмЮъЮфмййнлнлиЮймллуллйизлиизсссйсзизеиызссзизцлзззсзйзсчззежйлЧсхсиеЩвеоъVЦЅ ›‡ŒŽЃЅˆ–И˜NPPLPLNLLLLLNLNNKNKKKNJKNLLLJIJKKHJJKJIHFJHKIJIKKPпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџŽWTTRQRQNPPNKLLPLPPLLLLLNKJLNIKKJJKLKKKKKKKLKNJLL=LN’ьЫвфчзЩлмнЯЏџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџў§џџџ‰-JHF%БџџіёќњиПУОЅ•a[џџџџљћўў§ўџјомфовеЯуфъыџP)&>LV\afRWЄЯ…THXNF'BIKPQPP<8\N`УгXC8/CBEFHJKLNPPNLKKJHFEECBBFHIJJKCE6\еџєQ4PKJJFCBBBCABBCBCEFEIIIJJKKKKLLIIJJI62<5-6џџџt&0FEBA@B@>=@@>>>><<=;<;<86644000//-**-0022424455563588&'#3&ILRW\^`egir‡…Ї•jys`_ZXIFEQBNLJ;IHHHICBABAA0A>@BB/>A@-===@><*<<<<*=<&>)pДz@HCBCBEFHIJKPPQUUaceg“ˆmmm^_^^[Zca_n^UF@-8/--***)))')''))))*)*)))*))**-*0/#ліјэуСыЧцўвЂ­ƒŒЏДџџЭ‡RЪџ’\4RX^J3&5420202////0200336855553332223455)A8/RЏЧKEWdF>'63435455685588544334456;<>AFLCkЄZi_PEABABFFHHEEAB>;;@BKLRXXVV[E)<>AU88BBAABJ;fiXBUdZWRC“јјљэъф™‚–h@iџўџјгРЃ•ˆ‘ЙџCˆ“М§јўџ“*PN_W[X\_AМўыицилуйллуфхллмщЯлммчлззсийллмйЮлййлжезЬЬйзизйжзиЫхззйийззйжзлллЧхЫпззсзщлзЫзжгвгояdЂЏЂВ‡•Љ˜˜О˜KPPNKJLNLLPPPKLNLKKLLKKLJJNKKKJJKJIJKIJKIJKJKIHJNPпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‰JTRRTPPPPLNNNLLLNPNPNLLLLNNLKKKKJIKKKLLJKLLKLLKaKLP“сЭмлхжелцъмХџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџŽ#PW=CA3Pцџџіњ§тзЯвЯОЈZ\‹яџќќћћћћ§ќ§џџџьихѓхяџх'@Xa\cWVz™ы€[LZRKB<;UUNX\HA/;T^hЌœQ@BPKJIE>;66;>EJLPPQP=RPV‰зОU6>FFEFIJKKKLKNLJJIHFCACCEFFJVK<5@BE}џџt')CJFHECPA@BBCCCCEFFIIJJIJJKKLKKKKIHI-3>2)QЧџџщ\225BBAB@AB@@>>>=<=<<==<8;8886532/00/--0-02443444555&)!&3ILQW[`egj|…ЅГša_NIVEPQNNKIIHCCBEBA@AA@@>==<@>=<>=<>>=>>><<=<;<;8;;<;<845>INЛŒEHA*88<<<->0BCEEFIIKNPRTV`gdwvygmni^\[Xfde_LIB/%!-**-))*')**')**)*)*)*)*--/0ЏиуђъјжђфКоў›ŸaˆЙјбџџо>!˜џЭi0C^eKB&%42220/-/00----2444333302//022445@EKLPVrWf\60<;88>CmFECBHNViXTUXhWU5•џїѕяќХ’€ˆQzъХژЃАЯхѕчџўџЊ’Јфїџџл@FVNP\PPPI_^Ємˆ<;65EFIJKKLLLNLLIHFFFCBABFHJIK;>REHkщџГ6=>JEECCA@@@ACCHHHHHJKKJKLKJKIJFJJIH2BB56nџџџЫ=-;FB@A@BAA@AB@@>>>>=>==<;<;8865442020-0-222245545!;--5JQX[afjy‰—ЅЌЂ„‚rdPJWRPNLIFECB2@C@A>>==@==>=;<;<;;<<>>====>L>=>>==>=<<;;<;8;;6!6ANWQPUIA<6858;;<<<<><<<;;<<=@CCFJPQRUjix‡€ypo\gZdgnjZ^F@&!!-&-))*)))''***)*-**)0/!RбјпўяэяџџЯцџјДЬД‘еs“ЩС§џљџЇmяцEP[_LB*%320//-/-****)-2A4344323/00023346<02>…ЪhCZ^K-;5453456686888<;;<;8;<<@AEEIK5Cr{WVfN)AECFEFEEFCA@@@A5KP>gsUWkK/&5=FNP@}JB@5PV‚d;RTiZX^џџђ№ялƒohіџџџџџџџџџџџџџђБзјїџЯLINRUWUVZWZZ5сћпслчмлЧййлмлмлмйлмллсзиймнлллзлйиллиззйлйиллизщижпйисйлззжсзйтзйзеззфХзизжпифезноxЇЅЁЋ‡ŒЇВ˜—ЏˆNPPNLLNKKPNLLPPJJNNPNKKXJLPNLLKKIIIJHHIIJHHHJJKJJNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџˆJUVQQNPPPPNNLLLNLPPPLLNNLLLLKKKLKKKKKKLKJKLKJKLLNLP‘пЪгпдйŸЮцщфуџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџўўџџџВKddj[LCA2BЪџјяъъ№ђєЈОо|‘€ОўќўџџџџџџџџџџєычыјџЅBPc^dgKdМаmQQZhZQNKF@@dF2L\f…ЄsPFLKJHC@<&88@BHKNPPQACLVeœРp@85EFIKJJKKKLNKKUHCCBBBCEHJHII@AB@>A@>@@>=>@;<;865442302000023445&))-2>=<=<;<<==;;;;<;<<>;<;;8=;<<@>>>>>@@>>=>=>=<<<;;вч™FF^VPC%320//-***-')-/34544442322/03458<08;\ЁЏNPZPH)85545586;…<=>@>AA@@>ABCCFIWNL>hdXUhP6BCCHHFFHIFHFCFFJZPPRrWWgJ!'=EW^TdVN!=AFLUqWTRW[^8*sј§јёъПoiџџџџџџџџџџџџџџјз№џџћ='AIIQWWWWVZWX[[-тћеслЯцллмййлйллЭчмллиЬщЯлмлмйллизслзссийЮзилййсзззззЪиизпииийллйфджеззжизОоежзвбмАЙ’Љˆ“‚Є˜™Л“PPLPPNKLNPNNLLNLLNLLLJKNJKNNLL^JfJJIJFFFJHIIHJJKNNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџXUUQRPPPNPPNNKNLNLNPLLKNNNLLKJJKLKKKLKJKJIJJLKJKLPPоЬщсдй{уяфсџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџў§ўў§џџџИ=dcccqaJCA'hфјяччъћћеИЙ„ХИ§§џџџџџџџџџџџўџсфэџ­BPXiceV{ОШjP[UUX^\WVUXC<@5P^eЄhJQNKKHB=666=AEILPPPP=B^W€щЂR><8FIIKLNLLNJKKIEBB@@CAEEFILJI;FP>rџ§€%6HEEB@@@ABABBEFIKJLLJKNLKJKKKJIIH4/;B-4ˆџџџi35A@>A>>>@@>A>>AAA@ABABA@@>>=@@C>@===>@CEA>==<<<=<886848F^Z\^jPB;566;6;8;;66443200/-*-*-/-#!!58-@4IKPT`kixq{ma^\\chjcUC*!#!%*')))****)--2сєђёньљѕѕўџћяќџлВЪЙМжxЊнКбђэїџј^ ђЁQ3^gPE-00/*/-****)-4566666435533546;<>C%/Џ™H[fZB=88655880-0@BAEECCCCECCEHKNPP5QoVXgQJ4BEFIHIHIJVJHJJLN\ARŠXTmX3CINTi|tX)=EH=dWUTRIЧv^5WјђќьјХ}џџџџџџџџџџџџјђьъџџР%4K8LUWnZVWXUVWZ[яїпжиййлитйллмлмЯлллтйлмфмщбфиллЮЫлзлиисщллйлиЬизззйипзззезиЫтлизЫожзееЬожжзжжжфн„ЅЅ•Й“’™ВŽ™Ѕ—NQPLNNNNNNLPLNNJLNKKNJKLKLNJNLJKKIJJIIFIUHIIHHIKLKпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџˆWUQRRPPPPNPLLNPNPNNLLLKNKLLIKIKKJ^LKLLJKJKLIKLLKLPP”щзъсздохыффнџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўў§ћџџз0>eda__`^UKB>ŽяјђђъыёјпЧ‡Šџџџџџџџџџџџџџџљхєџз)F[W^dgL{У­kW[TKKT^r^epiA'Q^h˜˜cHPLLIF@=665=BFIKLPPP>V`[…ЙŒE=88IJKLJLLLPLKHIEC@@BCEEFJKWKKBZIPбџЃB&AIECCAAA@BABEEEFHKJLNKKKKKJJKJJFF42AE0#™џџьf550AA>@@@@@@>>AA>B@>@ABBBBA@B@>==<;85543424356))BHAVCW_e’СЂяЅ‹nTCAB@IFE@=*<'554566556566688666686865868=8;8<8;<<<=J=>>=>B)0Fc@>=====;<<66848ITW\^f^C;68888886543220/-/*--****)****---##6=ACHKQ`dw{z|_^P\\faXIB*#*)*''*)*-џзОхіэћљ№ђќєчђџџЄУмыќыy­д­лТьльџџќЄŒјВU2QhQH-%20/-)//*/--25666;;8868;888;<<>>A6>AœЏe@Z^JA<;5685&Й!>>BCCHFFHECCEIHLPPPL=`mWZ_L3BEHHIHJKLKLNKJKP\PRgaVeP4JJea````_^\`L3*ВфчёхщыџіыЮЪТџџџџџџџџџџџџџіы№џУ4HPX^dgRСБvPZPI3EPmq^XgL/'4Q^h•‡aFALKIC@8858=AHJKJKNLC[cpЅСnE;6HIKNLNPNPPLHHFCABAAAFFJKLJK4CPPњмm!4>FCBBBBABCBCEHUKJLKKLKKKKLIIIIHE62;>'3Вџџўa&4C0AAA@A@BBAAA@ABAABCAECBBABCAAB><=;86543446**5JPKQLwƒАъдЪŸ_\>>FN;F3>'<);856F45555565555456555665656666888888<8;<;<<<===A‡^B@<<<<<<<;;8;86#;J_X\\fTC;6588653320200/-)--/-**-*)6*))))'*'*)%0!5'!&)')-0ЧјјћцъзыяђяяёёёіџфЩєођџЏБЏЇШЈзРЙуљџџџе|џЩc>`eRH%2/----*-/0258<;><<<=;><;<;=>>AA3<6FОВINiPE0<;;6%!zTAABCEFFIFHEEIFJJNPPNCFIKKKJ=>\eqДЏPA>=<;;;88865656654564445565545654433444568;68<<<<<;<<>;=/JWE@==<=<=<;;66;864XеЏqIUZ\H'0/-/0-20038;>@>=<>@>@@@>L@>===@4')…ТdKZmLB><8;&**=@BCEHIIJJIHHJIJKPQ\N6TmWXjc;CCEHJJKPPc^NLKZ/2K_tVad;NKHB>><>BIpKICIWWE30EHJKJKJ=Q\d‚›”X6PKKLNPNQQPPNKHFECCEEFIHLLNNL5UKJЁџжW-<HEC0>><==<=<;<;<;866865555553545655645344543456688;888;;=<;=<<<=@-<><=>;;<;8868845@LA>>B@B>>@>@=>@BB8)ZšH^XaF0@e=;;;>@@ECFFK^KJJIIHJKPPc^PPWhUagK)EHHKLNPQRRPT=8>2=VzTaeK6EB@@=BH3IhL;KNdTQUe[fW;F{СтџџўјщљўџџџџџџxTB@CPHEJNRU`VUWUcWWWVXXWW[P‡џххлцйлиифмщллйлммылззлиииллмуийихйлллуммллилШллЮсЮичжзлсзсйпоШжссЭжйжепзфжътaЛЙЃР‚’’˜ДšЂТLNPNLNKLPPNPLNNZKLLKNKJJKKKLLILLJKIILIJJIIJJIHKJJLпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџŠKWTQPPNPLPPLNLILNPLLLLLJKKKXLJIJJJJJJJKJJKNJKJKLNNP–фЯэмйзЮътъаХџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўџџџcIfdc`^a`^_`_^\ZWRL;ˆќяцжъяъьѓўџџџџљјєёэыоцџџ@0KPWhae`{Г’XVXQH8#*-26;*-@4NZfg@33IHE>;5458@FIJKLNJKT^fqВoIEALLP\PQQRQNLKIFECEFHJKNNPPP@E[JhШў484HECCEEEEHUJKJJKJJLKJKIJIIIIFEF5/=C04ЄџџлE454BBBBBABCCCCFFEEFEEEFCEEEEFEEEECB@@@=;;&/0HPWJ;PСїяЖfV60=@J64A@@@>@=<=<<===<<<<;;88;666665655445564544244444566565d8;;;<;<<<;<=<<;<=;;;<86866684*K`[^_g`I=4232002/-/-H**--)****)))&'&'''''&%&&&&'&&&''&)''''#!&-C>FX^‡УЈЁjPE^ZcNJXХџџњхџўџёэээёђ№йёџџиыџџыПЭТОЫ‰–й™ЧЮофпяојџџ№XTџтz5TZ`F'%223424456<=>ABAABAAA@=AAA@@>@AE<5^ЂnFZ_L20>><<@>@CEEEHJJJLJJJIIKNPPPQ=RWVadPF4FIJNPPR\W>;AHJ3BRWUa_K'@B@@`UVF;kLI;NQRRUUopXR66МнќуџњзДБj_P-/PPJEFKLRRRUVWUVUVWWXWVV[[>™њёйлйилмллмлллммоолллйлЮйулмэииизйцййллмййлййщллжзтлЮззщЬйжЬззужйсзъепЭйежасs}ЏЂ‹“–šЏ›€­ŸLPPNKKPP[PPLLNPLNK_JLNLLNKKXJKLLKJKKLIIJIIIHKIJKKNпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ{XVRRPQPNNNL[PLKKNPNNKLLLLJJLJFJJJJJJJJKKJILLJLLLNLPŸъОсщизЮъсѕсШџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўћџџq#Teed`_`a_`^^__^ZXWU\L-ъџємЧгдыєє№№яэььыофџџџ‰&LPd\cdXˆйЇVJVRH=!*))-23482L[g„ЈjCB8/2C=;646=AHIKNZLKLR^iЃЊiBB=PPQRRRRQQPKIFHCEFIJKPPP\PLBVTL•ќЏP&;@>>=>=<=@=<><<<<8=88;86866555545444344334455666466888<<8;6;<<<;;<<=<;<;6668;884*WVX^_^WJ<3000//0-0**-*B*))))*''))'&%&&&&%&#%&%&&&'''&%''&&%&)**!!6=A6=EP|ЈяДŠQB^ZK)UОџџџџўяїяђџђ№ђџѓіеџђџВиоМСЙ’жЈЦУЪЯТфпсяїџџџI^ялX/KZPE*530344446;=>A@B@BBAA>@AABA@@AAAF@V‰œK^X[6A>>=>>@=ABFFHIILJKKIKKLKN\\QNPfTU`Q4CHJJKN`iB>FN\Us`PQhUagJ3EB0EJKJHДџжхллмлммнщллфлфмъйлЯллчлллЯтзитцЬлцийлллййллЯсЧсйлчслиифзжЬеззжсйЭжпжзож№г„ДЗЄД|”—›Г‹ЈNNLNXJKNNLLNLPPKPNJPPKLLPNKLKKJJLKKKLJJKKJJKIIJKKKпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџXUQQQPPNNPNNPKNJLLNZLLLLLKKJJJJKLJJKKKJJKKLLJkKPLLNЅфаыщмзЮмсъЩШџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ’Ufda``_cc``^^^\\ZZXUU^\0jџџџяПЩСХХдздлэџџџџmJQX^`dR{Л_TVPI#<4--))*0%0L[eЅ™mUXCLIB>8%68>EHJLLNP=@XQh™ [AHTRTTUTRTQNNLFFEEEJKNPQRRPP@;NJ^Дб0=/-)5PJAAN—зџх”a)'8L6CB@@@>@@>@@>>>=><<><<=>>>=>>[=<;=<;;;868555544444354233556655548858886888;<;;;;<<;88665;86;%-WVX[^^aH=0-//C---*))*-')**))''%'&&##%%#%&)&&#&''&)'%''&'')&**)*-*#!!&-084>gГЪСœPBLL5y§џџџјљђџєєѓќђ№зјѓџжсџоЋЯЙЧД€ЦаЯеяыгџчѓџџсLyћѕ\A_WP3%#34436688<>>AABBACPBBCBCA>A@A@C;/`У‰BZTL2A>AA>@ABCFHIIVJILKJIJJKLPPQLP_gVff;2FHKLU3#CJRfW@pp%-KmWWkJ0EAAEJKILLnLJJPdUTR\afPFL-&2=5o\‰hCECQNNIFFJKPRTTURVTVUVZWVWUVTWXWZ2ъџёЧйммммаммфлилЮмллймЯлмчлзиллллйийилииЮзЮйлцЮлуйиЮЪизЫцдцйсззилйЭхззУцЬцЯtВЖ—Г… —™Јœ™Д˜PNKKNJNNPPPPPNPNZLKLKNKLKLKKJKJXXLKLIIIKJLLJIJKKKKщџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ~JUTQQPPPLNLNNLNKLZNPLK^KJJKKJJJLJKIJJJIKJKLJJLLLNNA•хЮхммиихуёЯЯџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџЄEdcd__`cmc_`^\\\[[ZXWTWV\I2гџџџџџџџџџџџнЇIPZ^ac\‡ŸšN^VPH@>R<0-*-&/P\d‰œf^^pXW^NC;6A>/-0/PWA6PƒЮџђ—K0-A03/<;88@@>>=@=>=<=<=@<>@>@>>=@>=<=<;;<<;;6;855554455333544445458558888886888;88<8;8;68888<K_Z[^^iH<3/*--*-C-)-*)*)''''&''%%&#&'#&%'%%#%&'')'*)''''')))))-*******#%<3828UЈДГ’a=TL<˜џџџџџјђњўђя№јђўяо№џЧЭјݏ_ŸсоЮгџРјђђїјџџхйх`P^eKA%#5445668<<=@AABABA@BBAA@@A><@AF2Hƒš^Wp\FCA@=@@>ABFEFHIJVJIJIIIFJNNZN@_hUV^L3EHF='CKdcdXK‘™AAL^RUgP2BQCFJJLL8nP6;L^TRHeР[PT&%#'-ЄzLpVQQPNJCCHKPRRTTQUUUXcXXUUTUUTTVUVX)чјыцЯфбхлмфилЧлммймщщщллуЮззллчлчийллйщзфицллллммтзфзсйџ/џлиЮлмутзилпиззсхpЙЊЄЖ„––­ЁЗ‘NNNPLNNNPNNKPKLLK;LLXJNNLLLLKJLNJIIJLJKLLJNJLKJKLLяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџWURQQPPPNLNNLLJKKLNLJIKIKKJLKJIJKJKJIJJKKLKKJKKKPNP#—яЮифмйЯмъысЪџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџЮCffcaa`_`__`^^^^h^\[XXZXVU[6!K{ЄЏКП /XPW^mdNyБ‚i^VLH*>PP>3-)/2'N^iЄ…Q<0Vv^k[fNB/AHKPNPPLKA[e|Ѕ{FKUWWXZ[[WQQLIIHFFFIJLPPT_RPPELL_Јџ=6NJHHJJJKLNLKPPPPPLJIHHIFHHEECCE6@@/Kоџџw0>KIIIHHFCBECCBBBBEBBBBCAA@>>>><<>====0/3>H@6R€лџќЏ_0/>42=;55665666<<;<>><>==<=<==>=@@>>@>>>>>==<<<><<;<<886F566544444443444554445566866568688;<888568;8<8!8Wdejim^I<0/*------**))*)''&'&&#%#%#)&%&'&#&&&'))**''''&'))'))*)*-/***-**/!&35!/^ём–cAIH!WЦџџџ§ѕэя№їьяћџмьџђихЈ­е|ЗЮЗЙчмъџъщъыџџя6{т›IA\TI0)53565668@@>VA>>>BAAA@A@A@<>>>EI4xtaPdTJ4AAA@<=>@AACEHIFFIFHCFEFIJKP>PˆTWhP4F%>KRXnVUV^xc0CJRU`gLFIHECHLJJ>tP6ILQ^AFЄЉPWLW#@JV_^CWWRPLNJCAEKLPRRQURVUTVWUUVWTWVVTVEVZZ-ёђъйумщммйЯйсЬймлмллллллиймфммЯщлиллилиЮзЯлчлчфлчЯиийл§ўйлстлмЮилйжЬзищоГИ™Јˆ’‰šДšК’NNLcKKJNPPNNNPKKLJWLLKPKLIJKJHIKIKJ8KKLNLLNLJLKKKNюџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ{VRRPPPPNNNLLNKKKLNLLJKJKIKJKLIJIKJJKIJHKKLLLLKLKLNPЈёЯсщлйЯоуъоМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџм=fdaac``__k__^^^[^\[\XXXXUUR[I'J;8!5&=PJP='#EPW^ac[‡Ч’PPUPE0>CHF@6-*/P_k‘J6NPWXZ^^\VPHCINPQQPNQ[a„œgH@VXX[[XXX`RNKKFHFIINPQTTTRP>CNWyоЬU-@>>>>=>==;<<<;<<>0)KEC3==@A>@>>@@@>>>>>==>=;<<;;;868655654554444345E444845568868;86888;68;;<<8;;'FJKP`eC8/----*---)))''''''&'%##&'&&'&&#')''*')*)**))))'*)'****---)*****0//-0LCQ–яЙ”ZLQIHіџџџіыьояџћ№дџісыјЉД‘Ќ™Ѕ™РЭпОњЯќђыїўџ§)=@A>@@>@>><=<<<>4KBЄZXnN32@=>;<;>=>BCBBFFCECCBCCCCINNPTVWoRH#@FPfZdTRTQRKCZJLPRUeP4HEHHKKPLAwQ6HKQT>K_ktUP^BTZUVRTRPPLLI2@@CIPPRUTQUVRVWVUWXVXUVUUUUXXWZ@јџйуЮлмлмчллЯъхнмллмлхуЯмнмйЯйммллизлзслуммилйллмлизляхѓцийЭммйзсЬйжжимоnПИЅ —„—ŽИ“Р‘LNLLLJNLPNLKKLNNNJKINNKLLIJIJJJIWLKJiKLLKLJLJXLLLNяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‚VTPPQPPNLLLKNLKKKKLLLLLKIJJJKJJJKWJKJKJKJKKLLKLJLNP–ђбтялилпфъбБџџџџџџџџџџџџџџџџџџџџџџыџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўўџџјC/ffdcacca`aa_aj^^\^^[\[ZXVVVVVfL!2HPQW[^`ca\L*#4BPV^ceUwœjPVPH2AEEFE@400Q^}Ё‹H64IP^VWWggZWP84JaPN@T^gŒ„dAIWW[eWXWURPNKIFHHILLQRRTUQP@FEV э„=/BJIJLKLKPQNP\PPNKKIKHEEECFFFCC44L><›џџ“)5LKHUIEECCEABB@AA>>><==<<;<<<=<;<;;;'&8=@4#UУџџЫ^!%3%)##222B34W445344434864688<;;8;<=<===>=>A>@@>=>>>=@=<<;;8<;;88688686455434#6&!&')&&!!)#*-2&/33&/3//&30!!#/----*)*)&'&&&&&%#%%%#%')')'&)))-**-***)*)**)'*''))****/*)--**/-/КЄ\=ЄяДzP>K4џџџџясўђ§ьзхъЧ§ММДВ­Љ™ДеЫОидхщыщжїџџ;3/BЂяv@Ih[C'&3334455566;6;=<===;<<;<<=8;*A8P\LNZ^JB@<><<;8<<>ABCCBCCCEBABAFHXP@UVUWcJ2H\UVTRPQNIHCCCIK=cVViP8FFFFKZPQTP6HKQVBEZ[dTPJIPQTP>JKJIFE>@BCJLRTVUUVTVcWUVWTWTVWWWXVXWXWLeџххфмллмхйллллллйчлхмлймлмлулЧйилиЮлйлмлмПъулммлйсзйллЭмлййулзЮхлсзссцнxЋЈЅŸ‹‰š П›ВˆLLNNKLPPPPKLKLNJLKJNNKJKKKIJLKKJJLI8JLJLKJLJLKLZLKяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ}VRPNPPNLLNKLKKLKLLKLKLZLJIIIJKJJJJKKLKKKKJJLKLLKLPBЅчбьмЬзлофёдИџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўќџџџN![dfc`aaaa^a`_^`^^^[^^^\XWVUVWXV^V*/EKPRXWXUKFU>;^ešЂcLVXWZX[WXVQPKIJIJJKPQQ^RQdP6A[VeћЮf6BLKJJKLPNPPPPPPPNLJIFHFHFEFFCE*8C02™џџЛ;0>JJJHHFFEB@@A>>>=>><<=;<<;<;85<;;6;*#28H>*>Ёџџџ‡6%-3!&!42022324445343332445454568;68;<<<=>><<>>>@=>>===><>=<;;<<;;8;;;<)%)&'!*-0FE6IJKLNNXZZ[\a\^kd^c^fcddgT\a^ff^RPNKFF2>-<%!*'&)%&&&&%&&&&''))))'')*'--)*--**')*')))*-*-*-*--*--)*)/-%ЖЙ­М•…ŠJ&ZЪђЮwFI<UиѕџџџяјџЯёссєйЏЫЧГЈˆЈДЯтЯьчѓѕхцяјџџ§-)CХэyI\`L3;#223333544565;;888;<;;=<<<<<-C=UЅЈNZ_PE0><<<;88<=@A@ACPFCBAA>CFIL_PP_VkhKJQPPPPPLHFCB0CCJLKRWkaQ4FJJILP^QRzPJ;K^a`RVZdVNJKNoaLJIHF@=>CEHJJ\QTTVTVUWVVVTWUUWVVVWVWZXZZE™ўылмнмлммлммЯмхмлЮмммлнщЯлмйлйллллуиллмйчллйлмиилЬймлцллулмйллзлллжзщоzЙГЄЁ——›ЂЂƒ›В„LNKNJNPNLNPLKNJJKKIKJKJKKLLKILKXKKKKIJKNKNKKLLNKLNяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ}WTQPPPNKJLKNNKNLXLLLKKKLKK_JHJKKKLKKLJKKIWKLKKKLKPQЊьатщйЦЭнфђжЧџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўўўњџџ_Pfedddadamaa`_^_^^^\\[\ZZXWWXXWVTZQ)%BHLP`PJBBCEHNa\acWvВЏ\\UNHBCHHHQB<&EUa}šoU2*8<>CHNTVZZ\fc[FJA2sнџџХ@'/2000233333253344334434443444555688;;====>>>==>><>>>>>=<=<=;<)<'/#2'2FHJNQPR^`hmejfk^mfjZ[\^\^^\^^h\\\\\_x^^^_o^h_ihjipik`h_`VTFB>*'%#&*''&''')'))*))*))----*)*-***)'))')*--'-**---/**-*![ОБЗ™ŽЌЯ‹“4yфлЂd=@A–єџџџџцЛЮпхь­ТаКРzŽЇЏШХЭзцътёлхяњџџ&/&JАЉ\H[dL0&0/0224434345556688;68>=<<<;AI0mo\Wj^HB>>;=86;==AB@BAABCECBABBFFIFZ`WXiP>BIPU^kaVoЁ€TLUPI3CFFHHC=>=<<;655544323200200%6H8-Jџџя}&4)&0//000245444344W434344543335454444668;;<<<<;======>A@>><-/*%/'3JKLPUUc[\\kcmqacw{w}s}v€sqnpvyypp}m}pvtotvnnqx{yjsr’st_joZZ[ZdXgfdjcg^JEA-*#!%)))**))))*---*--*-*))'''*))*)&)**---*--***Ј№ЊЧКЄ}ˆŒˆŒВ—i)4ЊџђE2@5EцџџџЮѕямдЭЧЦззŠtЂ—vгПЫпъяътфяіьџџ#'06=aдДCFe\F&////2443233544668;;<;=<<8;<@ENT‡gXehJ4A=U>868;;>A@AACCBEFEBBALBNiWZcQNKIFBEEJFFBACFEINNUVTeR*JHILLNQQVyP66P^TRVWehRNIHHIFB@/jAAHIIHJLPRUUVXVWTRTUTTaUWVUUaUWVWZZX4ЯџьммнллнмномоллнммхономнлйфллуллмммныбщЮлмнйЯимлмйиуйллллймйлзизйиъс|­ЌЄЏš™œЂ­Ђ Ш”NLNNNLLNLPNNNNKJXKJJNLJJLKKLKLKLJJLLKKJLLLKKLJNPNLюџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ„VTTQPPPNLKKLLJJLKLKJLKJKKJ\QAHPQeUQmI%Jg_zePVWX[ZXXaUQPKLKLNLPPQRRQRQQ>R[erЧУQ-6@LNLPLQTTQPPPPNNLKKKEHHHFFHF/=T<;586453200/---*)**-#!'JI<4hнџџЂ;#0'520/---20233243444444433443443454444435458;=<<;<<<==<>-*23)3HJLPUWZ\__cwo||ƒˆ˜‡‚zz`nhmfXWcaVUTTTRRRRTRTQQRUUTUVWVW[[^\ypm}tt|pf\p^^ZXXdhfmkmZeIFB=0-*))---*0-/***)))*'*)))*'**)*))*-***/!чящПŽДОСбЉƒ“˜ДОЅzaЦіЯ^85EТџџџјйцтЫГтЩЋЊœ™zЉРЉлЯйхефщщёоєџЛ!'03*xл—E^g^B#0//0323232246668<<<<><<<<;-BIPd€Z[iPFAA>===;;<=@@AEAFFHFCC>6A6Pi\XXR=6CAFVWLKHEEHF4J[LPRRim6HIJJP^QVVn_HIPPeTWZZWRPHHHA>>>ACEJJJJJKPQTRUUVcaTUUTVWTVVVVVRVXZUVdX-уўхмллыщЯнмммллмнлнмммлхмлммлЯмнхцъмхлхнхнмллмйммфммнщлллмйлиЮлЮийъп‚КЌЅЂš‘ГУ”ЁОLNNPLNPKPPPNPKLNLLJKKLIKILKKJKJJKKLLIWKIXNJKJLNKKNяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ„VTRQRPNPPNNPKJKKJLLXKLKKKK[iKJHIIJKKJJJKKNNLNKKLNNCЖмЯцфлимстьЪКџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџў§ќџџд=fecdd```a_`aa^___^\^^\[X[ZZZVXXUURKB850002458;=CNV\jaZoВƒg^VPICFHIIRA<#HWd| f8&'433446=B0CHWaLH3'KWai™wWRWWVZZXURPLJIKKLPPPPTRQPQPBX^P„Щ}<4jNLPPRRRTRTQPLLNLLIJHIFFIEEEJ=WJCtџџЂ4ITFAAQ><<;544432///-/0*--*''--**/!#&NC*'tџџ§Œ%!*-#)%4220/-//0033444554555453445545556655454444558;<<;<=/0/58JLQWZZ^`aew‰…ˆˆˆ‡q^[^ZXWVTRRQNNKLKKIHHECECCBA@//3AAAAA@AACHJ58A@>PPPPR^Ueaqmwwsjov\^Zf[dXonnceIE0*%!#-00//--)*))))&)'))*)***)))6*'-yіШЫымРПКДТyЊ”„ВдРЏ5Гћџ}JCN'іџщџмЯгЯбeЄ БxЊВƒЧУаумтчххуъџџГ'A2E ЦjBZ^\//-/23332443456<;<=<=<<=;<<U[Za^I3BBA@@@=>@@BEFHHHHRB#%@BF65;šXcdI4FILLNZKLVFCBHI`;QTUgc0JW;PPVaVcZFEFNPRTRXWaUPFC>==AFH[KKJKLLNNRRVTWVVRTWVTRUVXVVaETUWWWWW[0§ќммлмлмхнмййлллмлонллммнлЮллмлммнлмммъмннмммлймммлммнлщлмлймттЫйхл|УЏЈЄšЁДЂŸРŽNNNNLZLLNPPLPPINKKKJJKKJJLKKJJKIKLLLKJLIKNNJJKNNLNюџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџjWUQPQQPNPPPNLJLLKJLLLLKKKJNLKLKIIKKJJKJLLLLKKKKLLLPДиЭфлиилпсяаРџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўћџџђ*3feccc`caaaa```_^^`\^^^\\[[[\[XXWWTXE<632300046023LZd‚™cH-N^WVWWTQPLJIJLLPPTTQQRPL>>WRXЈКk<>QQRQRTTTUTPPPPJKJLIJHFFFFFEC/QdPKЮџ№T5FBA@<8664322-*--*--**')))*)*'***-)4A>)8Њџџъd#'6*)8543//--/0202443454565655544343465665543334344558&/-06KNTW[^_ag€zœЈ™“‘€sa\[ZFUCNNLKJJIFECB2A/-*<)'&%%#4#34z42!0##!&-EPeVPIFA)=>BEFJJL`RT_gZvjnpnn^\[Z[XnodaVE0<#3/*)**))))'))''')'**)))'*)*ЬеЮхсЮЩиУлМРvkŒ‡ЗОхПp`жыЄA@>5aпёџзѕ}зЉДŽ—e{˜ŸœаеЯЫыхњмєзяњџе%5/QЖИXNc`E/-35666546868<=>><<=@>>>==AH=RweWWgJ5FEFACAA@BFFIIKKUQ'C^`=z-8dVgk;3JKLQQPKNJH6HKN\>@TQiR6WKNPQog0)@BIL\PRUWXWTPE*>AEJKHIIJIINKLNPTVWVUVTWUUUTcVVTWaUXXWVVX[NfџџуммлмлмммммммфмммххъымщннхлмнЯнммфалмнланмлмлмнщлщоммЮулмлмйллщлЦАЉВ‘ЏŸЂЄЃŸЧ}NNZLKLJZPPPPNLIKNKPKJJHJPPLKKJJKILNKIKIIKKJKJKLLNKяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџrWTRPPPNNNLNKLKKKKKKKNLJHKJJLKJJHJKJKIIJK|KLKKLNKLLPДсЮълЧйлчъяУЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўјџџ@2Zeddccccaac_^`^^j^^^^\[[[Z[^ZXWVWUNF<6532220026@K_[icdjŠ|g_XRPHIKJKIP=8'JXaƒЄaR2)#464348>HK`F'!&*4P^e„”eF2)#KgVV_PNLJIKNPPRTTURQ\L;Q[WdЬМFAFQQQUTUTUTTRNLZPKKLIHFFHCEFF6J=E>œџџf-><88330200-/)-*-/--***)-***))--#&5C>0AЭџџм'%!))4#3N44656;8L866856665546566645544556&'*4HKfUX^Pek|”Љ’”Їqpa^KTPLKKJHHCBBBCBA>>><<<;8556452300203/0//-**)'-''/4)#-**)))'''''&'')'&&)))#ёћхШиегЦхнЈ•›Єzry{ˆŽлЬмхУRAзчЙQ2=CCнќџщхТЗŸ{ˆm’˜x­Юзгыцћщ№мујїџџ!23%-5>>@A=A>AA@@>BCKAWe\Z`P8FHHHECCEHFJKLKH)>FPhadLqB-=TXFWd=HJLTRTQRPNPQaNPc>PTV`^0J`\Le)558>BHJ\PRTXXVQLCEEIIJJIJJLNKNLPP_RTWVaVWTVWVUVVVUUWWUUVVWZ\L›џфэщмлмфммълфйллнмобммалммонмммомлЮннмллхмнмлмммщЮммнмлмлфйщййлђоУС­ЖŸŸЂОЃУŒNNNJLNLPLNPPNNKLNNgJKLJKZPLLLLJLNNNKKLJKKJKJKLLLKLюџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџrWUTQQPPNNNNNKLKJKKLLJKJKKKJKJJIHIJKKKKJKKLKKLNKKLNBГЮОхщмййптяЭПџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџџџџўџџџx[gdddccd`_a`__`_^_\[\[^^^[Z[\[ZXXfaF>;65543304#;544458;AIPPaE&Q\g›ˆd^CLHE&LcTPLIIJKLPRURR`VRPN4A^QˆЉ•BBEQRTUUTRURRQPNLJJJIHHECFEHCF5=JCkеџО-)/-6432/0---//--****-)-*-*/*-*---0%'6=>)PсџџЊ'5*NNLL[\aedaWIIB@8468;888;8668;6555666;6554466&%-5JNTZ^QPci–›ЂД–…x`\ZECPLIHCAA00@>===>>@>==<<;;;;8653420000///-)-*)'''&'%'*4BNU[XRKB8''&%'&'&''*%/#!;>>@<=<<<[=@@AAA@AABB@BBEJLW…\ZhR6IKIHFIFFFH[JW#2HP`ZXZ[™|IF\sWhhLJP^UaZhUUVUUPQQ_APUTnR%PaZ*8AA'-@CINPdRRhZVQKFHJIKIJWLNKJNLNNRTVUUUUXWVWTWWVVUWVTaUVWVZZZ@ЧџуйлмллмйллммллммнлмЮлммЫъоонмоннхммммнщлннълхнлЮмоомамоллйфммьж‚УК—ДŽЈЂЅЖЃБХNNKLLNLLNPP[NNKKLLKHIKKILPLNLJKKLPLNLJHIKKIIJKKJKKюџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџvWTRPQPPPNLNNLJLLNLJJJJIIKKJJKKJJKKLLLKKLKNNLKLLNNLPЗООъђмлЩотьХЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўў§џџJUed`cacaa`a^^__^_^^\^^^^\\[\Z[[ZVTJ@<85653434;%>HW`‰Ѓ_CNI>;444456;QRTV`T_RRRQQPNKLIHFFHHEEEEFF=UI@ЇџсR!320/----<*/-*--))-/----/----00=8TF8zџџџwA_mmkjtvmfgq^mkjdh_^^B88;8;8<<8;86;6868868;88;6)--5IPH^RZXmŽЈЉŒЂgQQNEQLJF4B@'<<;;;<@><=<=>=>><><=<<<;;;864330002/-***)'&%#&%%&-4B`XffcNE8'&'%!%&&&&&'&)**&##%'=ACHLPQTXn|‡‚^^\ZXfk_VE@!%))'''**)***w/И§дУйТсщџмљмлКьлЂДЏ›ˆ„ЊЈЮЉчџ№ф—№я{34EПџцоВТГ‰ЄšˆЈВБжхъц§чхххунџџq443%-60a–‘P[a_B*8;>@@>>>>=>>>@>>@@A@AAABCBCJ&@>;!HXcxmK4PNH=654658=>AJN`LIJT_g‰fJJZ_x^kdRK3FJKLPPQQUTTVVRRL=VTmЇЄ[-APRUUUVTQPQNNNKJIHFHECCABABC;6N@nыє3&)822/2-/----**--*-//-0//00!6B;*Pќџџ‰>ˆwgfccansccr`m`_\__^gWgV/;;6;68<;;;;;8886868<&-22;PUPT^d…ДПЛВœhcPBHQNIEEA>=;886888888;<<>>=<<><>=<<=<;<;;;;;654320//-*'&&%&%##%&&/6BRZ\^eRE8&%%%%###%%&)&'''''')*)-#!&%=CFINTXdnx‰s^\[[jghKE'!**)**)--/#ќыѓоњувџџџгйЩщбћРИКo—wИЅ—ЖмщЯџјМTЩџЇJIL0 сстХz Ё—ДСРхьфцхьххуыћџ8654828CsДjJZ^I0*=>ABBBAAA@@>><>@>@@@AACEEFJP<|mXXh>5IIJLKJQA'0VRXdWVVTUQNJBCg@BjWW_PBFLLJ3T\wЋ€W>PZ\\Lw^[UN35JPPRTVUVWiQ@<<-&JV@N•џРE*0'#3000///-0//*-*-/-!-P_^FIF*'wџџџd/fƒŒomgecadUfc``aa_ad_`ZWQ4<;;8888<8;;;<;;<;&>34NRNTV\ˆЅЭфЏЃmTC@8LJEA>='&&6886466566F8;;8;<;<<<<<=>>==><88;6J>8544020-*'))&'&#&#%&'-5E^[^^\UF6&#%%#!%&%&''')')'&'')'*)*)--#!!8>EHKPTik€Šˆmm^[[gf^JA&&!--*-/sцЧлщфцыђџџотиОхщЙВ˜У“|ŠЋ’ЯхКлмџџа-FилE8@*6‘у§ТЃДЂ‚ЖЏМЦЮлопђфжф§ађўџ—85458=54kИЈKZUZC)<@AABBAAB>@==>>H\V^`cZxВ‚QWRTWXWZcd[8'Ef^w|e/<`Є„A<<88;;<;=BBH8>Vid|pH/8N_ZiWZ_^faN3H`TUVWWTTRP@T\UnЏ…=FRQRVUUVRPNLNJJHECB@=<88666*/NIJmљђ}--622/-/>030/@2005H_w‹›ЄŽaAJ=*eћџџ[2f€kmXs‚ƒniZhehhXeghhcdqqd_Z`N@<;;;<8;;;8;<<-@0HPUPQQxЄвсТŸq^8@BLFB*-)85433344456454688668<;68;;<<<==<=>==<=;<;;@Q;8;5530/*''&'%%#%&##-5HTX\_mUH;&#%!!#%&&%)&'')')&''))))))))'))'**#!!5;@FKPQd^—‘vxa^^ZfeXF@)2/0дціосЪујќє№їџчЙйчгЪТЗХs‰€˜…Љ˜гЭСнщыѓћИ‹ЙџЋNNT<Џ”ЛУЦЃ‹šЫОЧЯхбѕсхйёйфсјџП68668;2/@AB@@AXHEEFJNFNaZ`ae|ЏtPKQJLeZ[\imI*CUie€_IQPL2*2AA><<;<=ABCE>W`goKP'4ILQVVW\ii^WP;JRVVVVTQ@=F^fziL>RRTVaWURQPKJHFC>===8642456-EQRNЁяЬZ//*#!2/0-%0!2#8[a™“ЄЉЏВ€P/-/VёџџvFhstjwjxmrqrpz}nj|jmkpxkiifg`^ZdC*<;;<8;=;*)22w=>>><><=88JQ>JP6402/)'&%%%&&&&%#*8IU[^j^RI8'##%!#%%&&%&')'''''&&)'&'')'))&*'&&''*%!%L8&ЃжсЄ–ЊТЧЩммъфуххфххЯџџБ;8888'=C3^Ї ^ZaP50=ACEBBAAA@>>>@>@@AACEFTIJIN;QgZ[ZT8IC)IRXjZXWVRQPJ8KPNLKPP^PBXVWjPAUWZ^ka`eak^\n{cINRUdK-LUrkZ^BCI-8KP^P>UhUTPJJINLZLLLLLNNKLNPQRVUUXXXWXXVUVVTcWTVWW[[[W\4оџзиммоооммомнмлщмЯмыаоэнммллмъЬъммххммцлмнмнммЯыпмоммлбмцнонЭ —ЩˆЁ—ЇОЅЄЭPPKNNKPLNLLPPLPKPNNNPKIJJKKIJKKKKKKKWHIJJIHFKKJLKLяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџrVTRQPPPNLLKIJKLLKKJJIKLJIJKIJKVIJILLJKLLKKKLNNLLNNC­ъЯфщмийстљЬзџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџЈ!Vfhdacaaaa`_`ca__`_^__^^\^^^_\^h^jULE><=<;;88<=FPW\i_Uh„“ZZTJB)NWjdUKE-FUix„^HQQLHC@AEEA=>=>=>@3KXcr‹oCT^P53HKQVVWZ^o^XN0KReTQRNAV_gЂЏe8BRTUTUUQRNLWIEBA=;65;86224;2JVFjРоy/!/#302/!3'Z^kšŸšЉ™ˆ‹Œ…š›Z/-30Wыџџz=K=<<;<;44;=<<AABCABBAA>>>>=>>ABFIHHJIKNNPhWg_K/EZa[XWXVT\LI8KPQQQNPNPTQQtcVgQ6VXI^cdtdc^^na'CNRUmN8^o3LI*0oa&;LQQPRUcWQLIKJNKNLNKNPKNLLLQ_UWWWVUXXWVWWTWXWWWVWe[WXZW)ѓјымнлнхмхооныоммммомъмоъмлнмооцбмгчнпъолыоцонооспгцвмоонмпщРА Р’­ЏЈП™ЃХŒP[NKLKPP[PPPNLKLPNLNLKJIKKJIJJKJJHKLKLHIJIJHIKKKKLюџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџrVRRPQQPPPJKJKKNKKIJKKLNIJLLJIIIJVJKLLLLLKLNKLLKLLPCБпЯчнлШлытсЬЧџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ№џџџџџџџџџџџџџџџџџџџџџџўџџџхAvhd`^adc``a_a_a__`^^_^_^\`_^__\^\aNC@<<<><;;<>EPU[__Ufxxe\TNE'@JPhdK0&8V_v|^Q\aPI4BBFIHB><;=<>B;U_z˜aLVVV^N4BHLPUWX\_`gWP8HZPP@BZ`w“c6TQTVVTT\LKnHBB@=<886356634*5R\L|џТJ3/-!83#%C`vŒ–‰š›–ƒ…‡•|{xvW64%-Bзџџ”8;-%ELTEKE\иёс‘f5/>NH4@=<8;;6865666555C334342323344454668;888;;>I;<<<><<=<884656654332//*'&&%#%&'')'/8H_Z[^^VI<&!#!#&#%%#&&'&&)'&''')')))&&&%&&#&'*&')))')))-!#8>B<@W^|ХЏ|hT_^X=PТџјћџѓыголхљвЬоЯоаЮыО–Є™’h–›Є—ГЮЮЯšсјџџо}*АсtPCN>!jŸЬРЌЉЂСчыпоЬодфёљлаїыђ668;;;;=C4ZЛQXeLC0BCBBBBA>@>>==<>>ACBFIFHHJLK=WXWafKEIQgeXZVTNLHFN[PPRQRPPPR_TAVTUjT6Wn^^cdeo`tk&CNRU_P;LJF/PwmvƒZ/INPPQTWZWQP;KLLNJKLKLLNLLLPQVgVUVVVZXZVVXWZUcVTVeWWVZZXCџђмнъблвнноЩмбнлфмъаопЯнмлноопнммъцчЭооЬооонспгопоччъосымчцƒДЫАЧЅЈЈЈ™ЂО}NPNLNLNNNPLNLLKNKKKLIIKKLJJLKKKKHILLKJJHJJVJJKKINLюџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџuUTRQQPNNNLKKKJ_LIKILKKKL^JKHIVJHJJKJLNLLKKKKNPKNNNCЖфЭфхмлмссыЮЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџѓџџџџџџџџџџџџџџџџџџў§§џџў46hgfea`_aca```aa_`_^^^^`^__^`\i_\\kQF@@;<===8<>FPV\_^V^‡|e^VPJ=;=CIJHC&8V`g^B!HKJICHKNNJE>=;<<2;T^f‰dBCXWVT`JCBFKPTWW\_o\_J-AKKPZ`jЇ”P>;;<55654456;0JVP[Јхw;5)'4F2/<;8;8866866686854465454442222424N4858688;8;;88<8<=<=;6464444554330/*)&'&#!!#''&&/8JUX^_\aK<&!!!%&##&&&&'')'&''&''&&%&##&%&'))))'')')))---0!5*CH5F^tАО’jLCPBVяџџыпђдОэъоъ№фУиЮтЛȍ‡zƒˆ œЖПбЏаэёзўџџ}8‡м>@AC\ХЂ­ЈДлщслцѓтппымБжЧЗ‚#8888<8;;28>|–`NXQ83BBEABB>@A>=>=;=@ABCHIIHJJLP<_aUW_PKNQWiaRPLIFHNPQQRQPPPQNQfTBUUWWU4V\[`apexm<='A8`Q`nL6E4Pfrfgk…E!8JPQQTchWRNJKKLLLNPPNLKKNLPQVTUUWVWXXWWVVXWVTW[eWTTXUX@ЄџёлыомнъоонхмналмъоооцнблмцоооноЬнмонцномпсппоопооооЮсывёп’ООВ­Є˜ЄОЉЄЂзLPNNNNNNPPNNNLLLNJJJJLLIJJKLJJKKIILJJWKLJIIFJLKKLNюџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџeWQQPNPPPKLLKKKNLKLIKKLcNK<<=<==><<>CLTZ_`QjЂ X^XTLA;;68;*=@6U`ivaI=0%BHFHNa^PKHB=;@0Ia_tv_ATVWWTRQKHA2FKPoWWZ^fh^=)PZUoДw=CTT^QPLJEA>=<;888665853388<4N\Q{њГX%)/NWwŽŠŒЁ‹‘Ž“ƒpz‡|„}og8!;)2ЈџџБ4Rnfgjjmmhghimts‚Œ|‡|}{|}{{Š‹‡‡…zx„qsjP-=RIKFhЂЮџыR*/A64@-<8;;<8;686686666665644545343322222254468586688;888;;<<>J6553333443320/-)''&!!!&*'*0;Ie\\jikJ<&%!#!#!!!%#&%%%&&%'&'''')&&&#&%%'&&))')-)*)***-*/-/-!!'>F<>^v“С—oN=JLДјџЬЯУэомѓиЖЮымЪБœЄЄ‘Žx’’ЉЫМУЮгД№ёоџџџ„2МС8N@!'d‘ГЇСЧоЧчјсчЮсгЧАД•Є‚/'856;88<>>BBACEIIHFLLQ>A`cWaTAUUVQLKFIIIKLPPQQQTQPQQUW_APVVgC8c\^`nˆfARCE[8IPTa^;Ps_det|z„U-FL\^PQWXRQNIJJJLLKLNNZLLLNQUVVVVVZWVUWWcUUVWXX[VUVUUW[/ЬџсмомннпонлныбномлоцноноомочэнлъооогпннонсспоппппончсолђШ“ЉТВ­šЄЄ™ИВЅЪ|PNNKNLPPPPLNNLZNNJLJKJKKJKKJLILKLLKIHJIIKKIIFJJLLLэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџbUTRPaPPNKKLcLJKKLKJJJKLKJJ›KWIJJKKIJLJKJKLKNPPPNPLAИсЯцчлзйоъяСЫџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўќџџАLfea``d``a_`c_`__`^^^_^````^\^^[ZZRJA===<;;;;866866*CQ^}ОhIJPKB*AILPRURPIC@>A5V_v^VTVXXUUPLJIH&2EKRRUXZaLB!-Led…ЈjEEPPZXIFB><=<88<85#45568556-FUPTƒЯА/80)AWsx|…qvz|•‘‹ttƒ“{zyxtphN'63vџџм=#Taaeefhkjkijkoosszy}}o€|{zz{xr{vP<;3IBJR™йџџf>3;<4*<;6885688;;66866688658654455353332333402233556686866;;8<<<>>8562243433420--A&%&#!!#&L*)08IU\^_^hK='%#!!!!#%!!%!#%#&%&&%&)&&'#%%&%%%&&))*'**)-*)***--*-//0/#8@48;TyвЧАXFKI-0ДћџыяымфчвКЦящ№ЉЏЖ–s—ЂУИдТхРляпяўћџщ[LжЩrALR*!ЛВИоЬЧїсѓЧтС—Џi}ˆh!'86;888;;&EJ=^[X\33CB@@AABAA@>@=@>@ABCFFILPN[>PhWfdVBdPJHC2ILJJJNLPQRPRURQTRfR5RUUpQ8i^xmgBK[\AU@JJtUhR8exa`Vzjni—B#IN\QQUXXVPKILKKLLLPNPLLLLQQTUVVHiVVUUVVUTVWWWWWVVVVWiX-ѕџлммцоомоллнппообмоЯныьочнаоомоопынцопопдпсспоооомопснзмЂЯРЏЙЅЂЅЈЧЈ™ЭˆPPNNPKKLLNNNKKNNNNKJKIILJJLJJLLJIKJHJJJKKNJ\HKKNLKяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџbTRQPPPPPLJKJLLKKKLKJLJKKIK<<<<=AIPX\^`XnЈkIWRTQF*868;;)&PgeŒ}gxy[TPH3FcT``TPHB=-Ia_v€_HPRUUURPNKJNZNE3ELP_WeNH-'P[U|ЋfAQZ^FEB@-=;<;<;<8;;;854<88#)JXReЮЧQ#=Z\mp|{kpvz‹€€rsozzyzR485*^щџѕCXgfdeih{i^\poqpszxz|}pˆ€‘‚}z‘‚gQ46;BCFvЯоџЙc<0/-C0<;88866565688;856868666666566554434532222202343466666;66;<;;<<52420225<8/-/*'%#%##&*P/)*6Tdd^^gaJP&%!!###!%%%##%##%&%'#&&%&&&&%%%%&&'*))*/))***--*--*/--*///0%-E##8ЬнЂaAWN)qЏьў§зхоЭЮогџЦЂЏЄЌ…zˆn– МГКСмщопопсџѓўџmaЯЩ\ETI)ˆСлЮОУњљцуЦˆ”Œrv|as=;;688;;8=BF5Vq\ZTK0A@@=@BB>@>>>@><@AFFFHJNPNPQP[pXXW=>>;<><<@IPW^_`W{‘TWERR^K)8;;8<2Pfczf`c|c_fXPH2HfVURLIA2H`^y}^RNPPTT^LLJLPQ_dZ42HLZ[ZH*R_g„ŠaTKHCA@@=<=;8>=<<=<<;=8;;<;=BLZPˆЦЏJ0L\_afhhpssz{€‘™Ÿ”w}|myz„xwƒjeB@;/AХџџj>fzmjijioqp{p„xz|‡z{}‚‚€ƒ€yŒˆg>/)=6=aЏџјсo0-2<5/<8&886866664655688;68868866854566454464C443332024345555886868;68<<6H8452//@•[2)*)')')-20F3*)*3P`f`jgkJI''&!#!#!#>>@@L<*@CCBHLNLPNQPE‚ZVhfK54__PPLLKLKJLPQRUTUUWVVXV6RRVgTAaB_UhWV[‚{LAI\T`R'ftcegxjm{z65INPRTcWWTN8LLNNNNPPZLPKNPPTVXWZVVUVXWTWcXXXZXWWWVTWXXJšџхоммцмохннносммоомцнсосоымнопщносномомыппсоппѓпннощнсз™ЗШВЙЅŒЇЋЊЉЈв}NNNNPPPZLNNPPNLNNNKKKIKJJKKLKJLIJLJLLKKJJLKLILKLLNэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџYFQRPPPPNNPLNNKJJKKJKKKLK^KLJKJIKIHJIJLLJJLLNKNPPPPEЛщвстЧйЯсхьЬнџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџfWqfcadaaa_^`_^^_^\^```^`^\^^__^^^hQHA>@>=<<==@FQW\^^d{j_FTT_R^PE<6==-N\e‡mXCZj\\h^dTK&Iem\KI4;U^v…_Q=KLPPNNKJLPQTUWTK/0ABBEH5T_gЇ•^4*A>>===;==<<=@>>>>>>@<;==2HTL[Ѕбw2=[^`cefiotzˆ‹‘m€‡”Ÿ™nkvwtv‰|pE3840yџџ‘6deznqnnoo€ttxz{‡|€‰€Œ”’„‚€Š‡“ЈmH-*3=5L™№џч”5!63*B>)8668666665645535665865556666568545455454455433002322332466666685423!;;;42//#@>@A@@@@AA>AECAFIKNNPPPPCUWUZe=ILPPPNKKLJJLLNQRTTaWTW[iU=TTUgQ@JdhXTUWeWK3LRTiQ)hnerijkjxq)4JPQRTWiVPL;LPNKLNKLPKPLLPPTTVXXVUWXVVVUWXVWZZWWVTVWZZ;пџьхмцомммощсоыммогнопмпоопопсщоссоонцннвщогноооыпсооэхЂИЧВЊ–•ПЌГЈЈЬ}[NNKKPLLNPNLNNLNNKJLKKKIKLKLKKKKJKKLJHJKKKHJKKLKKLюџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ^cRPPPPPPPLNKLHKLJIILLLKJLJJKJJIIIHHHKLKJKPNNP[LPPPEУъдъхйзм№хѕАеџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџВQdgc``ccacaa`j^^_`_^_^^__^_`___\^[TJA@>>=;<<<=BPVf_^T[œPJRRUTTUPF<;<-Jed‚V;KVkZWXh^eRI2FWWIEJU^ƒŒ_CJFILLJJIILPRUVVVU^W#%;*3KW_m“nPCI->@;;<>;<=>=<>A=@@AAA/BBEKWKnЛЏ^3JZ^cdfimmryy}‰€“€€‘“tpnr^336-iўџО48`fhvmpqsqoorvyyˆ‹o‚„ƒ}‹vƒ„‚|€iB%/@5;yТџџРH<2&-)<8865;86455545544454545655866466686685465545443333323223334556565543#8&%'#%'*!A)**)AF5H200'3%A!&!&#*&*'##!#!##!#####!##!#%%&'&))*)*//-)))-**---*----0-/JЖ™œ”œ˜”'0xпмЂA5HEЗп№щсббзЧ“ЙЏ‰Ž‡nˆ{›ЃЏЄоЭмдзіђтяыяўџџЂ;ЂпvFTJ‡ЄлЁ™‚s^XyUWmz›Јˆ=8;;;;;;;/EJRŽ^KddJ3@=>>A@@@@AB@ABABCEFKNLPPQRARqXZfNKLPPPNPPKJJKNPQTUVVZXX\ZU5QR`eZFEKdgTTUTQNI%Jf5@TUeRBrsaVevƒj…[0HLPRTTdXRPNKLLNLJNLKLPLL[PP`kVXWVVWVVVVTVXZXWWWVTVFXZZџђммонппппсппщоочоыпннмпнђбнсоопьсчнныыощонмсщснооонэЪ‚СЙДЏ™ЃД˜Й—ВР|PPNLNNLPNNPNPKNLKJLIKJIIKKIIJKKKJJKKIKKJLKJKKKLLKPэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџYVTQPNPPPLLPKLJIKKJKJLKKILKJJJIJKKKIJJJJINNLKNKNNPPEШьдяолиЯэхђŸЧџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўџџщ&=dfdcdadddda^__\___^^_k`^^^^_a`^_f`KB@>>=<<<=@AIRX\``d‡‡V\WRTTVUT_E><@Jca€[3FPadVWXhmXTJ*!EC6Tg`rhR;FFFJKHIIKPTTUWWWWe\['%)IWcpЂP;;NH*=@=<=>@>>@=@A@B'-@cdKAXW|Ы“>;C^_cfikz|wx{‰‰}}n`xvs‡zc>5<2AЦџћJ#Edqgjkoqqrttthy}‡–€ƒ„„s€€‹‹”Ž‚h@*68/Bыџјz)4JVQ4*86;86666656456654544454545666565555456556444444444433333233!#&8%%&'-!>@BEFIJK^LWa_`aaadia^cTVcid€Тhn…maaaQPNIFCA>8&!%-&''#!##!#!!#%####&%&&#%&))------**)**)--*--**////0rЩЏЗЄВˆ›П‡Ї_#Uлёвe5HN&иљзоєБЖБЇŽ–Žqx|—ЏŽЋЫаЯКсмптцыппђџсq_мГBA_EJƒ‚sha`dT[yƒ{ВоЊ;<<;;<;<<=CHQo’K\WN4>>=>@>>@@@@BCFBEEEIKP`PQ^RPRcZZf@8ZPPNNPNPLJJJPRUVZZZZZ[dVNPTVfQ;8QRRTTPLH;Rryw-NPRe88xmaahjijˆJ3HK[QQUhcUQLJXKLNNKKNNPPLNN_TTWXWhUVVVUWXWUVWVVXXVVcWZ[_џ№мцосщспещосепппепсооппоеяпдоесппоопсжтспсттоосппоэж‘вКЖ­Ѕ™ДЊДЊЋЯPNPLLKLNNNNPNNNKLKKJIJJKLJLKKKKKKIJJLKKIJKJJLKKNKJэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџYHRQPNNNPNLKLLIJLKJKKJIKJKJKKIIJKKJJKJKLNNLNNKLPNPPFЙодфъолмсујЦвџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџC8fdcedcdcd`aa_`^`^_`_^^^__^^^aa^^^XPCA@@=>>==-BJ^X\^_diyd\WTVVUVURLC>@8V^f„\QI2CJLdVVW[^gcZ>IT^mkWPJCBBEFFFHKPQ`WVUWWTQRXHBHUWŠРpCkЖ^WQF@&>=>@==>@@A24F\}zTU^[…Щq8A^iaagvopptz}—’€q|zˆ€sqzmqP2>84‡њџsI`dgijz€srtxƒzƒ{Ž‘”„‘–Ž€€„Ž}‰œ‹h4286P­џџТP)^^\Z^F*8;8;8668566665544334345454686546664855555655564444454#5!'=)AEHIJWNZ[ad__`fWXZ[[[Z[\\[[[f[[\jefeIN^\\\^^eXcigfsFC[BCCA=8##!!!%&%!!!%!&%%&''%')/-/---*'-**-*--*----///ДіЯЈ›ЉЏ‡­iKˆЏЖ W жДЇ@6KALЉляйгВЖА‘‹fˆŠe”ЃУДЈлфЯШ№§эпођсџќсо\dл–BT^2kˆ|fQP^Uk\‚Ђйлм‚<;;;<<;=;<>FAs{x[oPF@>>A>A@>B@CFECACBFJKPNNQP^ACkXWaP8NNPPPLPLJJJNPTVWX[Z\^ZmaJ[Ta`NAogPPPJH5Re_ap\6NRR_8Hra`TgikkB*HKNPPTZWVP>>@>@AIQc\^_ciscZIUUUWWWTNFA@HU^pp\RKHFAAFKPUXX[gkP@&0^^o”hQIA@BECFFELPQWVVWVU`TN[LJNWUoл‚>Pg˜afXTKA->=<=*0)%&E^zБЂ€^=LHm­ЄR>KXZ`adhypsxz}srˆ‡|{zxsqoh`>3E/LжџВ33v‚gixonpsxx{{{‹n{|‚”–„‚–‚{Ž‰jT34=;^ЯџџЉ*#I``aj^f`K=88<;88685586654563455554544645544455K5656858565668&!03CIKNPRVXcWZ[X[\\n^n\^pqvgyqvpptojktxoti‚rqyzqqnmorhnn\Z[jigi_gmcd`ZP>*n##2#&&%%###&%%%&%'-**/---)')*)-******---00оџџлҘ‰ОГ‹`W{€ЌЪОQ!8хѕЉU0PB%BО№нЛГМЈŸ•‘s‰{Œ˜­–ДВбЮУХїѓоУмэ№їзчЦД<4˜ЌjE^[4;[\[Z^fm‘ЏАЙРсф<<<;;<<;;<>E8U‘^KW^I/@>>@AAAAFQECEFEEEKKJNPPRRNQWZXkR2N`LNNZNNKKKLPUcWX^[[iL@FPTWfAshNJHH5RXpj^_sn6PT`h4Xiaachhktz//ILNPQWdXTPKLPNPPPNLLNPPNPPRUVVXdVUWXVWWVaTaVWVWWZZWX[>тџфомонпосспсппспппьствожтссссс№ощоэсттѕссссъщпооняг‡лЦЄ­™Є™­ВВ зNPNNNPNNPNNPNNPJKWLKJJHKKJJJJJKLIJKJKJIILJKJKJKLKNэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџYVTRPNPPNNPNKLJKLLLLKIJJJKKXKHJIJIKJJKKLLLKKLNNLLPNBОуныплиЮыуъЩЯџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўўўџџУEcRaaadn`aa`_``^```_^_^`_```_a_\^dRFB==@<<=>>AFPW[^_czœf[WUVWUWXULC@06Q^|ЄiQHCACCA3HKPTVXcdI%CQ\apRIB@@AAABHHLTUVZXVVUQLLK=PZd­g<=[t^K\\d_NC>>@/''WqŒŒ…{PBJRqЧЃL5F[\\`dghpswzˆ‘’ƒokvxvtzyK48C;Ђџ§^)Icsinm€rrrˆ{‡ˆ|mziz…„s€ƒ„Šy€iU*!435‰ѓџъx'N`cwed^\fVKA;88;;;8;58856565444543646446455354456555586)*)-33JLRUWZ^`dcdonqjwn€pvy€omdihWWWW`_R^R\QTTQRPQTTT^T_fVWW[XZjjswx‡t|ym\\^^\ecgn_mdJ^P60'%*)*&%''''))***---))****)*'))**-/Fѓазіјп˜ЮА}m`ior‹гИ՘K&ВќЯk4>J/'ДххЯЦЉЄ›‚–ˆZƒГЂЋЗгиДГџсоЭлѓомщЙСни„QЩЈWI[H58V\I`€ЅОеТЯЮЯфh)><<;;<<8;;>@@@CCCBBFHCFEIFIZNNRPQPPad[kQ8LPLKKNKNLKKPPVWZ\kzK=2IQTWc@@IF0'RikXZi^arX5RRVT-eo^Pdghjˆˆ&5JKPQUXZWRP=ZLNPPNNKZNPNPPPTVUVWWWZZWZZXVTTUVUrWXW[[X[5џњлхоыосщоопппсесогпссщсэъгьтстпсспэтогсспъоссэсщљЬ—ЧЗГЫЈЈ™ОПВЏЫPLNLNNKNNPPPPPNLJKJIIILJNLKLJKXLKJWJJIHHHJJKJJJKLLэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџkTRRPLPNNLNLKKKLIKJKJKJKKKKJLJJKJJKJJKKKKKKKPNNNPPP;!Чфмнэомлпсѕдвџџџџџџџџџџџџџјџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџ!5fc`acc`aaa_``_`_^_^`^^_a_`_`___\[TJB@>>>>>>>BFPUX^`Uhni^WTUVUUWV\HB04Pfap`R8ABACI^60EJPTgPH0*Rfa}^TKCAA@BCBAFLPUVWXWUQPIEF6PZd™d8-KTj[VWZ\ZTLEAHTg„z”Š–œmE8PPoИq4@WZ[\jTgknaˆz‡”ƒ€}‰‡qsrpj`B5N0gѓџЁPdpg{mnorvtyz‡{ˆ|”Œ|{m…œ”ƒЏ–—„Q*060C‹ћџб[6Pnanccca_[XUZ3<;;;;68888;8;;6566553465645565555456#6'*/-0FLPTX[`cWgy|œЄЄЂ”…rpncU_RPPQPNKJJIIHHECBA==AH22FC)&<);&>3H;LBQP=@NNPQTfaWqmt}vpm^y`[dfFjAA#8<'!'&&))-)*---****)*')**-)***/wїщСПзъЬхЄnx{{hzoАЋЮхмrz№я‹=@N6ŒйхзООx…š_‰”ЊЄБалуШщоуЮЭлмЯпсоезЯЌC'РkIKXC3Vns’АЉЊзийхЧом2=<<<<<<<<'@ACCABEHHFFCFIWNPPPRRN6jWWkR-KJJNLNPZLLLQRVZeoK')ACHJPTgVN6C3Ti\\ZX^`m_[W=RReT)^y`Qadh[q08KKPRUWdVTPKKKPNKPNKLNNPNPRaXXVZXXWVVXXhVWWcWVVU[\[XeNzџхЮоосспссоопъссътсссзсссЯспттстпопопттфуЭэустпоіЮŸЛЙЖВЋ”ŸАВБЗиPNKNLLNPPNPLPNLKNKJHJKKKKJKJKKKKLJIHJKJHJJJJKKLKLKэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ^URRPPLNPNPNPKKLKLKJJJKLKLaKKJJIIJKKKLLKLJKLNPNPPPP>LЮзбмчнллпхђЪвџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўќџџ^0Zgdddca`adcT`c`_``_^^_^j``_^^_\^fVPC@@@@>><@@ENVZ\_dh–aXTTUVVWUPIBA0PZmŒjRH2>BCHPdf/4FI^\23-T\atoQ8EBBA@ACCCFNQVVUU^NNIE/3Q[aˆЙaA'/FKTWXVW[kdUN3K…‰ww€€gCJIh™Рj@B[Z\_^aczypqvz}‰™€{zepz‡z^)A>BЇџџF5Neihjpqcq^w‰xy|}|{ˆ}|{}Žp‚…‡Ђ{nC&8;4>ЂџџЙ8>`eŽVdca`aiZWV\H>=<8<;;;8<<86665545455455566F8556&)-*/HJRVW[`cft‹ВВЋšŠec\XVTPLKFC>>;88'8<<<'&&65#0!!5[A>A=/*&%'0%;0K[TaJFB<>ABFIWNNQT`aj}wyy…o03`qgxaV\>)!%/----**)-)'*)')')*)2#Ё№єќ§л›ЬЌ Ÿzknnof{  ЈЬ§еœ-Uях–H@K8#‰флпГŽ‘‰z”…ЈВДлзњаиЮчнчЮцсЮгДЛПzg<%=ЈСfP\T0\s­ЉПРЧРйЯИнлє2>>><<=<<<;=>HgXsWegQFBC>>AB@CEFEHHIHHHIIL[NQR^PPTcWgR6JLXKPPPKNLPPR`mL!CF85C3LcUae<'\mn^^hI[`aa^oA=PR_TзџмцммпъъъооссяутуутэтсстщспясъсстпссыуфуусзттЮоэЮ‘ЬзЌС­ЈДۘЌЋиsPLLNLZNPPNNPNLLLNLKKJLJKJIKKLKKJNNJJKI^HKJIJLJJLJLэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџQVRRPNKNPKPPNPNJJKKKKKJKIJKJJJJKKKJKKLJJJKKKNNL`PPP>#ЧмЧчыолмсьыеЯџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџўўџџЂPedecdeccapedc`^^^`j^_^^_^^`_^^gWP6B@@@>>>=>CLUX\`ag|‡UZTQTWZXW^JC@&LX_ezWJBA>BINUeih5-/>>0ERgeeVK0)BCBA@ACHHL^Ue^NIFFCC6P\a‚—dHIB@@EKP_VWZ\\ZeN-){ˆtsr|d5BPjЂЈRCX\^\[kaafj^ƒxxzyzk{}ˆzzvpkx`62=>PХџd/#I`ffnnmrwvˆx„‡|‡‡z{}|||Ÿ‹Ž|ЅyA#65*KЏџџЄ5P[^‹dWzf``c___XVQ^N->>==;88;<;;;86666565485556568)'0CHNRV\`Xjnˆ”ГЄŠЁthcFACRLJECA=;5#'%%!#))%03340/22//-&'I<6PE*%!*3<06NRRJC<%#!&8;yлэБЖ‘Šˆ‹}ЁЈЊабълзЮъолЫзгЭЯГЋŒnnZ2gЋ˜J\X@'–ТмфЭяЯйЯсЪфѓE>==>=>===;;/EJPjZVggI3A>AABCBEHIIJIIHHIILNPNPQQBVUVf^JIJLNPPNNPL>P_I*I[f>tЯd8KRUjg3^e__^i\^P`t`h{Q==@BHQW\`aVz…dLURVXVXc_KC@BIV^rzXLEBBAIPTZ^^fm4&&)2NZU}…P;LI2)@BBBBEHJNPPPLFCEEB4RZdŒ_F6ECBAAFKPQUVW[ZeUP/5rˆyICKH^О‹P;WX\[\_afhmpwzzwƒ„{„jtr‚jnL4=HAЂџЊA4`orvoqsvwyzz}}zz„|ˆˆ{z{ŽŽ€kN&64&JДџџЄ6&L^``QdcPca``^_^^ZVRRrE>>A><<<>;;;;;888688655668;)-EIPTXLR[^‰ЁЌКЏ’sfQJIRPJIE0>%5!##))#!!#%*@453-/-//*-&)#HZ4LJ*#!!)3=IPTTRKB><><><<=<*BJPUZXZeK0@>>CBCCFJHKKJLJHIJKKLPP^QPTVUaQ2JIKKLLPQP_WE0J\VqXPw\CJ^VVT*cn`^_`aa^_\^[f_дхдъвнмосфјбЩџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўџќџџK*Xfdadccac``ceda`__^^^_a``^^_^_`^\TIBA@@L<>@=@FP`Z^`af|g[TRTXWVXVPHCA/W_svZPFAAAFNV[\oo^aX@)KZc}„gtgTQNB/>BBBCFIJJHFECFCE8P\eŸš^E;CCECE33EKP^VWWZf\WP/„tJAPU‚ЄˆI8XZX[\kxhˆsxyzmyzzkzx‡trWwg^<0K=WЪџ‹5Laet^`svwyz{z}€}{‡zwwz}{zn{‡vziJ*-68Йџџ™#'P_jqc`^^mca``_^_i^\XVQaJ@@@@><><<<;;;<;8668<;)--4INW[^BRp‹БЬОЅ}fULJQHH#zИМ—{Š‘БЅВОЧЯыысс№здщУЧŸqV_\X[W/*`vP\E0Съ№хсейлым§Л2@>=;<<;;;<<)@FLfsZZiN5ABBBBBEFIKKLLJKIIIJLNPRTRNQUWsdAA=@>@EJUX\^_d{g^VQTVXVXVQFA2FTi}„\THB0CELUZh^^^[VZI3HXcŠŽev_[c_PF0>AEEFCBBAAABBBHPZ`}œ`E;EC2HJZN5B4JNTXXW\^iaF'@>PW’Оm4HZ[ZZ[^Ph^tƒ‹Žqk{‹…rqrzho^@AHEџИA@`cfsmzrvx{|‡ˆ‘zz‡tvez|{ŠohN4)K-EЪџџœ')_aaa``_am__``^`_^^^^\\VTQHAAAA@>=<;>;;;;<8;8*#48NTZFIKp•Гсй™nV@8TAJ6B0-<'54430-/-)''#%%#%%!*0>0*-/---*'&*5A<E82-'4BPV[fiQE;/')**))*))')*&''')'))&!!6@FJPRWjџКzn`Q^Zoe`IA<&)))-&_џ№јхцйщњѕчйЗЪЩзЯЫ’ЗPЙЮn‡Є’ГЪЛЯмѓмqxј Z>`=&xЅЄˆo”ŸЈЧЊЦЮххђєгммТЉ•jwmf^JX^^XJ30€Дc^^5zчіпйн№нлєьоA>>><;=;;<<;;-RNV{[Za\6A@ACCE2BJJKKLLNLJJJJNPQRQ@TVUhR<8IKLP_^EBLRgXXWWdWPTINTUaU4U\\^PcdkP_E_nt5LQVe'aVZLZPcc{t&FJKPQUZXVPKJLLNLNPLPNLKNNNQVZZ[WWXjWXXWXZXXVWVZZX[[[\)џјосутптпттсссуфуфуффутсеяуфсифязсхыххтстууъсёмšЮОЉБЋЉЛБГВБфfPPLPPPNPPNPPLPKLLKJJIWJIIKWIJWHLJKJKJIJHFJKHJKNNNNџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџRVRTPPPLLPNNLKLKIJJJIKIIHKKLLKJKJJJIJKLNKLNPLKNLNPRK#Угвтмннпст№Ьпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџжJdeedcccacaaaa`dddc``^_\``^^j``_hZQFBA>=>>>>@BKTX\^^ag‰mXRQWWZXaRIBACP\c€kEP52BHKV\__^^XTPJ8=a_sЏaKP^ZZf[VNH@@CFEBA@AABCB6P[c{‚PFJ4;8NRif^`F3EJ\iVX[fjc0#P\e‰˜hEJX[XX^^cginvy€ŠЈy`tqqztdB>=@>><<=/A2IPVQ;Na˜ЬтЭЏnRI4EPIE@=;'8558432///*-'''%!&%#%!%)*-00----')''-5V\%=L5I')5B\X\\ZTI=/')))'))))''*'))&''')'*)'%)*!!cILF`>\‚‰š”ePINZfeKA*0#ћъїхучфхЧлхоаЦопаИœ‘Жqs‘ЂЂЉВИЛВОЧсѓv€э›U2IB)<Зƒ’pЫЁМХУжхэУдЧЙ‹ŠVkgcZW\``adf)*c˜e_Q@6уџџлчонѕяђУ3A><<<<<;<;88*CKUhWZkRF/AACCABFVKLLLKLKLJJLPQRPQPRWWgd68JXLUB)/XTZ\[XZiUPKFam)NTTgQ@Zzj^_cwa^CxCfV<>=>@IRZh__azraXTQTWWXWRJEA'KXkƒ^JTZHCHLTZi_^_\VNK8=V_g`8PhjZXZ[eaPIA@CEAAAPABB3P[d‘ˆ[E;/2VstjXXVTaH'4JP_Vc`PFCQ\r•ŸNBHZZZZ[^`fwzs‚zŒ}g|Œzwvsx^AJKQvјдJ8P`rmxki\rxy”™Ё}{z…|hvrrorqpot`4&@&)ЗџџЂ!2ch‰xwfdaa_a`efgrehggfdepdc`[T[FBABAAA@AAA/@4I>QLLE`}Њћ№ЬtU/A<>830')6%645534320/-*)'&'&&#!#&!!!#*0--00--*)&)0NNPBa!!J/#!*4HRZ^\feJ>0))**'*))')'))'&''&))'**#&'**--#0BFPTWi|ЈЊ˜eJc_Za^H0'PџџѓчяђёхьомучьзжгЮёˆЩ“в˜‹yz•œŒСЯОЮСУяьсЂvсЏQ=RFI‚‘|ВЈДЬдхРъСЫЉ[gdE[[^ehio{ЉV%dЄd_^џџфытсчЮяџ3>=;<<;;;<868;EJL`XfhcIECAA==BHIKJKNKKJKJJLKP^RgARVUgd@A><>>AFNW\`cdg|vLTQTWZVX_KECCJV^zkVT\K6HLRW^_^iZXTLI6T^qa>8QVWUVe\fc^I3@BAABEBBFPZcz’\A4PWv|r`ZURTRU^<)EHZ\\K58U^dЂ„`BXk[XWW\`dhnx{“aƒyzzysˆdN4BHB‰еw80N`sqinp{qpx{|{„zvvxwwron}w`>)8-!‰џџЮ%*`frhmk{hWfgdefitkwjjnŒjjtggf`^ZRJBBCBBBA@B2H>F\PKXзјяЈg@35AJF2-;65544643333200-*))&&&%&%&!!##)--////-**)&'/8AAPF!0I'#!)6ERX[\[VI@/))*-'-))))')'%)'''')**)#)))****)*)%#'>FJNBXpŽДДVK^X`Q6…щџџёјчъыЮщЮЯѕяяџеМЊТЏИ”ˆvrŽЅ‹ЈдПЫвЌхяЩхъ—Дѓ—JTQ;&=‘ЈŠДЗОжЏаДЄŠt›–JdcKP_Porsx™Ї0I˜eL\K*ђўџпсоиЦџў3<<<<<<888568'@IPgfWZeJ4CA'A/CHKJJLLNLKJJLKPPNR^=TTWcU=H@@KRZfZW\XWNJJ;Xp^^^X=NTXjCF[i^^^^k^\d@PyC@PRgUFrZZV\_``-;HLNQUZ[gRLJLPPLPLLLLNLPPQQVTVWZWWUUWUWkXWWHiUXXW[\W[-іњяхуусуттухёхтфху№футутсйхххуузхьфтуутсуутяо’жРОГЏЏБДДБ яi#PQPPNPNKPPNNPNPLLXLIJKKKFJJKIKJIKJIIHIEIUIJIIJKLLLџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџNURRPPNLNKKLKIIIJKKKKJJJKKJKKIIIJIJHIJKNLPPPLNPNLNL>ЭоасмлймсухгуџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўџџЫNegfcccdadcaa`````am_^_^_`_^^`ji\c\EA=@=>>>>>FLRZ__cg…i^VQRcX[XUNHCC5V[mtWQPLI8LRX^_j_[WQNJQg^zcm^WQQTVWfv<&BCCFC4Pcerhijmjigjjfsihjmonomomnmijjf`[WNJCCAAB55NFFHImЇЮія–K543LpЂД™”iVQPE%ѓџѕјинялзилЬъъдЬЊЊАЧŽˆra’А˜ЁИлРбТШмЧслђђ’)ŸУ“BK^;)R–ЊЙЗГнМЋ‘wnЁƒmcacVjqxk{qƒˆКМp!cƒJPPЮџџњяйздћы2<;=<;;6886668>IPa‚WceJECAA)CFIKKLKKLKKJJJILNPRTPQVWkUH<@><@BEKT[^`ac‰aWRTVXZWgPIE36R\‡w\TPI4HPTXg^__[WQPN6Q\dВ‚AXfJ3AFLQRVVZ\hkaPC>@ABEP[cššJA;C^adgkmp`hƒz‰yyyƒzrƒ…sqp`m}tN2>8#cчџџCRUfhZgi|nkmnimjhixkmkpqtrpmpqrqnie`kRICF6;NHFIBdЏсѓЯx8/-<>F3/*;<<66855544452230/-/'')'&&%%&&!!&'))//---**&)3Rz&#[/!/5F^Z^^^`I>-'*****B)*)&!!%&))'**)3!'--------*--)-*-)*0!!##054AaˆЁРЂn=UJ=XсијђџСЦъЧпэнџШКЃоЫЁj[‰–”РЦМЪУЦЩдбЙејў“2мДsFTN0V­ЃЂОЂ—…i`j[ccahay‚‰”‡…|ОаВ>Џ…N^*џџљолжлџџ@===<<;886668>==@>>@BHRX^_adgsdZTEWXWZaQKEC5P[a`UQNJJLTX\^_\^XUNP=PXqrwHWV^PFAAHNQQzW[^igf^@)AFPXeŒ‚_=5EIKRWZZTRTQTW[_dh|ŠB0KZazТkFFNI0&QT\^`ejpyzy{zz‡g}mtw[<6LP™щx/%')'))***)))%)!#)))**/3#&*--***-**/**/****)&)*-#&/F<JN''_ЏДŠfƒL_L^cfo……’ŸЄƒ‹xjЗВфыP‡cF\>@ќџ№хлдЯџЗ-><<<;656;;6;<=HJemXXnL6FECCCEIIFJJNNNPNJKJNKL^RPUWXpR5=U[WrWQPL;<_X[Z\^\[[\eT5TUag6f``^i^q`hsWCeZAPTeT*giV@VeXZxV-IKPRTXXWUNIKNPNNKLNZKNQPPRRVXXUXXXVcVWXVXWWTUTVWdXWX3џџьсх№уяяхуфэхцххлхфххцфухххуфёьфхэхцххффђсЃЬвМУЏЏМИИЇВоa!PPNLLKNPPPNPKNNPLLJILNJJLKJ8JJKKWJIIIIJJHJJKJLKLKLџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџHVRRQNPKLJhKJLJIKKIHFHWKHIIKKJHJIJJIIIIKLPNPNKLNLLPCЩщШъомлмссцчяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџЪJfqcaecdca_`aa_^^`_^^_^^````a^\_hXNEB>==@>>ABENV\^aagxc\VTXZXXXTAEHLQQPQPPPRX`cgyz{—N%L[dŽfFhXPLI)3Rsavgnqƒ‘zz|{xwqQ<3NLrлЮF&IX[_diijnsw|Š‹ˆzwwtrn_onha^@0030­џџp4Pogj^k^kookkmonqsqqww‚wtx{zƒ‡wwvr|zzm/5=NF3Z љџу‰@'*A86C3t@=<><;8;;666865544430/--*))&''&%%&&!#'')*--*/*)&&2#!=NKI!*8H^X\^\`J>*#%')))*)**5'''%)*)-**%'-/*--*00--***--**)')''*)*#!!0&'#5ТШЗa0HPBVЙжњмтјђЪзс՘ђХЙ„mk[ŠxЃЛŸ­ТЧЩЧмЪЛздощёfpЛмP6PJ%>‡œˆq^€dJL^e\yˆ‚ЛЬхЈŸ•m‚ЌПВмџСQЃ_\_ЗџџлжПящж&2><=8;<;<<;6683eedccaeeaccaaaa^_^\^_^^^`a`^`^^n[RHBA<=>=<=ACKTZ^^`fsp^VTUdXZd_LFECJW^jpTQNKKKRW[[^\^XVTNK4W^€PVVQPNPPQZ*0F^RVWXZd\A%JV_f›`;E>=@ACFJJJNLNRV\nrjq{|vHR[dŽВLJ[\ZV`TN4*Usvgnq^vwizŒ„ˆ…mc>>>><<=<<<88;6;6543300--*)*&'%'/%#&#%!!%')))**)))#&04EFJ2'#-8I^Z^^\WK>'!#%')))))))#))'#')**<*#&*/---*/*---*-*----))*)))'))*!UU0HЈхё’X4LE%wијџџлђЯЪВлиХ|}xp…ŒЌЌЭзгнДШЩЪЩЪнУЯџл< №ЄIJJ5#CgvT^^g^`^w„ЇЏОУдГЈЊЈzq КИчџтT}k\^6‹џџыЦлдпх@<<;8888;<8;8;-EJPUXXpQ4FHHFHIIFEKLPPNN;LIKKKZ2AI^aXhR>WNLJ6@@BJRW\p`f€z`XREXZX[UPHEE;Ugi^UAPJJNQX[\\^[ZTQPN;V^czdKXVPNPTTVfa53HLTh[dgE!He^wv_>=E>@>@ACEFHJKNPV^asnˆfJF\e—R;RqWXWdifQ;-Xrinr}vfwxx„RA>HT™оp58J[^agijnttzx{ˆ€rpzˆqpmjghm[/3=&Tзџс)P_ccikjmzsŠvŠtvˆ€vtsvwx|ˆ’Ÿ}ozyŽŽ‰cB'4<>/\ШџџЏN#;;4CAA@A@@@@>@A@===<<;;<5665J320/--*')'&&'#&%###!!!!!!%')%'**)*)%%/443*!!!!*8H^i[hgaJ='!#%'''*)*/!')'##)----3!)--/----**--------***/**)**)*4^™О8N•№РvJ8LHEвџџѓиЪЩжяЭЋ•hmh›—ЉЄЏКмЭЙЦЦЦаВ№тБЭђыС&”ПpB^[<0XeZWW[gƒЃЂ­ЭЬШЙРИœ|“™’В‡УџџŽ`jN\KJџџьаБХ§я2=<;;=88H88<<<=>>@AHQW^_adfhcZREcX\[ZTI83#TppoVPLJIKTX\^n^\[TQQN;TZc˜dBWTTPPRTW[i`P42CKTye;/2I_^cvK8>QHBA@=@ACEFFHKNT\_h{mgAH^d˜ŸQ6;LUVTUX[eWQ6jo_rrttqsnfF5CAvдАI0AZ^afdhy€ttƒ“|{Œ{|‰zyso€jwv^@3C/5ЖџџA#^^_aeghjkmnrvxvvwyˆwtdxƒ{z|i}}Ž|—ŒjH0'8=2B›џџі‚/2=IE3AAA>B@@@A@@>@L>==><<==<8643020/-*)')&&&#&&%&##!#%%!!!&;*'#3*))'&#ATUPZ{sбЗДОУСдЌВЈ‡ƒ‘–ЂЗЂСяцџј!I€^[IЧџчЪЭёџп/>8;<<;;68<<<<=EKLWnXc_=IHJHHHFHFHKLKLKK[Q;<@4'=RWmZR2EBHPhWVVWXTVVWXX[^N[hn@PRXaERieXFXe[^^XXVo=PPg^5gTRPPURVƒP*ILPTWaсPTP>=>A@EPVZ__agd\TCW\[[fWLHI”>[ktXUPII;QW[^^\\ZXRQNKPX^wrLVVTQQRUVXX\VRK-@CIZJ0CKT\s€J;„^^QIB>>>=ACCBFJQW[af^ILQeŽH;4HNRQTUX\fXP6n’ˆssrqp‚tI;[PƒвЁ;5XXZ_ƒmiiosˆzy{‘|zzzhvrroie`J2@=AzіџŽKPqaeefjknnpqrc€v‹{yjzzzyzŒ{zwˆtP//<*%jлџџЉ5!*6FBBBABBAA>@@@@@>@@>>><>><@=<;4532//--***))&'&&&%%%!%!###!!!#!&&%&&))))''&*/'%%#&%%#%%!=FKZQcpFP'!!#!&)))''&'')#%**)&%*<-//-/----/------*)**-**)*--#K›Г–|gЭъВA4•ћЯ<4H'iТыьцЯЙЈƒ–qzn„ŒŽЛ›УЗЙдЙаТДйКЬЄЉУгЪ­[jгƒWQ[R2@A_s…ЦДБуШдХСЩЙ™Ј}–ЖВОжЯеџѓL#si\_3ЙџіЖщЩтџ2/==<<<8<<=<=<=>BJNgZXh_8IJIIIIIHIHJLXLVX'>INQ_*=TTWjP35LPUTTWWXVTVVUWXf^^^^r3PTcg8RcWTTUXZZZZIhV>LTeQ@^RPPRRVV=5JNRRL‡LVRLKLPNNLLKLPL[NPQTWWWWZXWWUUVUUWXWXVXWUVWWXEЭџьхцяхччщчєчщщчмчцхлчяцщчщчцяхцчщчцхцїн•бЩЏЛЉРЮзОЩяXPNKNPPPPLNNNLLLNNK3FJLIFVIIKLKKJJIJKJIKKIJKHJJKKKPџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџCUPPP=KNNLKLLLJIKLJIHKKJIIIIIJJJKJLLJKJKLLL_LKPPLNPAдтефхлЭмуцямђџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўўџџ‚#Rfeaocacdcdaac_`a_`_^_`__`_`aka^\U;CA>@>>==@3NU[r__e{g^VCR[^^gXQJF0TW_thCRKIIN`[[i^^ZTTRPKPX^p_XUVTQBTWVZ\g[URNE>*>BBBIT^vtRtяŠCBPIB@>>@APBCHLV[kv^@F_fŸ•FE{Q)CFNP_WUXf\WQ3[zŠv…ha6@NRrЯ};4W[\\UƒzpqdsvƒzzŒ{xxwtvookyd\88E4AДџе)3N^Pfizhhimntv„s€wwk|Šmz…zzz…{‡ƒŒŽz<*2)4;њџџa#IP32@AA@@AB@@@@>>@@@A>@A@@=>>=<8;54420/--)*')')&&'&%&%##!#!####!##!%&&'!##%BB#6&B)5*#%%#!%'&'))!#')''*'%%)-/----0/-*--//*--)*)-------//_ЇЭ ЂmW˜зЏпcIоџЏQ'J82“оњпТ”„‰mˆXp‚ƒП—ŸВЈОЮРТЃмЩбСМЧПЮО’z5/ˆБxJ[aP4_‚Љ ЮЩРЧЫЫеБйеЏЂ|’`ЁУЄЦайяѕџТE€^^CKћзяЪиџџ'/=><;<;<=<<=>@@AL>UhWcULIKHJHJHIHFKKJH>&AL^iXnš>JPUXiPINNPTQRTVVTTVTXUWf\\\fX=TUXa>QiWRQTVe\ZXXV^>LReNQfVWWXiXXVUVUWVXUcWXZZVVWVX/џљьчхчщхцщчнъъщчцщццхцххщщчщцмяцйщ№щцњжœщеУЛ ГЖЧЙЄЈжjQPJNNPLPNNKLPiNNKJHJJKIHIJKJJKKJIHJIIKJJJIIJJLNKJNџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ8TPNPNNLNLLNKKJHJJKJIHIKIIIHHIJJKKKKLLKKLNLJKLKLLNPAЮйзънлиняфчбёџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџцKdefcdc`a`aa`dcaaa`^^_mac``ac`a^^VLCA>@>@@>>AIRW^^`cg‡aXTUW^^^jQ6Tg`‡^<‘јђм^5XPIB>==<@>AFIQXt\2EPd‹ŠF8^mK3CINRVVTX\fcR;%Z€p…^4WH[—‹g4FV[\\`dmqs„wvwzzy{yxyw}anxkH2@>6‰џј\Qc}ffzjmkjkqqxˆetywyx{ˆ‡{z{‰yyx‚ˆZ=;4'-NКџџО;H_XVQFBA@AA@@AA@A>>>A@@@>@A>>@<8<;;6443200/-*-)))')&''&'&&%#%#&&'&*#!2%8=@@BFIIUJ\[U^\Ve\_\_L^^Pkmka`L;'2&!!#'&&&')*)))&)3)*&'--/0/0-//-0/-=////-**---//-/0/04yзАšГŽ|ŠLЮ‚ЙЄШЯЧC'Žџоz/;C2ђжв›’{}yk\ЉЅЃЈБХОПлДУгжУМЗВУЏzjU40FСТPP[U)PБДУТжЧЧчЫХПМϘЇ—‰}ЈŸеёзћоџџэ/U_[[^#вбЯыЮџџA@><><<;<<=>A>@CLKThWdf;KIIIIHHHIHIQ>AN_dZLc‰'3KRUce;JLLPPPRTRQRVVVVVZXZ[[iU5RVaV=P_TTPQaWXWaReP>Pdd4PR^LNQRVie)FKQRTWXUPNJLJILNNPNPNPNLNRUVWXVHVURVVWXVWWUXdWUVUW[^jџјц№щцчщъѕщщщщщщъъщщччх№нццяцщхяццчхёзЂлХбЮ’МИЙЩЋбщaPQPLNNNPPPKLPLNLJIKIWIWJLKJHHKJIVJJHJJIFIHJHJLLNJNџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџBVPPLNNLNLLNNKKKJJJJIHHKJJJKIJJJHKKKLKKKLLLKKKKKLNP<гэдямлаоыхяйђџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўќџџB*eeeccoeedecac`ac``_a```a``^_a__^ZPFAB@@<>@>AEPX\_adrhaZVFZ^^i^WKIH/R\_hWPNLKPUe^^_^\VTQRN=@>@BJNQU;W^d”{>N\^rkUH&BFPTVWUX\fW^K!Z™n@4KP^ЙДCIHTU[jdfhiofyƒyzyhxzzywttz_<;B3JцџЈ%=_`qjjjkkpzpqvyywwyxz‰xyz}zxyˆ„z}c3/682jхџџ&JavzWV^K0>@@@@@@@>@@>@@@>@@@>><=<;<6854432/0/--/--**)&&)')&&#!%<)BFH[V\e^kijkd^fgchZ[[XZWZ[[ZZ[\`^^^^\[fegigcda[XQEA-*#/*%')'%&-/--//////////0-0-/-*)-----///0!UРхцЬДœЇ_ЄŽ­ ъяЧpkэњА->L</ЂхГУŽ{„ikj…ЃАЉРИЛСУСВУлЮВЇЌЁ}P_XPL*0rБxA\Z-5•џммиЇдЮмАЛзЄœ™ДЦЧайыућџџe/x\\\*ВхЬАцџџ@>@=><<=<>=>>AAELLRgWif>KIFIKFJFFC-BLTdfJ[ˆg-KdVV_>KLPPNQRTRRRVUUVX[[WWWdT=RUaT5RURPPPQVRVRReNLPdc3P\LLLPQV€@3ILPUUXcTPNKKILLLLNLPPPKQRVVTUWcXUWaWcVWVVWTVVVVTWXXEхџхящщщъчђщцщщщъщъщщщщщъчєнчщёщ№цмщчёяœпХДЙДИХЛŸПл^!^PNNNNLLKPNKLLLKLJIKLJKJJLJKIIHHKJLKLIHJIIJKIJLKKPџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ6URQPPNLNNNNNKJKLWIHIJJKKIIJHFIIIJIKLKKLKLKKJKNLNPN6зхжяощмофящгєџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџšRefgeae``eccdna^``^`ka__`____`^i\UJE>===<<>@FNV[^cdi|e\UFW^^`_ZPJIHPZinWRQKLLRW^o^^mXURTR@T^`„[TUTPAQT[\XXXVWRPNLICA@ANX^ŽoRL8)џџіŸ)QPHB>>=<>>ABUJ62хџјh!Rstd`_WXhJ0@AA>@>>>@>>@@>>>L@>>=<<<86844432202-/--/---/#!'<=AFJL\UaXZe[fZ\[\\[^\[k^hni`€|yzxnqnrs„Œ‡…svaac^^^\[\Za`hmknk`[HFA<6''///00000-00-/*-0//-/=*------0/20#%aтгблЩсЉ˜axЌIqaŠВщЩџхŽ85№џЗ8-FFhШМ”Љ‡‚zŽ‰­ОДХРвЫРЦЮиЄЂ’spcXVNNKA%;ŽЏgE^;zџщлЩЫЮЪШЏЛРЋЃЁŠЂЏЗДЩРъыљтџџМ^o[\6€зШПЯџџ><==>>=>K@@@AAAEKLPaXkVNJJJIJJHC&&CPeZeZZ\[X\2FLPfjT=JPLPPPQPPPQQQRUXWXXdWqQ@RVpQ@^RPL=PRTUTUT_NLPgP;QPJJKPRXz-6JPRQTcWUQJLNLNPPLLPNNNQPUUWVXWWVVTTVUWVUVVTVVXXVWZZ!џџхщщщщщъщщмщщщъщъъщъщщъъщъщщъщщцчщїеЂдХЪШzВТОЬКЖсgPPNLN_NNZPPNJ^IKJJJKJIIHJLLKJEIIJJLILIJIJIKJWKNLJLџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ@RRPNNNLLNKLKJILJLLJKKKKJIJJHEFJIJKKKKKKNPLKKNPLLPP=!зхзыооммсцянђџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџ№4Ceeeeeddeacacdd``aaa_^^`^^_`cmaa\aLCB>>=><>>CJTX^`ehzˆ_WUH^``p\QKH8>X_yZERNPPRVX^^^ZiTTPP@Q\cw_IUTTRRUX[\X[XUTPLLNIFC4LV^z`UKFI8`џџџ„!IKC>==8<<=>B5T\cqHC_s`^WRPPZH&3ILPVVUZixX-Q\PЉ{E;RWXVW[_expaqtwzzzzˆ‚…v‚{e^;/C=RЫў„/K^^dgffkoqvvttvyyz|Œxxwwyzxyxƒ‚U*#6=8ўџуKBcdsddr`^XFdL#>@>A@@>>=>>@==K>@>>>=<;;;556332300/0//2%-@EJN^VWX\_Vfgj€ƒr‹yrz}owvikrmimnkenmhgoapijghxzihqqz‡zzzwp^^^^\\[ZZWfg^_\IFA>-!!!//0/-/-///--0/*-//////0334–яыЬЫбПиЁ}дm„stŽя’ЦхЧхš%/ЦўЧA*NR‚œБЇˆ‡€…|ЄЄУЖзИСТУЯ늘 ^iaHQPLKPP5-eДsP^ICЬџэхммегЇЪГМЂ‘”ЦВКаЮзьххёќџе`a^^InЮСХдџх@>@@===@=@A@BAACVLQVUc`PQKK[NTTRUUf^>P^e@>ePKKKQThp/FLPRRVXWPP'гѓищмммЯехцвђџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџў§џџQ#geddcceccc``c__^^`_^a`_^_`a`a`ai[PFB@>A<==@BHRW[a`d|€`JFU\`aahVLJI'A”џџЗ@!@a`xec_^[KXWCkN2=L@@@@@=>@@>>>><=>=ABBUWUVfjqv|€zxzi^_^^\edj`f[LFA'%!2/00//*/000-----/0//24;ЩчаЮспгЙЏ„|ОT–RЈЙЙВДыйгОq™їлU*PL3eКР…w…œvŒЈБЪ№ДеБвлŒŽocZUPNKPQUTH#'€ЌcI^%‡мяЪъЯхЇзЛВЉЂ“ЇЏЊЏЬейъ№јы§џџFL}`[P!ЈЦОиџѕC@>>>>AAAA>AABCCKLPfVhfL;ITP&-FPUhXXVZWTNIFIJXa>NTVj^8LLKNPNQ^QPRPPPQTRUUWRhAQPVeR_h=R@>AFPa^_degrcIUFX`c`_VPLN>=<*4PZd‰wLIfo^\eUPQQRTWs^'&BHQo\J4/*Q^e–ЌfJRQRUZZ^_^efjottq|ƒƒrtrnkvq^;8B@A>@>==@@@=>=><=;=688654334#%%)AFNQUZ\_Nik’ЃЙ­™’qfP^KFPLIHEB@><86%#!!#!#%#%#'##%#!%*@/4=>>>>AABABBBBCFLLQXVdVNIP)EPVZZWZXWUQJFINNPRfPNUWgQ3KKLLLNQPRRNPLPQPRRTRTd#счзінйШмсфьмѓџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџ*@ffecdddcdeedaca`^`aa`_^``_``^\h^WNCA>>>=>>@3JUZ^cdf‡d[XTIiddjXRNNJQ[ioWRQPQTd^^^^^kcRPQR=W[szXBRRTUVZ[\h\XW`N>PQUTRLKUZpxWKHFB@@CCC…ђљ;LFCA<<3P\d‘mIPQX^[XTPNLLQUWizW'-CIVIC05V`ŽzL2RTPPRj^qddgk€ppsponqony{hcZ8>H8ŒыпE*5X^_cgjk…opqsvyyyˆwvsqqrcqqrpp}c6/=24–џџД)&Kdnaa`n`^_^\[eWTRQPI)>AA22@>>>>>>@==<<;;;6;46%&-EIPUZPPRg|ЄЌЙ›’qdc^KRPKJFA-)&!!'&'&&%!%#'*'**'!%!#!%##!##%/5AHKNPTWjyŽ˜’‰„ic`^Z_PJF@'#432/----/20/23ИџсђоЮдЮУОЏн эЄ‘ˆkˆˆœЂЅЌГУЗИЫџЦЂ€џхRCA>@AECBEBELPQtZZ`K>K_ieWX[XRQJ4IPQQQ>P^4NVWoAmLNLLNKKPPQPKKKPNPTRQdQ>QTfT3[QP=PLR_TVUWh;NR_PL\PLJP^EXr0FJ[QTXWXRNJJXJKLJZPKNNNPQRXXUVXUTVVUTUVTTVWTaXVWWWX@аџцщыпълјьъъъъъыыыыыѓыъъщщыщъыѓыъќзЉмЧРШДЙЛМЙЭмWPNPLKPNPPKPKLKKHLLKHJJJJIHIJJHIJJJHHIIIFIKLJKKLKKLџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџь=R^QPLNKLKLLKJKJJKJJIKKJHHKVFIIJJJHILKIJLKKNNKLNPPL=гызђмиЮмттхЧђџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§џџy[efccaa_`cdadc_a`^a`a^^_^`^ac^\\XPFA@L>>>>@BHRW^acado^WTH^mecgTNN<>@CFIВџщhXQJFA3Nd_‰}H=IPRgcWPLKIJLT[_zsp!&-AC@>AВ-@>>>>A><<<;8;868--EKRVZQCUДЌЈЁe_EJENJ6B>*###'''&&)&%%%%%#!#%)'')&!#!!!!#/5=ELBTRJBI&#!##%#%''!2#6=BFHLRU\a}˜››rc^fXd`LFA='0-/-0///#;йпфїџ§јСвзВмА­лxŽhoРŸ­–ЈХЦжЩзгйуЙiЋЬw5IIW”ŠƒvД™лГЛЌ”s…\U_fTCT[vkqqpevjЏЉ-WЄdPP==јџыУОоПДВЯ™ЏЊЪидЋяъјяњѕџџя`zZ\QwеъџџЬBBBBAB@AAABCEBBELLQkVhhJ/BPa[XZZcTQNI;_QRRQPL\f>QVVgP2JKKLKNPNPPLKJKL\PPPRTQ;PThQ=NQPPPPQUT`TVR/Pdm==>>ACLa\_dfgp`ZEAZqcdiWPLL8U\jnVRPPTX\_`j^\VUBRQPPX^i\HURTTV[^^\g\ZVRUURWUVRBT[_xZPHBA>@AABCCFIЖњџw3XN63LV`„zH@>@A>>;;888)'-EJQU[IEo‚ЏйЯˆzT\FCNHC@*'!#-**)))&''%%&&%%&#%%!!!#&')'&!!#!!!%-5@VcWiaLFH'!!!%!!%!%'#!5QUVVNIKKKKZPNNNPLIJLLPPRQQmLKPe^>La^PLNP^QTUUrPLAUR2NPNI;`QE‚>4IZQVXZWRPJLILZLLLPLNPQPQRRWhXWXWXWVWWXWXWTXXVTRUXWJnџђцъъъьыыыѓєььэыыщъыєыыььэѕыыыыќвЋоЩвОЈЗЗОб–ДчW!PPNNP[NPLPLJLLJLLLIJIHHHJIJLJJHHJIJIHHIKIIIIJKKKJNџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъ0RRRPPNKKJKKKJIIJLLJIHIJJJHKKJJIHIJJJJKJJKKKLNJJNNNCнфжщнмлнтффЯёџџџџџџџџџџџџџџџџџџџџџџџџџџџџџўџџџX*gfgedccccccaaccaa``a__^\^`a^___^XPEA@>>>=>@AITX^cdfqd^VEI_dd`XRNNT[\h[PLHC><>@CACFEFFуџоC=U3PW^{qWI3PACHKLKWJJLPTW[avih|n#%IWH•џ`Za_WJE!FkX^_v}ˆomj[hvjix‰jVBWIPЃќ–2)H\[^negknrprqtcnnpopspoorzm}q_B48A@@@><>=@==;<*)38LR[CLXvЏ”џОƒXBB3QVah;IJHIJJNKPLNJHLJPPNPPRd3NQT^3PTRRLNQTTRaVn==@>@>AHQd^adefo_XRViddn^VQjK@W^rXTRPPV\^k``^ZWQQTRPU[hgVQTTRWX\^^^\ZR=QRTX[[W>Q[^n[TKHFE>A=AU>-EECE4%хџхiCT[^s€VK->>@CCTHEFIJLTX^``fi{ƒnNLZd[ЃnA_ŠmUPH)Kz{dNhnoonkhjggre_>0I@A>@>>>/22;PVJ;IA-#%#!!//-/--****')')''))''''''/'&&'%#!#&**)&'!!!!!!!-6@PqZ[fTHI'!!!&!!#!!#&&'))-0#&)/FKKCV^|ЊЅЉhdK^WfPIC#Tи§ЮчЯё№нЧУўЗЏХсТиВАw‡or‚vˆ„ЉЏЏЭООПŸтЬлШџЇyџР3=^N/Bo‘–Š‚gN^IVULcnz‹К——”‘|k{zЙКъй\)v‡QQH*зѓухЏРЏКЉЂЖХСвлыофџўџѕџіђџz;p[^_EсљџџЧCCBECEBBBCB@BAB>@CN`Z[WQdƒVQKIIFJKLPQ^QP@RPPPaP>QUjd6JJKJJLKKKKKKJJLNPPPT_R8PQgR3^URNNPTRQVRTU'ныпфмнлнть№Юяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџќџџ;ffvdteda__``a`^___aca^\^^_^_^^_\UJCB>@>==@AEPcp^acgt^XTBCA'>EECFFK%џџv;[_vVKB>>>>=@ACBEHJLQX\anefe^EFZdЧ_6F^r^ZZaTIAvzghknoyjggge_W0A@>>@>036=RJ;A\‡сџџАwH2E@F2*'%!0/0//P----*****A**')')''*'))')'&%&%#%##))'))&!!!*6BPXX[f`II'!!!!!!!!&&')*)**/000!&8-BHNCK‡—ОЃ‰XJKZfcA#6—ЫџџџџеДЮцЧЏВоъВЩТ…}n}_‚„Ž‰ЏВЮВвГСжЧХгыз“ѓ˜AEPJJko€k^BWIW\Qm{ˆ‚ОЇ„Кš‹ЛwЇнтз{Ј`P^!Рћџе­ЈВ­}­Оздлнпзцзўѓћяъџџ‹0^Z[_*аџхџ0EEBFAABABCBAB>-EQgX[XBfNJF2ILLJKLPTTQRPPQNLaP>PUW^0IHJKJKKLZLKKIKLPPPQT_PKNR_R>==ABK_X_`dedmZRQVtggo^UQQ=>>>@BAFIKQV[^cacrEI\e”P@=QZ^XX[fd^J#3hdhjinmkhrxjIEHNB›а‘/4TV[__Tcgiz……yxxy|›”ŠŒvetwЂkoi>3J;JЄџўz!H^j^daeqdhfXhggdcfeefffeecc_^ZQLHB%>A@@@4H>EE;>mЂёјШŽk048=4/)3!//-*/---*--**-*)))''*))*))'')''')''&%&%2%%*))')&!!!)5E\XZ[oUI='!!!!!!##&&'))*---*/-/036&0F>6H^ˆКЅiLHPNF#xџџыъеВЧЧХЩзŸРуŸЏЁˆoftw™—ЧКпПбУащВимфй‘%МЯBT\56Aa^[I‹W\cn|”ЌŽЖщЏ›ЃЂб–{­ъпйо4FvwP\5^џѕПЙЯЁ‹ŸЈуозбџЯёЏіѓќѓэяы№Ћ\[[^#щџџџ04CBECCCBCA@B@8*E5дойъомлоптядяџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџзRffcdccaacacdca_^__`a_^^`k___```\RIA@@>>==@AHQW^acdfd\VQF_ewd_WQQL=Zh\VRRPQ[`caaj[XTTVgR6V^_^UUUTVWZ\^\ZXWVQTdf[eU6RXn^WQPICE4FHEAFXEFHHHJHFJ83K^tˆP;PJHA@@<==>>@BHIKQV[_a_\>INd”ЅP/4LTVWXX\ZcTK-Q|iiihgiga_W=JA^ЪгZ5FTWZ^aedejoqqxx‡whxwrss{ŠdI0>-3gїџš>^`^aaaecggjihikiifiiiijhgfggp`[TPJB<*@33=EF43^Ијџа‰P)88/2'##000--0*-)-**-*---)-)**)))'')'')'*))3)'')''&&&&****)&!!-8E\XX\\aKJ)!!!!!!#!%%!&&)*--//----/034&'&@F=EP‡ЈРЋm@CPH-TЗјулчТЯжХУДьЪ‰˜„n|nˆ’™ЅАоПВТЮавзЧтглйj<нТPB^X8>>==@>ENW^ceggftXRRZvffaXTTNNV^mZRRPRW\cnc_^VTRTUVPT[^hXCRTTZ[Z^h^ZZWUUUVZ^ZX@QZ_{ZRQLJHJIIHABFHIIHFIKHEH6>XPoH3\ZVLFA>@>>>=>ACHNRW[hgZBV\d|cH^22EJQadWWX\d_N&Uœpwfe`W<=JFvЭI)ARUX^cdhj^\cqtsttdfer`ommkhf`E6A@8aмџЖA;^^qctpfehgh\nmjopki^knmimkmjjip^X^KC-0;>LE5gАџџч‰=%342*)!32200-//-//*-/----**/***'))))'')'))'')'))'))')))&')-))'&!!%%)6CQW[h^WK>&!!!!!!!!!#%#''***--*---0222243#>533H{ШМ­m5EIJyЙёщдхлЬРБъ™Њ–}inˆ›‹˜ТЪй”СЙеЩинЛбзфЫWaиЄN@^W8=RT[dfЉ—ЂˆЛЩЋКРШЋОАŒ}‰ГоиЮџ§дB‡`P^ШњЧЂЉ‹•ЙЧфидєъыџђљђ№ьщсъћВ)\[Z^-ЫџџџJFCCBBAA@'=E^RPT`ђџъыыьыпьэээьььяээьэыыыьээээџлЇсЭЧЧКМОРЯЗДя[!N[LNNPLNNPKPPLLNKKKIHJIJWIHIJIJHIJIIKHIJJHIIJKJKLKџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъ>TRTPPKLNKNNKJHIIHJJIIIHHIJIHFIIHKJIIFIKKLXKKKJLLNN3/ихиьпмлмъэ№ЮфџџџџџџџџџџџџџџџџџџџџџџџџџџўџџДPehfecdddcdadca`^__`^_`_``^____ieQF@>A<=><@CJT[_dfgvaZW><=>@@C8\V[[W;F\cЂЂ`>Z_N3AELQiVXZ\\ZU>=ŽnyzW;FPH•х‚33PQRV[`chkƒs}ywxttwrt„jvgd_Z8;E\x—ШЩЂТЏЧЏОУsЅХ‚ЉЙРЫађјыTAŽa[\-ЏљОУ™’ПЄЫнмфёщъф№№№јќуођъВ%Ze[^-бџџЬFEEABN@)'CPfcWK{j!KRXVgT=JKPQPPQPKKNKNNLKZLNPPRLPRg_>LLJJK[PNTT^RRRPTe_TU`R>NTiPN^UTPNPRRTTUr@KP^P;NNJJIN@Tx)EINQQaZWQLJKJLKLKLNNNPLNQTXTVVVXWTWUVVUVVUVVVUUVUVJ=џјыьѕэіяяэьыыэњяяяяьыэяяяььќй˜эЩУМАЛЛПЦˆЏьU-PPPKNKJNNPLNNLLLJNJJFHHJKHI5IIIHHHJKIHJIIIUIJILJLLџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъ>UTRPPKJLLKNKKJJKIIJJJKJHIIIIIHIIIIIIIHKJKLKKJKJLLN34змзхнллмъххХёџџџџџџџџџџџџџџџџџџџџџџџџџўџџџ*@gqeec`caaccaccaa^_j_^^_^^`_`_^_gTIB@@<>=>AA5PW^`egen[UREqqfe`XU^@AZ^[UCUTW_cnaa`\URTahU;X^k^TQRTZ[\^[XX[VWUUZ\\^ZQ@Z^_hWUVVPKKIHFBCEEIJHJHHJIIKT\dŒ^0ЊџmBafPJCA>K<<<=>BFNTaaCR[cQIVWVQK/ACJPUcXXXXcUN&<ŒsZ8FP^ЃСm/RNPQVehkcv€vxvzˆy€Œƒƒspm[wc\B5;=@tђџ…/L\^^`vgegiiympctresqtrrpdrsssqsqwqX<0<=/C{щџџ›L*6*#)44J320000-/0/--*-**-**-**-/***A))*)'))'&)*)*)))*)-*-*-)''***)'&###*6C\Z[\^cKK&!!!!!!!%##%##&'))*-/**/2/022@---/0-0/Vc54ˆЯј™J5KH-QяђЮЦнд‡Зˆ“‰„{fi‚Š‰ЏЂРмВОДЯцШаЙнАЫУŸ™e/EЭУ^6\W6>} ЙЯИбзСвУСтЂƒЖ ƒ„‰”ЁКЦЮсоўџŽap^\@xРГДЄЌЖТтисяъъьћятыъщхмйЩО;J[X_/мџџКFEBB@&>HPgeXW^…|&KmWWkR=NPQPPNPPNPNNNLNKPLLLcQ>PViQ8ZLLLPQPTTTRRRPQBTUUVf@>TWi2Q_UTPPQTQTRT_@PQkKJ_NIFHKPpPFFLPPVZdaPKLLLLL_NKJKPKNQ`WZWVZXVVUTVXUWUVTVUTUWVVZ^пџёыыьяяээыьэээяяэьэьэээяээџи™лЪУРšЛОаД™™хUPPZJNLLPNLKNNPKJLLIIJIIJJKKIHIKHIKJHJIHJJHHIIKLJJJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъCRRPPPKKKNKLJJKKJJIKIIKJIIIIJIIIIJIHIIIJJKLLLLJKKLP3иызхомммпхяЧёџџџџџџџџџџџџџџџџџџџџџџџџџўџџz\gddcc_adccd_`aaa^^_^^^\^``_``_^XNEA>>==>=@CK`[_afgd^ZTB\zzhs\UTP@>=<<>ACJPQAE[`Ё‘JIXWUQQZJB2EJcVViWX[XTL-hX3ZTpЏšI;8PNQTW[\^dkqtwŠytrqoaopxst`X<<>@^ЫџЩ;6KnpaQTejghwpzsvxwwwzwvytvvgty…‚vP44E5;_ЧџџТ^'5)2&84323322000-//-//--**/*---**)--*)**')'))*''*'')))))--*****)))*))'*&!%)5C\X\_hkKK'#!!!!!!!#!!!#%%'''-*)-*020333/----/0*jЁšsa-4ŽўПƒ=)>HPWf^Z\`ys^-KUZZgPKPQPPNPNNPNKPNPLNPLNPfNNP``PKPPPLPQUTTTTRPPPTTVVXh4NTgV5R`TPPPPPRTTiRNPT^2L_KFHKLP|<5INPQUXXTPKNLLLZNKLPZKNPRWhWVXVVVaVVVXUUTVaVTVRTVXZ&џџьљяяэьяяяјяэ№ј№яээяяяјяьџцЌзйЧсКЧЙМоƒЏўKPLNLJLNNNLNNNNLJKJJFFJFIWKJHIKKJIWKIIIFIIHIEHIIKKKџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџмCRQQPPPKKLKK^KKKKJKIIIIIHJHJJJJIJJIHIJKJLLKLJLLKNLN;%щѓлъоллмяыуРёџџџџџџџџџџџџџџџџџџџџџџџџўћџј!Ligddcacac_aa`_`_`^^_a`^^__\^``^ZQIB@<<=>@>>FRWimaggcZWTJssiq_FU^@PZgfTRVW\adtdm^[UUTXa8R\_`\FQVXX\^\\\ZWVVUXZ\^gV6QX^mWTZf^dRKIFHFEIFHHHIFC'/EQ\o–cUAїџЭJB[UKEBA@>>;=>BEI8P[`{‚R@\\XVRPNKL23FLaQXXW\igJ'#AJTtз}g=QQNRTZ[^_dgkorxxxwspnij^hfc\8<@>5…џєg*'X[Z\`cfezhknkasrwˆz{’„z„z„…’|{zvqw>6/8*4qќџџ˜;&08B=;5443433320///)-'*----*---**)*-*/**))*))''*'*)'*)))*))***-*-*''*-*)))&!%!#)CC_Uj^\WLK&!!!!!!!!!!#%&&&*))*-/00032/*////0%AtЁРЈŠ_XщџЁJ/;I;)ѕфТЩЃšЃˆqyi€‡“ЉЄЛДЗРђУТУДоБД—„peXUN<&4•ОhIXALйьлУУЮЦаЯЛЖеД€•tДЌЈЩмОэОъџќCœ_[^<*ЂРЏЧ­иПлїщпы№яяымнхјьЫаЭТPIXZiBжџџ‰/B'*FQc\Z_i^\ZTK!/JPpVX`@KNPPPNPPNLNLPPLLLLPLPg;LR`o@L[PPLNdTUTPRQPPTRUXWaU@PVpQAUUTQLNQRUTUr@LQgP0NKHHFWLk\8FHLRRXWWPJIXLJNJNNPNNNKPTUUWhVWUWUXVWVTUVWUcgRUVXZCЧџђяяяяья№яяэьяёяьяї№ёяяяїїйАггДСЃИЙОиqШїV&PNLNJKLKKLKLPPPKIKKIHHEIKKJFIIIKIHJIIIFEHHIHJJJIKLџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџдCRPPNNLLKNLLKKKKKKJIKIJJIJVKIJIFJJJJHJKJKKIKKNJKLNL>мущыпллвсуяЮ№џџџџџџџџџџџџџџџџџџџџџџџџўџџ`%[fdda``aca`_`_``c_^a___`a`^^^`^^VKC@@><=<>>3NVZ_edf{^VRV_gisdZWVP=c\[VRTX^ceddac_ZTVXhU>X^ofTTEZ^i^[^[XWTRX[[o_hXCPc[oX=W[^^XQLLKJUEUJFHHFTUNZ_„vWPLL0џџЖafWQKEA>>@>==>C8PZ`ˆ}KH[\fWUQPNP\`F'0JQVcWdgP34Q\T“Дp6XZ_\\VLP*!!!!!!!!!'!!%#!!!#%%&)))*-/00322--////2&K}tЄ”МЭЈ-/ˆџі|&AI>pЈвбЌЗ…‰{cˆ’›ЅХГ“ЯбРдЛАЈ–ŠxQ\UPLIK32IŸ™dBI;wџђКОРЭУвХаЯВЇ{ŽЄ ДУЮаУлыўџ•k_L[=|ЈАГЪПхпчјяјяяїјчсщъЯХЩЖЩ{Ie[[6оџџЇ!AKkXk\JyiWUNKFCEJPQRVc`'лцфщпобмтыэЩяџџџџџџџџџџџџџџџџџџџџџџўўџџсNedea`ac``aada_c`a`^`a^__`_^^^_hdQFA>>>>=<@@K^[^adee^WRB\vztv^WXR5V[fWQUVX`tqfe`i[VUZZV>R[m\UCUVf^`^^^[XRBRW\_^_fRCWZ[XUW[^^^XTPKNNKHFIJHFFXBHf^to>NIKLAIјњ‡K^RLFEBA@>>TRRRVX^_cwworpv€vzЁzxspkfpI*A6=ŸџЯC@VXWZ`^cfVm‹r‚vtwwtxˆ„zyzyyk{‘X'!-!hъџџК/#88)'55544522432220/-0/-<=C/*--*--**--*--*--)*)***)*****--**)))**-/---Z!/0##!#%%&%&&&%'&&'%%%!=/HR[BF*!!!!!!!#!!%#!#####%')*)-023233///--/'nГ‹yj`tŒЛлхв^dхџЋ<4LA#UИЦЗЅˆƒˆJdp™šДЏЙьРМЬБЇ˜Œ}paWPIJJKNN0-бgJ^CFЧЧУМжКзШЮСЖБЃ}—˜Є›ЪЩоЯавбоџЏjn[^JXЈТЮоУмђьяя№яёящсЯлъЪЌЄЇд}=VX^8мџџ2JRZ\\[__\TPJEBFFFNNPRZja2NPaQNNPLN_LNLLKNPRPPR^=PRfd/PQPLNPPQVVRRQQRUVUUipP@QfT'PPTRPPP^TRQnR=L^^0LXHFFFKRw44JPPUXeXQP6LNNJLNLKKLJJNQRTTTTWXVUUUTVWRUVEUWVUWWVZ“џљьяэьяя№№№№№јёёяэя№№№яя§лЁийЯЪЏМБезКзѓWPPLKLKLNNNKKKPNKLKJIHHJIJIIJJLLJIIHHIJIFJJHIJJKKL^џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџж3TQPPNKLLLKKKKLKKXKLJIJIHIKKJJJJIIIJKJILLJKLJJIKKLL=гпчсоомчутсВъџџџџџџџџџџџџџџџџџџџџџџў§џџH2fgec_`c`aacccaa``^^`__`^``_^^_\ZUJB@>@K><=@EPV\``cvn\UTImskg`ZWgAPi^eTTRV^`eeec_\HTZec8RdgZFAUWZ[^__^XWWQQU\\i^\VCV[^kHHf^^\ZWRPIIKJIHIVIJCFCH^\jhTPKFIJK5zџўoPVNJHCCA@>>3LX^Ђ\FVWZZVQQLNQRU[gv/BU^[Z8*6U^dz^>RURQRUj^_cd[n‰}twwg‘zt|ƒ‚^;3B6dўџ€'HXZX[^aefyhnstvvtywxyxzƒƒxzz}›™ˆŽg5&0'/„џџџm=>A@@ABBA@BCB@@>->0-/3*%%!!!!#!!!!##!####!#!%#%'))*/03342//--//BсГeg‚ЈЈзвмХˆ-4ЙєЄT@A@4KЄРœŸŠx\V€ˆ’ЈЈЇьЏЇТЏЂЄfnq^QJIFKPRPT==БŸa^^#ЅщЩВиЧзъ ЫзЗ›||‡ЈЮХпуЧстЩъџЭPi\Z[%B›ШщЫеѓѕяќђђјћъиамжщмЗ ВОt5WX\6тF\X\\Pak^TPIFCEFFFKcQCh[xc4LLNNNZLKL8>NNKZPPQLP^P3PVgQ3PQPLPQ^RTUiRPPQTTUVWf0PRhP>deRPPNQTTPQq>=PdP6NWHCCILcP2HKQQVZZTNLXJKNKKK_XJKKNQU`TUaVVUUUWUWVUUVTWWVVUUVZ2џџыэяя№№№ђ№эя№№яя№№яя№яяњиŸчзМПКУЙОЬЉЪљC*PPPLKJLKLLJLKLLNLKIJKKKJJKFHJKIJHFFHUIIFIHIIFIKJK[џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџд>TPPPPLLJJKJJJJJKJJJJIFHJJJJIIJJIIIHIJJLKKILLKKIJLK8сьмччнмнтысРыџџџџџџџџџџџџџџџџџџџџџџўџџЙVfgpcc`dcaac`_Q`^aa`a^__^```^_i^WPFB>==<<=>BJU[_ceet^XT=^hvheNZdR>W\mXEUW^cdfgf`\WVVZZT@XkfWUUZ[\_^i^\XTUVU[^i^kX@U[qgXH[h`^^XURPLJLLKKJKKKH4JTZonW>JHHFKLI3ˆџ­;HT@JIEEAABJW\e…\;@RVWVTNNPNPTe_cv‡2'>AAEIKZf—ˆdI5)JPTURV[kehvkndstjatf‰wajhfPCАџУ;>Xe\iamnaehjnorrvxvˆywwxiwyyˆyyZ)#/'ЊџџџP@\Z^JIC=34434322/2022000/20--/---*----*--*-!00**0)**--/*--#!;)<-ACHIKW^ZdeckccgdhhiW``Vf`eeg^gd^k\\^PPLJE@=;%!'&&##!#!!!#!!!#%!#!%#%')*-33443/-*-0NО№ЊŸrŠT5‘—šЪМжЭщ_™фдm4>P5%5€В˜ŒtqgŒ–ЁЏавЌЂ™n|^cNFPIHJPWZX\^^%cfFN<;ЯёдА­лЧУЛЂŸˆ„ЁАаЙлмаїыЪпџџJ>‚^X\2-ВлЯУлхщ№ёё№яџхънЪвЬЮЊšУь„>dW^K*LV\^`^WPJECFCEIKL[kPfXZ{`8LNPNLKNNNsKKKNRPPNQk;PUWfPNQQPPPRRVVUUTRP^TaXVcU@RVfPAUVTQNPPPPQQfKKcd8LLKIEILPr4CILPTVdXPPJLNLXLNLKJLKLNTVTVaUXWWUaVTaTVWTTVUUUTXXX\џэыьэя№№я№№№я№№ёё№я№ђ№яџйЈъЮЧРЉЙЈОзЛЮј<QLLPLLNPNKPLJLLKIJJIHJJIKJIJIIJKIFCIFHHFHJIFJIKLK[џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџд;QQQPNKLKJJKKJHJIJJJJIFFHHIIIHJIFIIJJJJJLLKLJKKJJKLHпммпнЮлЪухъЭяџџџџџџџџџџџџџџџџџџџџџўџџџA@gedaa`odaaa`a``a_^a```^^`^``a^heRHBA>>><>A>FPW^acgzcXTBZxkvg_Z[c3RZ\[UUW[afghhd^XZW[nU4U[\XETV[_`a_\[ZWVWXX^\^[WA>X^^ZHWZ^__^ZXRPNNNNNNLLKKE8^\aaWPIHHIFHHLK-Џэ­;RWCNNKF5JV^x‹Z@IJNcTQQPKNPRXZaaf‰ˆ;&/KXa|мqPH6#BL^UZ\_aWk}q}vtzЃziqwoP@;™ЈLJL#ГџоУбЫзэƒЂ˜ƒ’š…УСЫРЛЗЪхзчџєa5‚[[[*ВсЭдщщэя№яэяјлосвЭиЫГЏЊй…@Z[gX>8LVk__vpWQKFCCEZZHIIJJ\AQVjXP8NNNKNKLNL>KNLPPQPNPPcLNRWi>=>>A@3P`[_`eg_UFZdiwtc\\eTCc\jUUVZaphhfpaXX[\^nET[^fTCaZ^kc`\\WUVVXV\i^mV0=>@@I^Wh``ercZV;`hvjg`^kV@V\\VEVX_phhhda^WW\_gVAXjyXAUW\`a`_^ZVWXV\\[``fQ;QdpjTV\^^^[[XXURAPNLLJKPNJIPW^m_HNJKJJIFHKLJIN'0ЮоŽ!Jo^QAW\t”^>3>>BEHIIJJKNQU\`ehnkgvr4RUda@PTiPNTTTQPL[QQPUR8Lf\0K^LFCCIPm&CHLQVZXUPLJXLIJJLNKKKLLNRUXVVVVRVRRQTVUVTVUWWTVZWX\иџє№яхяђё№ђђђђёё№яя№яяџм’ъТХПОЊОО­ЙъB&PNNLJKJPNLNKLJJNNKKWIJIJKJJKH5зЦоопммоъфуЮёџџџџџџџџџџџџџџџџџџџџўўџ„ihfcdcc`a`a``__a``^j`^^^_a`_^^^\UKA@@=>=<@>CLVX_cag|^VEXvmmh_\^j5Tj^[TTXjeihire^XZh^oZ;V\|oUUW^^aa`^ZWcVWX^^^_hc6RZ^ZHFX^n\\Z\\XVTTTPJKKKJK;>W\i^TQKIJKIIHFJKJJNN'8хџ’p{^BW\nƒ\=4-<=ABBCEFIJNhW\chmonyvVCWV Ћe@K^c^\ZnL-0godinnmpnannookgQ=ICA}тйTIX[^^Qchhfgkmqƒq_rterwxxjzzx‚zzd-);>BЋџџЯPk{ymovd^[VNE@><6322033322200/0-0////-///---/0#'2FKQW[_aes”š——Ђ™‰ay^ZWVQNKKIHEEABA>*;;'%%4!!#%&&>/FJ<)A@@PNPNRUfXmkzowx`_^^\mfo_[E=!!%&##'-24442/-//2ZьмнзЖТїТВpatW‡y|„“­ЂЈМЩУыЭЙW4џџ3PVqiPJKJJJJKLPPNPLPPPPPTQ^NNPVgAPQgPRQRT`VVVVUTRVaXVj=>R`_4PRTRLKLLPPQyL=PcP0NKJFCI=sP2HKPTVZXTPJIJJLLLPLLNLNLPUUXVVVUVVUUUUVQQ`VVVWcWXX[#џџя№јя№№№ђњђё№я№№ё§ђђџмЋщЮШУМЙКЦЬПзј84PPLKKLNNNNKNJIKLLJKKIKJHJIIJH6ЗLFCFHIHJIJJIJJLLKI^џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџй=UQRPPPLLLLLJJIJIJJJVIHHIKJJHIHHIHIIIIIKJJHVJIJJJKN<&оЙуьпмбосфяЖяџџџџџџџџџџџџџџџџџџўўџџџ%Fhhgc``__`````__^^^_^_^^i^_`^^^[XPFA>>>Q>=>BIR[^aegp`XE=_t|vd^^tTA[^^WUZ^tgjiiqaZF[_jgCTZ^oWCW[_``a_\XWUVW^h^^^X@RX\pWTWm^\XWZZZXVVUVQLLIJJI=U[woTPPJFFIHJKHIKWKKLALђјŸc4V^m{hP3A><<>AACFEHLPTXcgkomzeLIXd‘Ќa85V^^NZ^ZVN)/dmjmzppmookksdL3@F8Мџ’);BFJK\TRWrt‡Ђ{m`^^[dh`VEA'%/23442---!=ДјШДЧзТбИŠЁrvcodh}”’Џ­ВЂзЗЮћПELоџ}<<\H-Nh}r\he_V8TU[aQi˜‘›Бпz€s…vЂэсF<ŒcNN8PуяоЭš|›Ѓ‰“КДОЫЯдлёјЯусжфїй5[pZ\IhэђічыљэяяљыъжоЛЄЗгЋ%3ITWWsXCNK6-6ECAAFIHFEHHHHIHINNNRUh_8JIKLLLJNPPNPLPPQPPQPc;N^a_4N^QRQPRTTTTUVTQRUVZWo>>==@AEPX^aegrn[UALqnohT^^d5X^_\HZ`ffhkifd_XKi^oZBe^wZHV[[^acap^XWVW[\\^mZQ8ZmmZHV\\[ZVEU[[XVXZaQPNLKKJTfogTNLLJ44IIJLKJKJK;KN>ƒџф5LNc_CNHB@>=>>AAHEEKPW_eznnk|CдмлЬЪПмЙŽПœ’}XTppg‹‹–œЈЏВздПепмз\Lьџv*FK;2Lo_[ZXTTQV`ht‡ЁП­ВфЈ™‹ˆx„‹Вж§Žf™dRQ!ёјџя—Ђ‡ŠБЄЪЦзХзйщнЯъЫж№щђWPvZ^NFћџыъєѕјяяыьнХ ™ЌТЉEIL<=QVnkU3a;RBETIJETFEJHIFFHZNNTUaT6JLJNPNP\PPPPKPPQQQTR\8PRiT0T_UQRQUUUUTVTQQTVTXaQ;P`iPN^QQPJKPL\R_TNNT^=@>AKU\^ddhp`UC>s}ng_`oAEeozJI^dtknkie_^Z\at^CW[^[VW\o`^a`_^ZXZ[\\_^\[V6Vf^ZHVf\ZZ[XTTXZ[[XWWQNNZN2QZinVPKIJJTFHILLKIHJsJJKP5Їa'Pc…_>HRPFA@>;>AAWRCFLXoartsoJFNd”TF-2CKPX[WVZ[ejR-%nxqznoit^3==@|щЮ3)Wtzppn‘xhfc_\WRPKCAV8;442002222000/0/0/2!)@FPVFLUtŸЯзУxZJ@FNIC@<'50!%-*--*-*--**)*''*/*'''&!!!!)4;F`TUVPEP##!!!#%)#%#&#!#8=CHPPTWn‚›•‚€ec`^XRL50*%!-#2jњтРнамгЙДЏОošˆeqoz`xŒƒВЉЏЊЪСяИЮнџЌPRлЩt4CX8;IVTUTPQR^irxЏЂУЪУКЮ{”Œ—xš•ЂТмџЪ*WАdP\˜§зАЄЈš‘ЃОЏЦЯбгУймцыЛчЧнсы_5kX[_QџџьщплыџьцщххЯуJQUUUNRmN6^LIECJLaK2FL\QVVVRNKILNKNNLKNKLNNQTWUVVRTUTTT`RTRVRRXUFWVZXLГџѓяяђё№№яёђђёё№№ђђђ§мВззЩЬОМОШРЉая>PNNNLKJNLKKNLLNLKKNLJIIJJFFHKLJJIEHIIIFIIJKJKJJKK[џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџОBRQPPNNNNKKKJIJKKIIIHFIIFIJIIHHHIJKIHHIIJKKKJKJJKLN>HQX^_deyaWU<^sxnha`oZ/W\\WV\`ixmo{rc\[L^rjIH\^\UFZ^aaa_p^ZZXZ\`ak^\WBCZg\VH\\h\\\ZZV[Z\\[ZVRQLL@@FFHKU^acdaI@ZLœ­Q=W^HECJPjdUVZ\[XQ&*nzn}m€d\->JNОџ}58XVWm^^aafhhXnznpqprvƒqqsqktp^>35;TеџОQ-Kvhmkkjkihgfe``^ZWRNIC@@<8;43202202/000003#-EIPKC@^УщлМ…ZA6QLFA=&3***')**-*)-)-**)***))'*/)'%&&!!)4>LdWemTH>-#!!!2###!!#&&&%#;=CKPT[| ЇЉ˜…id_\VPE)'`Вџў§яяоШВŸГЦ•™Ђ{ˆZ^mrnŸ ›˜КšЧТхУЪТёоЯШEhјЪW0\V@APPNPPXRtЧ̘ЙхЊхЋ™nŽs”…ЈЇухџ€aK\@`яСЃ”ŸŸЁЙДхусызЮЪпщмхиЧЫхёy;fZ[PPўџј№ъыяыщујќуСJTd[^Z3JPVXi0‰џо!HHFHJIFIJHJIFFI6I`LPRgfNIJLNPQPPRPLKPNNPQR^Rf>KR`f=PTRRPNQQWWXWUURTTUVVn>==>CNV\^acds\UCKyƒmiaQ`k;Ue^ZHX_inmoiePZL\mt[=Z^qZFU\_`d`^^ZEZZ^^a`_hZ@PX[^X8e^\Z^\WW[Z\^_^[ZVV^PJ>WgzZQPJKNL3HFKJKKNWHKXZNLLI8P[c‡e-h™hoUIB>===@>@CCIRej|jFE\cƒ–L6VcU[I3CJQVXXWZ^^kQ2%[v€htK8JC^Хзf*3UXZN^^`afhjxnopqrqnpqssvt‰sa=#B8KЋџџx%JcfzjzhiedKUaTc`^^ZTQNIFA=;8;63220200032##'0KV;05yЅяђЩ—a82CLEA%!#*)&i))'*)****)))'-***')*)3)*-''&&#!#!'4>NWZ[kVIP*!#!!!!!!!##%%!&'*!6QVXe=;KNPPPQd^PNPPPLPPRRUd3>RfU2^VTQNPRTXXTTWTTQVVVWT4Qf`QNKXKKNNNLKKLLLJHIJHFFIIJHIIFHHJHFHI_IJIHJ\JKKKLL[џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџС=>=>IRZ^`aed^WC<`k}kdQ`wC5ZgfUE\cƒpomzra[\^rr^CU^_^VV\^`oor_gXWX[^a``_jR6a\mZUX^^^^ZE[Zm^^``j^fXR^K8T[\fTPNJJN^JJKKLIJLJLLJNNNXJ@d_|o#@ƒ{aaXPHB@==<<>ACFLTegJIZVŽ‚JBWZWURNE/4JNRhZZ[^^XP;jZ38IEvѕЈ-&EWVXhtegrhhnponnzp|qrpŠqqszzL5688‰џџt>_mpheeddfdcdmk`__\^ZURKIFA=<8684220233##)5LHA/LƒвљџЄsB)<=FA*!0-*-*))'')'))-)&*))***')))*)-))'''-&&&&&-!!!'4@`W[^hWK>-!!!!!%!!%%!#%'&&'#!/F@=NaГЉ•eQQ\W;LМлњєхЧбзОАœЂДЈ‚Vp`owhˆЄБЄЌОЂЯКЏЧПВПопЮŒŸј“@NXP4PXw‡–ГЭУЈЋ­СЬО”™œ€‰€ŽЙЗЯЙыџх0B‚kN^8›ЧЖЄЇЇУХзмЪЪвф№сдщПсвЫХЈ-VX^a#џџњщђыінџХNV[h_c ‰„KaVZ^Ќџƒ8JIHIIIIIJHIFHHHHZ[LRWWg2KKKPPRPQPPLPPNPRQRUf^;PUiQPUVQTQRTTTUcWETRTTVVrAPR`d0P^RRLLJPLPPk=LTpLKLLLHEINz-4HLPTWZWRNJJIKILPKKKNL[NQVVVUVTWaTTTTVTURUWVUUZdXZ;џџяёё№№№ђѓёёёђђђђђџпЗЮЭЧУАОРДЭВЬњP^\KJNNJPNNJKJKLKHJWKJIHHIIHFFIIJIHJIJIHJHHJIKKLLJ\џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџО6RQPNNNNNLLKNLJKJJKIKJHHHHFFJJIIJJJIJJJNLNKLLJJJKLN3'щфучомлоссфањџџџџџџџџџџџџџџџџўњџчTgfea``c_aaaa``_^^____\_^^___``^WKCA>>>>><=ENW\`ceda\R8Xxmg_Qjf5Ve[XH\cjpqpjfc^\^dejVB[h^XI[`aadd_\XV\^_^aa`\T6Rj^fVVhj`igXV[Z[^anc_\\Z`P2Ph\sTPPLNNPNKNLKJKNLL_LLNPPJ@X\vqB/ЭЧ—Ђx[\RK4A>@>>>@ACIPRAVZ`…œUIZjZVRPPXH0CIPVZ\[\gjn^P@T\H”Ч„0=RTW[[Pddjmkooqnmppnp‚rd}ro|gQ@4F<`тџД4!@^`^`dfdcffe`na^`P_^^^XTPLICA><<R`fPP_WUQTRQQVVVUVRRTUUW_>PQhQLPR^PLKLKNP^P8>^d8LPNHCHLfZ5CKKQVcWUPJKKJKLLLLLLNNLPTUUUUWVTUTRTVaUUTTUTWWVZZLЉџєјёёђђђёёђђђђђђёџоАмЮЩУООЛГЮОРј3PPLLLKLKNNLKKIJJJJKHHEFHKIIFIKKVFFJFIIHIKIJIKLKKN^џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџОFTPPPPNPLLNNNKJKJJLKIHIJIHEEIHHHJIJJIKKJKLKKLKJKLLN;ъфмцобмпъс№ађџџџџџџџџџџџџџџџџџџџ0)fqecaadcca`^`^^^^`^``^p^^`__^^^dPIA=@>=>>@AJUe^`ces^XQ;nmomdRcx8E[kXUW`fnzrpha^^^_psZV\q€H=[џџЉ•ƒrefTJCBA==>A@@CH8QZ`ˆ‰KE[[ZVQTRPQRL54JPRd\ZZdRK/*EERЏРk3=RTW[^^aghkmqrrqroopnp|qrŠsI2BEVЙџЛC)^a`ca_Rceeac_`_^^_\^\[[WTRKHEAA=>>=85&*3KRe@8ZZKFEKPs5CHLPPUWWPJKJJNNIXJKNLLKPRQWcWTRTTT`WTWUVTVpVcVVXVX6џџ№ёђђёђѓђѓђёђђёёџнЂмЮЫУМЇЦРРЌЧџXPPNLKPNLPNLIKJJIKJLJIIHKJHHI\VJIIFFIHFFHJKHILLLKL[џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџО>>>AA@EPX^_`ec_XVR[jsZRF™џсƒjZ^UNFBBA==<@A26P[^p‘_>kkZUQ^PPQVhjP2JQTi[X^8U&2RQpбВ>5EPRTX^`dfgjzqprrtƒtronnmp}}w^**@@фъ|3_cnad`_adegffddac^^caP\_^XXTNJICA=<=<>//8=-<{ыџџУc050)----/*-##!6))**&)&')*))'')'*')'')))*)*''')''-'%%&%#!!!!!'6BdX\^^XJ>-!!!!!!!####%%!!!##%)'%&%%#'2345''240<‡зЙЃXA=@2NгСЮЙЌЙš—Ћyzfcf„’ŸЈБГУЗХСыРЙЧŒš|neZPP#2oё‡;FL-2ЄїЫЯЪТСЯЬйЏЭЬЊ…‹z–ЅдљЬаОУчџс!Hh\\\8ŸБВ•ЦУЮохнэсїъоофзфЫРБЄЏИ<XXW_&эџџыBWZ^^_`_\VEаџџоV[\5)мР)JJFIIIIHFHHFEECHJc=PTXjAJNNPPRPQPRPPP=PQUTT`d;PTfT5`cWUTTTVWZWXUURQUUUr=NP`_0QU_RPKKLPPgT;LUv;LLPIHILai3EJLPVXcTQJKKJKJNLLNKLKPQPWVRRTRTTUTWUVVUTXTWVWUVZKŽџјяђёђђђђђђѓђђђђџлЂЮнШТЧЛМТдЅЭљ;PLNPNLKPPKNJLLKJJWKJJJKKVHUIEFHIIFHHIHJFHJILKKNKN\џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџОFTRRPNNPLNNLNKJIJKHFHIJJJIIHIHHJIIJIIIJKJKKKJKJJLNP3уутцонмоъхђзєџџџџџџџџџџџџџџџўџџ\0hcddc``aa`a____``_a^`i\``^_\^^^ZPE@>===>@>BNU[j`doa\WAAy€okdUes;Fj\WC\c{qpnmif_^`egtZ8Z\[UF[rcec`^^^\^``ccc^WU=R[gfVIh_^_^[X>[_needdda^iR4TZf[RPPPPLN[KNPNPNLLPQPPPNK=_\_t\APQ)Џяи™„raVNIFEBA===A4P\c}n[JXWWUP@PPPQWZivT)2JNceTK-J8URПBFCRTUZ^_aehmyp}‹rrtt|rpmhhf_=)=8gвў 5#A[^cnecadwghgKdeecVe`apca`a^^XPPWFC>!-=A3*XЬџџмq#//-)///--**)**)-)*'')''''))''))))')))'))))*''')')''))%&###!!'8BPW[^^aLA-!#!#!!#!!!###%%%#%%%#&'#%%%&23400!X-6‘со—>>LB&qЗЮЙЖЁ™‡gvXw}gЏЂЛРвЄЙРниЏœŽ‘tg`VPP=5C˜ЫjIL3gШмЪлЈЙй№еЄЩСГxy‘ˆЏувоџдвлјё_0‚\Z[EzБЏЛКЙасъсъссспЙйіЯйКЋВдTF[Z^џхPV[^`ma_XVRд§пзџЛ6XZ\*AјАJJIIJIFFFICHECBFJJ`NPUk`>NKNPPQRQRPPNPPPURUVUP;P`i>BaXaTURTUZXWWVPPUWWio4LTnQ5QZ^``dt`XRF^}zofac…Z=[g[TFkin|spmfa^`dgq^p``_LX^^^fgeghgd_[W=Pc[eUPQLKNP\PPPPPNLPPPPNPPJ=QZ_‘\RQRQR5#ЯџЦs|eWPPNKFCA>>3LZcŠˆXAUgXUU^QNNPPW\at}X#/CIHVI/NWUДz3KARЖйМЈЁАsˆWcv}‹ЉЌЌХЈДЊЯя€sm`WTPJKNP3hЯЁLN^ЁблЩЧмЯпБЭеЏ€‹Ž{Ј•СОџчгеяяћ–![mZ\L_›ЋТЭЪслмдппфјоЩпвЭСЫ—ВДЯPZeX^-/5R[^m`d`[XU'ГєчгзђџšCdZ\-eУZ!JIIIHHIHFHFEFFHHNP>PUcT;PNNPRTRRQ^PP^RRRTWUh@>@=>=@BKU[_`dfn^UA=f…kfdpy0WgmWH\fm|vrpj`QacdgtZ>\o^EV^wqqca^^_``deggc^fU6V[fZWXia^^o[^^_fhishgfc^ZP>X[\cRQ\NKKP\QPPNLPNNPNPNPP)NоџџтU%*C%0-0///***/***)')*)))))&&'&'&'&'&&%'&&''''*&'')&''&&%')&&!##!!!!#'6B[W\i^kNN-!!#!!#!!'#!#!##%%%##%&&2%)/2320/0qЖОдЮ™p‹аъQ8@P4A˜УЏЙЂ–{vewƒ{˜ЊЉОООЁЯtW`JRRP8=PTWJ5›ИfJL<\нњОлуїЧЈлДЅwŒŠ„ЁОзЖбеоЩудыэЯ__[[K#UВОЖКЯщЯоъяуэјлйжиЦКЂЅЂМвRKUZ^X04J^\afd|\UR)ГоЪЮяуоэџhAUZ^*ˆМ0)IHCCHIEFFHREHHJIK`PLQWPL[PPPPQ^RRTPQPQRRVWVi@RUjT=eWVVT_TRWWVXfRRRUVXi4NQhQ;QTTQPJJLNPUP>Ph^6LPNIFHKsK4HJNRaXVTNKLKIKINL^KJLPQ_UVVTUVUUTRWUUUUTTVWhXhVVV<џџя№ђђђђђђђђѓђђџмЈмЯПЧУАМЏСДПј4RPNLLLKLLNNKNNLJIKJIFFHIIIHJIIEHIHIIJFFHUHFJKLPLL[џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџО>>>>@BAHQW^acdx`XT=qvykigg|L>\n[IKdvptrxe`Rdgi}_3XniXI^`gego^^[^cdefgf_\WBUe^XHW_k^[\_^^adrgghiedd^T8a[kXRQQ\LKNPLPQL=NPP\PPNNNJLV^qzEUeTPTQQT!HсјДXeZCUVVPJFKV^nƒX@FHJNPPPLNeePL^TRQLLNPPT}4N^m>KPPJHCKPq3EHLPRWWUQJIKLKLLKJJLNKLTRjTVTUUTVVVVVgTVRUVWVWVWUXџѕяёђѓѓѓѓѓђђѓєџнАщмЫЧЖВПабЖЭѕR'PNNLLJJLPNJJLLKKKKJIJIHHIFIIHIFEHIFHIEFHIJIFLNLLL^џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџОFTQPPQPPLLNLKIJKJIKLKIIIKIJJHJJHIIKJNKKJJKKKJJLKNNP4#ьфмъоммотфхдёџџџџџџџџџџџџџўџџPeegd`aacdca```__^^i^^[\_`^^_^_\dPE@>>>>>A@CPW\_a`ecZTAJz}xfXhq0ZhnWJ`tpqsrohc`ehisr@H[hmVKafffe`\^[_cdgqfa^Z>>ZgfV>^vc^Z\_`apfiigfggdq\AU[\eRQPQNNQ\PNLPPQPPNPPQPLJ;U\srVC^RTRQTPU>aвЗsdg^J[fgN;j\v…XKBABFJKKKLKLPTd\_qikn{Œ^6U_g­NXzFKE'L_[_fjmppqortrqokmhw`I5EH^Ш§3*LX[Z^[fZ^^_dfqhwmmmnq‚qt‡ƒ}tŒrqK356&Љџџђ_30%2//0----0---***)))')-)))'''&&&%&'''&&&'&&&'&'')''*)''%&&#%'*&%%%%!!!!!!!'6CZW[g^aNB0#!#!!!#!!##!#!##%##%#%%&&'0023/2dЄŠz’ЅЄЮгТџМ\xсз„)5B@!zЅЄyprz|tЅДЃЅ‘x”j_XT^\Z[4ЙгзжђсжтхщєфођйѕиЏШœЏЈч№™'Rcf[V'BFIFIKIIJJKJPc_UcWWQBVWXZVTVQRWXZgP>R`U0Q_VUQLNPPBqP=PUc-ZZKHFELdJCFJPRWdWQPIJKKKIJLKKIIKPRVUVWVWVUUUTUWUWVTQVWWTVVUFџџ№ђђђѓєєѓѓєѓђџоЋсЮЪнСАПУХЬСћ>QNLJJKNNNZNKKJJLJJFHIJJIUIHIIJHIIFHEFFIHIJJIILLLL`џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ­BTPRQPNNLLLNJLKJHIKKJJJHJIKIJHHJKJKLJKKJKKKKLKKJKPL4*ыхфпннмпптъжљџџџџџџџџџџџџџќџлPdeeacccaadaa`aa^^^^^^^^``^_\^\\UH2@==@0ITZ^`acn`WR>nxzmVez€6E^_\J\h}rrsqxfdaftvq[;Z^^W@_eqcaaPJ`_cdggdaagT5UekXH[kcm^^`a_cfgjigWgdnhBEXm\UQTQPQPPPQRQRPPRPNPRRLJ2Uj\wWQLPRPNPQQTRV{­ЏP_neczU8V^c}[L3'=@BFHHEIINQUXhcfikjvW4Vpo™‹LIgЂ\`QH*Lvthwn‚poo{srqomsx\<>KFъЫP&B[X[[^^B\^`_ceXjno|‚sqqsrs[ssqzyL'-&>УџџоL8=JB!3/0//---/-**))))*))'-)***'''&')&'&%'/&%%%#&&''''&)'&'))&''%')'&%%#!!##!#%2=UmhjhhLL/!!!!#!!!!!#!!#!#!!%%%###%#%&)=222-=}Ј‹„ЈИ—ЉћтЭЦŠUоџЌH5>>*/}‘mmswo‹Б–šPnaIPLIILUqdnospoj‡=BЂ‰VIP!ЙщџШВЖб›ˆz‹Ž‰ЄЧОХыъдРотЭЩёџ\X\=Пєесэосыххх№самЪВУЃ‹•ЮўШ8ch[dW5dtUQP%šСЇœЧЄЦснсвЯьлTXj[=m<3HA>FFFHHIKLKJKPRQ5wUqUAQQPRRPRTWUPQPRRUVVUn4PQfR3UXWXTQTUBddZUaUUXdWe4NTnQ@TQUTNKKPPBp>=RmP>>=@>BLW[^maca^UA[|qpmgh€_'ZirZBdj{rsrotefghjtw=X^_Z>[aqhfc`\^aofhhgfd`Z6QZ\ZCXpa`c_`cc_cgZjkhfeaoE;X\^XRRQPPPQL>PRPPQTQRRTQPL6R[^rWQQ2>^QPNPQTTTJ#ŠёЮzftg^HW^cƒ[A5A<=@BBCQFEINRVWJdfgkkzN2VQˆВvA>[esdP[hR5Pnfmnprpp`donkrcK0CLdДѕ}43XZfW[\_^^`eydhjjjosfxywrvtywxrjvH//*UйџџЋ24FIVZ!2//-Q--*-/-)**)))))))*)*)''))'''&'&''%&&%&&)''&')&)))')*)%&)*'''''&&'&&&%&#&#%&&0&>C35PXX>0%#!!!#%###&!#!####%%%#!&%&')203200“Ћ•{sn€ŸsšЇйЊУчцšK0ЭџЖR%EH20cztn|tp‰œzmaXPNKIJR^kvj‰€{^pXzО‹iЏfPP4zчџібО­Ёv|ЁвЅЪбщдтеаЫЗыџВ2LZW^6šџомђосѓфуьтмжЙУзЏЊЃЫŠ-HTVXjXBVP<ЧЗГ ЃЋгЯГЫЙяемнџЛ2RV\IEˆV2ZEP0BIHIJHJJKLL=Pj@PRVkCPPRQRPRWWTRQUTPUVZWhQ>PVrBPVXZWRR_RWZWXXTTQUUWU;P`_5QUW_Q<5LPPTR3NTf8JXNIE5K`X4EHPQWXV_PHIJLLINNILKJLPUVVaTTUTVUUWUTWWRUQWXTVcVXBџџ№№ђђєђёђѓђ№џмБмЮЭЧТГРСиИОёN'PLNKKNLNZLKNKKJKVIJJJIHFJIFHFHHIFHHIEIIJFEIJKKLKK^џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЈBRQQNPPPNNLNKJKIIIIJIIIJIHFHHIIILJKJLKKJKJKKJJKLNNP05щщщємиЄнсзяЯђџџџџџџџџџџџўџџэPdcd```c`ca```__`^^^^_`^_^^\^^^[TJB=@><>=>@Fc[_a`a`[dA>dqk[z‡[E\o\=\iptsrqieIcgvjzN=_asXJ`dgid_\_aagfhsfdmgEBc\[UH^cnca`ccccqihjjghfcf;V[gnTTBQPQPPLPQQPQRRP^_TPL>=@ABAACINQVX^dhgz[;WRnО‹B0La_c_^[kcRIR€ynzqt…‚a<4PHyпКZ;6HU[[X^\_ccfgjhkkmpqvxxzxxxŠ—”™{N//3Pєџџš)*56B@BUH`80/0/**---/--*-**'*')*)))')&))))&%')'&'&)&')'*')*&-!!!&')**<-@@>=>@@A=@A=<;)*-#!%F*#%!!!!#!##!!#!###!#%%######&%&%%)2432!IХзП…‹ƒdw}—ЖСŒРбзИ‘_-ЃџъN0@K68^v{j|wzwkcXPKJFTHFIFHJIIKXKPKPL\KNRhj=NQPQPTWaT_QTTTVWZXWj=LQgW3UXXWWQRRWWVZXWPQTUhgALRfU2d`UPQKKPNPwNKPmP0LNNHCHNq3BFLPRcZTP><=<==BLU[_`am^XV8Lƒ|mggˆ`)^jhW>fnsrq|fedgkmyk4[zƒ^<^oitge_^`cedghhc^_X8Ue\WCX``cdaacddciihjggge_=EXf\UBaTQTTQQQRRNNPPNPPRTQK>a\^qTANPPQUTTRUURTQUE/2ођД}@=[`‹_>@@@BHZTXgmgge`L4X`jœhF)%ENWv_^Z[eV^<Ezikopstqnh\4A>P н”>-HTWXZZ\^^`dddjjkoppqs€xƒƒyxxyvƒwK%3)Tњџџ0AHKH=-00*----*----)*-*)*')*)))*&')))''&%')&)*-##%#*>ACEI\^__decpdTmg^d_`af_eqgkj\ijad[PPNJHB>;&!#&&%%%##%#!#!%!&&#&%%&%%#%%&-032/8iдВЙЄЉz‡eci…{Љ ‹ЫОЅЊЪЬˆŠ§уjLNA3[`gh\t`[T@PNNCPPЂЇКЋ“–„kkŽжРйˆtЅUP^%ЛиЧоЧЏЗ’tŽ‡ЉЂТЮвЦвтаЙЩЛлхќУ6[\[[HїќумвЮћссђмеЫЮРп|IXPK=@`Z[eU3џјЙБЃƒЊЉаШЬмЬМЯЮЭЯЬё`FU[e;TNIFIIIIEIIJJLPL[PPNLe8PVc`4L^TRURUTRTVUfUTXVWiV;NUpV6aWXVWTTTTWXXUTRPRUXf@NRiPUm2XPZIEEL`X4FINRWXWRPKJKKIJKKNLKLJPTWXcUURUWUWUaWUUUUVVVVWVUW3џџяёђєєѓєєѓђџъЏЮЮЭеТООУХРОљC&PPNLLKKNLNKKKJKJFJJJIIIUHUIIIFEJHJHFEIJJJIIJHLKKN\џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЈ>RQRPNNNNLNNJJJKJKJIJKIIIJHFIFFIIHIIJJJJJJJWWKKJPNL00ъщуцомлнусудђџџџџџџџџўџџћџэQdea`_aa_a__^^^^^```_^_^a^^^^^\ZeJCAA><<==>FR[imaen\VRHˆ„oWh}v3FzpZHawt„tqmideimowfII\nrBAcghjg_P^afhihgpc`\REe^[UVrrdaccdedefihjzgsgrWAX\kHRWZaRTVRRRT^PQNPPQPNQL>UZnmVPP>PPTUVVRUeQTQTUF3[јхR0\^m_IJXUJB>===<>>@BFLRU[`wf_Fa\h^ZXZcT<TŠkopnpzoN4;Egдп[5BVRUVX\\adcedggxq{|s‡tvyxyzxt‡ŽtT*#&PсџџЁ<\WPJEA=@AEKKE&!0////*------*-**)**))**)*))-*'')))&#%-@CHLZReaXd[[^\^_a_p`o^^^hoqzt_``^_^[^\Z\\X\ZXWedj__ZHB=)!#&&%#!%%##%&&%%&#&&%&*2333;•сПМОЅ•h”fxxqБ{РУЉДЄРждœ‰џпW#BLE3X^__[VRLQPCNn|ГœЇЩЌВ”ЙxtXŽВˆЏщб&[ŠoN^4wсјЊЏЌ‡ŠŒˆДВРйпИвтоВдПЭЮбхм\Bk[\P}џмёйЯыснбѓхЭОп€KTfThU4>Vd\jB‘џъгАЇ”ЌЋВ­ЃЗЫЮзЯЭтРдЧBRUiXPNHHUJIHHIIJKZPPP^QQRQPLPWjP@cTTUUVUTUUAUUWVZZXWR0Pga6TcWZVWUUVUZXXTPTTaWcPNQ`_'c_R_T=TrP0N`LHCFKj6CJLPRddVQJILLWJJKLLLKLPT`UcVUaWWWUVVVTVVVVVXXWUXdKЈџіџђђѓѕѓѓђѓџоЁЮаЭеСРЖЦлГПѓE*PPPKJNLNNLLLJLKIFJIJIHFHEFI_HIEFHIFTEIJJIJKIJJKLL`џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџС>TTRPNKPPNLLKKJKJKJJKJJIJHHIIHFIHKJJIIJJJJJIJJJKKLL2-ъпмпммЯсђфудђџџџџџџџџџџўџџkVcdda`_a`c``_a__^_^_^^j__`^^^^mXPF@A>=<<>>APa^_afvcZU=QrpiZi^;[j_ALzƒt„sqmddfmoo{^;ZaqZK_fihsda^acgiheea`^TAXp^WE^acccedfgfhziefjhho^BW[\ZEUdVcRT`TTTTNPPNPQQ^RP>QZ^qVCQ^QRR`VaUPPTPTU`RTV*q\_}kABszgQJC>>@<<>=@BFPW^tdp\2ZUŸd8VpRJ43ENUe\ZWX[kTK!B}‚‡oia>AEEєГ=#!#'#%%#&&#&%%'&&'-233#KйјРмнУŸ|‡—vPrgŠЇЃЊЉЈВЋЈЈлаД‰џъ\0JIB8VVkTPNRWIg|›ЈАТяВšА…ŠcŽЖ Јзхѕpz|P^P#ніПУˆ€y– ЏЏШхзъУщОЮЯлсЯзнмPBeX[>WыјсЫыбоЯЮЪџђsP`Z[JkƒC)LhV[^КџмГˆ„ЂЅ™ЖЧЯШгЮлЭЧРЫйЧ4'TVd`26IH3IIJIJKKPPRPQRQRQcLPTcW6QTTQPURUTVWTUUUUdXXy=PRaU3fWjXVcVXXV[ZXTTTVWdcP=efQPR@_RPKKPRTg0QWh/J`[IFCI^L4CHNQVdVRLKWKJJJJKKKJKLRPTVVWTWUWVWXWWVUWUUVWVRWXW3џџяђђђђђѓѓћџмЇчоЮЧТПхУиСВџ>*NPNNNZKNNLLNNKKJKJIKIJHEFFJIHJIHJFFHJFHHHJHKKJKLL\џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЈEURQPNPPPNLLLKKJKLLJIHKJJHJIFFHHIIJJIIKKIJJIJIKKJJLX/ыъхчомащффхаўџџџџџўўўўўџџ№Hcc`c`_`a```_a``k^_^^^^`___``_^fTIB@>A>>@<>HTX^ccde`XFBxzzn[\y)Vg_[@ezssvvqgNfhzpntAE_|i@Nxhighc^_teijhca_\W8a[g[CXpa`cddfeWgihihfhhe`=FZ\XRTd[XWVTVV`RT>BINtF!3220-///0/----*-*/*/*-*)-/!!&@CI^RXZ_acfˆ˜ŽЊ|Š‰p^g\ZXXWTQQQQ[NNLKLPNPPNPPP\QUWW[^^^pv‚zqio_^^[[W`fc_TCXZWXZVXWW[ZXWaUWXZ[f5PTh=f^QURPKKPQePPRxc2PQPICCLp3CFLPUXXTPKJIIKLKXKJ^_KPQ_VVUWaUWVWTVVUURWVVTVTWXWZЧџљёёђђђђђђџЮ мЯЫЧЗВСУЮХеџI3LNNNLKNNLLLPKXIKLKIIHFIITHIJJIJIFHHKJHFJIFHHKKKJL\џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЈCTQPNNNPPLLLKLLJLKKKJHJHHIHIFIIIKHIIIKJJIIIJJJIKKLN2/ячмчолЮчуффзѓџўџџџџўўџўџџx)fdac``_``^aaa`^____`\^^`_^_^^^^dQEA@>=>>>=ENV\`acdm^U>`|nhiw^;Xh^HI{|rtˆrmhdhmp‚^;\kjK<`zjhhea^`ghhhfP^h[CCd^ZHI^ccedecdfihgihsgggvJAX[jUFX^XZXcUTVRQ^T^RPTT@LK;U\zgHTTRRTVUUUUVVTUTRUUQQPKsw„mW_ZPJA>=><;@AEFNQaTBZR}ЁsCXЧЪZ-AVTUVTWZ^acchhoonqrvqqsrrtsxŽxN'=6ˆџџО4fi}jjaZVTLFB@>@BEI[J40/0--0-/0----**/-/--/0&2ENRXN^TN‚‰ВЙЏŽ—d|_[WTQPNJIHEEB>>)'8&4#3!4%##%'-CEJ64438@RVT`ji{t‚ˆ||j\[[[WfaVF@*''&'&')-222ŠўёъщЬйЌЋЏ…ВWQTst“оЃЏЉЈЌВДЖа­иуЅЅ№ЃF@_V5A@PU`qqЈЂ›ШзЙсиИЏЄœ˜€‰Ћ’™мОЮщџ66…„R_8ˆЮЪЃ^ЋœЇДбЮЫлЮЮхзнЛсовмфЮЙ}6ZW[P>ђџђъмиџџДPcfgZ^_dah25X[^6ћиЏЃ {ЬЈОЮдЖзЦРЧЏšЏХr*RTdtP8IIHHIJIKN[PQRRQURUTTQ@QWkQPdRQPTTUZZXUWWTVW[\mQPTmh-QqW[\XTVVZWVWUVVWZ[h=NPfU2RTTTQ=JPQQk;PT^3LP[IFE4sK4FFNRTVWRPIJIKLLKKILKNNPUTUWWURVUUTUTUVUTTTU`UUWVX)џџ№ђѓѓђђѓѓџъЂзЮеъТЏГЯУССѓ;*PPNLLKNLNLLLKLLJJFEIIJFFFFFIUFHIFHIJIIHIHJIIILJKKNџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЈHTRPNNNKNNNJLJKKIJJJIJJHHHFHHHIIJIIIJJJIIIIJJJJKJJL0%ящмчнлЩчфхцЯѓџџўџџџџўўќџџEeea^_a^__^`_^^^^^`_k`^\^_`_^^^\VKC@@>>=>=@F^X_addc^ZF6yƒƒjZ\x2UghZJhƒxwvtogfimnqof=Viq^@Iotkiea`adhkjhfa^gU6V\fXH[kddddaefhvjiifhght^FVZ[UFWh^^[ZVVWfRTRTRRTUUcL=Td\gWTUURRRRU`RUTVURTURTPQK>TZ`vJ*}У‘rwme^aNE>=>=<>@@BIKN8Xahg5J@‡ТЂH2HUUTUVVZ^_trhjmn{rswvr}sqt‚zt`;50!^џџТ%*fszkjzd`[WQJFA@A@BAIco>320000/////--0-0-/0!!-FNUXTNVp•ЉЙЃЁwdRJICPKICB@*%8%#'%''&#%!!%&%#!##&/afЁЄ3HF2/@BFKLPUXozz„|a^[ZiieaTA)%#)'-3364ЖѓйЩЗЙфРгРГ‡hPhkeeЋЙЅЋКОВВГАЇШпЛ™&ЏџšIL^X>B\t‹‰ЊЈДъсВКоЂДЌЄŸЂxЈ•сРаДјў•wyR^IBГД€’„ЂЏдлтяялЫХдУзфыгэоМЏ‹#3X[[P'џіумйјˆPVo\Z^j_[WCУ*XX^24№У˜Ћ {ЩдУвлУСУЄ­ЅŸЖˆ`5PVdgLIJKIIJKLJPPPQRUUTTUTePNRXWPPR_RUUWVZXTUWUVVZf\c6QXra8XZZkZURWVZef[WWTVXWf;N_fAPTRVTPNLPARQ=PdQA@@AKV[`ddw_[W>`…|k[hmˆN2[h^5No…‚‡wphXfmppz|^0^akX>mhijhdaafikwzhdcje@R[g\>Jpdedcdehiiijhzhhhqq;FZZZTIh`_^\\VWWTQQVVVR`TTP>TZ\kVRRUVTVUTQUWUTTVURPRTTP>=<=>@CF>V_t™dKVXVRPNPQUXcg;4EKRV[[Vh_3'%KXNŸџ5ARVURRUZ\^_Rdijhn`p}rrƒve‚rqŠƒe4*3&AхџѕW)Wgyjjhggd^kWQJIC>>>@BHNfV4332020000000//0##)0LUPCFRˆ›пдК’eaKCPNFC@<#&#!00--))***))/Б#%%&!###!!!!!!&B;BP^si=FB#'&#%'=BIKPRVevƒ•fcR^\f\WE/#!46VяёщзЯКШуТТ„‹ncXhnx•“™ЋБЊЂАл‘ЧЈУмЌО’j2HОѓ‚@UgC2hЈ››МХРУУВ№вЙЄЉЅВ|Д”ГЛлЬЯўѕУe•`P\*;ЇВŸzšнзгсм№лйизжзеЧЯХИЈЦ‡)[g[^3№џџџPaZ\\\jo[V>/џџЙ#X\_%PіЛ”ДЁ–ПЙЮЯРПОИ АЂА ^nT@RVk`LJJJWLNJKLPNPPUWWXVURe@PVki5R`UVTVUXZXTWXVFXXXZU5QZmAUrXXZVVWVVZf\ZWVTWZqB3QiU2^VVVQP=PPRo3LTc8KP\LE/FX^EEKKRWhTPLK`HJKKJLLLLKKPVVaTTTTUVUaVVVUVUWUTUTVVWWџџёђѓѓѓђњџщЃиаЪеЄЛОУлХШѓBLNLJKKNNNLKNKKHIJIIJHIKHEHHJIIJFIHHJJIIHIJIIJLLLI^џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЉBRRQPNPLNNLJLLJJJJWKJIJJKJFFFFIIIJJIKIIJJKJJJJLKLKK2CяђоыомЧпяфэвџўџџџџўџўќџџ!6fca`__`^^^`_^__^_`^`___^`_^^^^\`LE@=>>AAA@HRX^ra`c\VE>yƒ\fiƒt'Uo^X@f„‚yv}mgfgjpq|d5Wj\B`whseedddimmjggfc_V4W\oVWideddeehjjggijjhiiwK=c^gXERVVVRVRTUUWTRT`UVRQQQNRe^{^<=оћХ•’ymnXTLEBA@>=<<>36W_|šcBWaRTPLNPRd\^nX-2CJPphPJ%%P[eœСp6>QPTWVZ\^^`eefjjkyoq‚dnprtpzˆgQ34=4џџi!Cc}rsghfdc`[XTPIHB@>@@CCFJA5222022202002%#FPJ8BN}Тџѕм€iJ%!!%**-/*--**)&)))'*/&%#&#!!#!##&B>HTm^XPEK0#%#%&'''%&>>=>A>3N`\`cad`ZTB_„|n\i‘L>\^[K`ywzzxpXefinppsN;^ajLJ|shgeTadhwnhggdccoARdfXHZkccdegjkxkjihiigzzi0VefWC[rd^^`_ZZ[XUTUWVTWXVP5W[^[TTWXXVWRQURUUQRTRUVRRQNBi[pnUR3PЯџ™’|NP[UQKEBA@===AIV_y’vKRU_PPLJKPTX^qsqx4CIZsL*6JU`kЁd6CQQPUVX[\_`chiknoopoo}rrWp|{c83@<^џџЈ#Be„caeccc^_`\[XTPKHE@>>A@BFQB832222222!%%*8QLBA\ЅїўјЏwF42JUZ^[RHK0!!##!!!!#%#'&#!&=CHPUZp“ЈškNV^ZdP<%€јџџџтђЗлЯнУ›Œ‚ƒmQgoz„Ё­ЁЅЉЏАВЄЮХЉvVc_C;N'nъСKNa6aЬнпжхЂЪйбЈД­Кœ…{МЉЄАщъШщЯѓџpˆzP\Kv™БŸ‘бРхЬиімйяфижебЭСЙЛЉЊ„6\^i^;–P`[^^`qiXT@>џџўђџџgAU[^“аОzš›˜Џ ЉРГЏКœyfoR4K_KPQWjQJLLJNPRQPPQRRUUUTTVX`@NRkj8QaVTVRTXVWXXXWWXZ[[j3PckC@kZ[WUVTUVZWZZTTUUVmQ<^`U2UcWTRNQNPRp;Lhe3KPPZIEI^L4EIPRUWWRLHKJIJLKIJNKNNPUcZaTTTVV`VTVRVVWUTUQUVWXXџјёђѓѓђёџчЊиЯЬеТЉРсУСМјP&P[LLLNNPNLKLIJJKHIEHHKIFHIFCHJJJJKIJIFHIIIJJJJHJK[џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ“ARRPPNLNLLLKKKJIJJKJJJHFHIFFHIIJJHHIIIIJJKKJKILLKLK0*фсхъоммщтсузњџџџџџўўќџџ63edc_^___^a_`^^^``^_`__^a___[\_gaKC@>==>>@BHQW^cccc_XAHhzro^nŽq*XnhXAj…yzzvzfdtkqpn@W^oZ=`xhhed_aekmmjdaec_V;cXdUI^aaaafhv{mkiihkviir>;XZeUJafec`a`[ZWVURQVTVXVQ>)3U^dšcFBQQPPNKJLQVW[`egzx5'/0CI8a\NqОN68LQTVFX[^^`dimonpqamoq‘nkzeE)<=AЄџпH>P^cn^^``^^\[\Z[WQNKHCC>@A@>BEB=442324%%FAK=;aЇџџќВ`-4>>F>8##--/)*)*****)**-*-*****)*))-&#!##!!!%#&!#!&B=LV[\fUHK0###!!##&##&&&'&*!!&=FKPI_ŽЏПЏ}PKRNA-ЧџџџъЮРШЏЂ–‰Œy[Z\qm…ЅЏЦЌЖ­ВЄЏЏkf^Z^IJJ=)>Љз{IaJ4УэќЫЫЭщаВЭœВ ЅzЗЌ›оћКъзвџёАzŒ_[[*eЁДЉСЦђвхъйСмуЧсзщйЩОЖИЙГЬ5^w^^BHPg[`tT^[TPфџчпфјџџVV^Q!ЃЊ„”™ˆОЛЏЧПЂ•…sCKIKNKQTcj\im>Zvvjhgcapskjjjea`p[AVj[TF^ycaeeefgkgfghkijjv\;UdXVI`ofqpa_i[ZWVUURVVU`TV[^pUPLNQIџф€­—k^W`R^NLIC05^^ƒmULJNPPNJJJLRUXZadsvƒƒ3&/;[HtзwA&#X^WX\^_eghjnnpopr€qpcr{xp^A555xџџy%FZ\_k^^\Z^^^i\ZXXVRNJFE@=><>@AEPK4345%*6PLC6`Єџџе’B!2652'#/*---***'))-***'-)--*-)******)6'##&##%#!&6@NV[^mVIA2##!!!#&%&##)%%''&&''&'54;F™РМ‹Q>QUh`>LNKPQPT_RQTVVTVUVXXVT@PWpCQ`VaWWXdWZVVXWXWVX\i6AahV4cf[X[ZWVWZWWeXXVVXdf4PUe2QpWUTPPNRWz5L^eNLPPLF4H^K0FIPQUZX_PJJHHJKIJJKJNPTRTVUUTXWRiTRUWVVRUVVWWUWZXPџьђђђђњјыСнЯжеСОЊвУЖЯђH2NLLJLLLLLNLLILJJUHIHJIIIJIIHHIFFFJIIHJKFIKJIIJKJKnџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ”BRPPLPNKNLLJKLIIJKIIIIJIIHJJHIHHIIHIIIJIKJJJJJKJKLL'5чфгэомлъпосЮјџџџџџўќџџE6eocc``ca^^^_`a^`_^`^^\[^^\\^[\[WKC>>><=@>@FPX^_`a_^WR>yƒq^koq)VgiZ<|zzysn\jhxop{c2Z__W4aywkgddcejjijifoagBQXfXEV^cTegjjfjifgikmm|€q;TcdX=ZsqWdgd^[[XVVWWWXVAUPAW[\[VUXVVXXWTVWVUUUWaUUURNKRZ[fWQPLLPQ6ВьГ€q>FVZdUQc;-P[`ЁzFRЗџЮ)%_r^ZW\`_^[[Z\^^^\XZURNKFC@@=>@@>CCB'0=>E4d“џџщP;>42)20////--**))'*'-)-**--*)*)*)***'')'-&&#&#!!!!#!!#)C0ZX[^^WJA2#!!!%####&!#&%%#%%%#&'''&0#)/8CCkОщб‡P@B<ВйДЭЁЉˆznfXie ОЄЖА­wŠ‹dIPNJFIPRTVV)2jЙ‰[QJ&СђщызШз­БЄ›mЙЦЏАЪнаащмлх№хUB|^[^2>Š­№игйщолЭйхёъщЩхйЗ‰Љ­ЏсъBTdkjU>QRW`q[UQ-ЪЮКеъс№ьхщџс-WXg=J“z ЂŸ ŸДЄЅrz^6KKLJKNNNTVkT=KPPRTRTQTRUTVUWWejXjP@Qaa4QWVUVVXWdVZZVZXWZ[k`>>2LV\_ca``fT8`oXj{ŠF>\h\BU‚xwvtrmhjjprprL>msg@Nzjjjfadejhjkfhdd`X)WeZV=\`aahhjwhighijknpmpHFWXXUKmgfgshf`^\fVWWZXdXTR=@A@BCBE0;C>;<ŠўџјЂC/64#%!0////-----*<*)**)**-B)******-)***-)))3&#&&%!!!!!!'6@PX\_^XLB2!##!#%%&!#&&%'%#%&%''&%'''&!6%!vЗыИ‚53EA#2–ЙзГЃ˜‚inXe^h…‘ЄИŸЊЇ[j^CNXHKNV^^^\\P)6ˆЇnFP*‚йџќ­ћВ™ЉЂ™jƒЄ’ДгсУКгйъыльч„4p^X\<#|ноцЮцсоъЪаынЧоаЦЛ–­ЙСДхњB=Um[dRCjiVXTP*УвКнДаёсуьбыџŸ>V[g2jŽЁ•Џš—‰Є€‚daAJIHJKLN[LPPWp@JNPTUURTUVUUWUUXZZXWV`Z[[WXXXZ\p[XXX\^Xj6_zthjkjg^[^^XWXXWWaR>AX\\VTWTVWREUXVVWTUWWVWVTPK@W\^XRRQPNPPQPQ!NЯЫ `pXP`y^/A[_|€U8A===@BAEFFLPU[^aeggfeo`HF[P—Ј[3PŽc[[c^L*0h|hjjjkxnmjjnkmnie[06LNЊџЅ56IZXVZ^[XXZ^^^^\^^`^[^ZZTPNHCZ@=>AAB505HF0^жџџЖN!486*%%44000/-----//0/<)*)))**/****))--)*))'*)''6&#!!%!#!!!'6A`X^\hcNC2#!!!!%!%#!%%&%%&&&'%&'%'&&'')-!)RLhляЙN/>P2!|ИЏЗ­}smIdkxˆ‘Д–ЄcJ^XNIJ;LE\z|eRos6%_з™EPJмџжыУЪВДœ‘ŒХШ™плеРЪъїџзѓџœh\ZiF„убпсіуѓоШньбѕЧЩЧГšПВзяz#HeXXiVTfAL28š™РˆЩИОЪыђфхїњџkFX[^&p€œ‘Ѓ™šg…gF=HFJJLLPQRTUUTUWUVTVXWeZXXX^4PVaQQX[[XZUVX^\[[\W[[^mk=PakCQXXZZZWVaTXXZ\WTVZXgded``_`_ca^_^P_`^^_^^^^^^^^^^\iRJB@>=<==<>ITX^ccc`^V2`…„njkz‹P8[^mIQzyxtnn^y€||xCI^ihAQznkhfefjnnmmjhfopV4W\eHEic`egmxonjkhhkhko|p<>>ABCFFNRW\_sfrzio\>>Qj›”d>C[^^\Xei_L)'\}j\himjkvjjhgzrH3@@k№фd->JHWZZ[^o[KL_^qm_`m``P\^[ZVPJFBA>@B22<30pѕџњœ0%E6/&%42200000///-/-/=---)**-*-)))')'*-)*))**)))'*3&!#%&#!!&8AQW\^^WNC3%!#%##%!%%%%'')&&'&&'''&&))'*-#-€јО‡>Њіќ}36IA!PŠСŸtLTXqk’™™ŽpdZWQKIJNV^ZqƒmfXjŠЂ`4ŽeFQ!ЊџѕЯдДЊ•|€МТЗЭЧЧЭЧлуџШЦѓёО_o^^F јоѓџЭязсЭщпщуРДУ–Йѓ*4QghU4LTUUVVTWWXTVZXXWHXWa5NRa`8VeWZVdX[^^[[\XX[^^oU5Qcg8W[[[fZVUVW[\p\UVUZV^/@`_2RcXUcWPQUVy2NTg;KaQP;FIjH/FKPRcXXQJHJKIJLLKKKKKPRWVWWXWUXcURUUaUUTUTTVVWWX^лџјјђђџђАЮЭЫЩТЉЮдЦЬРј%2PKKJIJLLLKLLJLKJKIIHFIFUEHHHHFJHHIIHHHHUHIJJIIJILkџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ“4RQPNNPNLKNLNKNKJKJHFIJKHIJIIJHFHFFHHIJIJKKLJJKLLKK4)щозномлпьсщЬџџўўўќјџdcea`_`^^`c_^^^^__`^^\^^^^^\[\[cPB>@@><=>@CPa[_cda_ZF>{‰rQZpŠw)Uf\KBkƒˆxs{mnqrrs|_<[`pXBxxjfdfijznnhghhoZ4Qd\WU[zpffjjnmm{WjmmmmyƒK-Z\XTFstx^jnkf_qj^^Z[WXZWT5Td[XRRVXXWWXZXZWVTTBTTCTTN3Te^^UQRQP\PNPPPPN8qъЪŠiy„\3e\qpV@3B=>=<>A>@BHKTV\caVehy>>NU­оF5)IRZz^XW[[`Q0)w‡}kimkgghzpq[F=IKјВIECWWWXVX\_ka`_a^`ctdeddd`q`\VQKHCB3*;<<QйџџДa)42)#432230323002//022*--/**--)/*)'**--**---*)-*)))')'#!%!!!!'8B`c[^qZNC3#!###&#!%&#&&&'''%&&'&'')))*-*-0!6xхоџџМsVяѕКV2FEEB‹ЊЁwaTgmrxyoe\FQKLFIQ_jw|”zpi^tzŸ’*RЃƒKRC@жхиЗТ™z|›ДˆЈОШЬЮепџЩЧціўХ^i^^AЇщє§эиђџут№меСсШУИЪnJFI8=>=><=@H^X\`dda[WERˆ}p^k€ŒQ3en\IUƒ‚zywrqrptssx>;^q^HPhmkifgjoonpmkfhhtU8Z\ZUJaeehfhn€k^kjixnjm{sPXgpWRP>=<<=@>CFJQX\moedtj2@Qi­Јi82'EIRj^WVZ\jVR/ozmn|jgifc^I2BCQШй{43JZjWUW\[\^ddVeaUUWehhhfgec`\WRLIF558-_ъџџП&22-&%33322322220020-00220----)**)****)-*/*-*-***)-'))))&##&%!!#!&5BQW\\\iPC3!#!###%!##%#&&&%'&&')'&)')'*)-*%eБьЩзпѓђђЉ6%Њђыj;I<%KtŠ{N_gigq`\TPPKJI;KizЁˆˆ•yqo`z”ГЭp%}ЇU^_КтсВЗ ’‘”ЇЏЙЛЯЬЗъхязШджфоК;Aq^^B‚ђџїслязфтслгЮЙзЮkNcTViANUWZk82џџоПВЏ‰ЛШплп№тояѕуџš=@><>BNU\^cdcjXF>s„tppsŒs*U^o\2w€„{ztoqssvvt|cBBIPc\aUev\>I^hЈ™CET[I0CKPXmWVZ\[hQ-&r€nkihr^C2K@xЪм@*HXVW[ZXZ^^dRwivmzjtkxomhhjifdiZRL;45&0yџџџ™6=#44333243220200//0/220/F-/---))/--)--'-)**/-/-*/-*'))*%##&%###'6B[XZ^^iPC2#!!#!#!###%#%&''&'')''))**)*//%&nЉŸ‘ЮЪчѕынЙy{їў'0QJ/@^m\^o[WFTNJKKJK8dxƒБ‘Јzvah™“Ож­5XˆdP`;wхЬнˆ‘’{ЉСжъЧбжхзСдуєзей_Ki^^P`ї§ь№хысіёцихсэ`0PfdXa‹88NeWj\ѓџфРЙБОЏДЧэлнньгмѓСпјƒEUZ[6d|q„n@KJKLJIKKLWLJJLK_;QVkRPTVWWXX[[XVVVXXZXWeZaA@TcV4gWZ[[ZZZ^^\\^XJ\Z[m>NVgTQZ[[m^WVVZ[fZ\VWVUZhANQi_AR[[fXURVVVT;PgP3QRPNJLN`0BIPQUWVRZ8LWIIJLNLLNLNTUWVXUVWWUWTXWT`VWTWWWVXWX[Xџћё№џх‘лбЯжТЛДнЮСРџ3&QNKLIL_KJLJJJKKIJJHFEFHHJIFJUIHEHUHHEJJIJ\HKJILNKlџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ“@TRNPNLKNKKLJIIJJIKIIJIHFHJJKIHHHHHFFHKJJJLKJJJJKKJ38цтвђлщмсоонУљџ§ўќџџ@3ccdc``aŽ_^^_^_a__^``_^^^^[^_^^^WLE@><>@>>BJTX^`cdd_WEPˆ…q^o„—`/e`oAW‰z|zwractsyxs€C>\tz6Q|nijhgjo{ponkghfrWBehmVW`fghkjiivgjjmknzz‚`;X[FџЯ“ikmjkkhdT`a_\[m\ZUAUd\dRRaXVXZXX[XXWZXXVVVR_N0UfmkTRUTQRPQQQR^PPQPPQ>=нџЛI^m}LBcn_ZPE@=<;<<>>CHNV^jvtgPWšъ•@=CTVWZZ^^N`T‘ji[rommadƒenpmmgcgV86<*-Šџџџ_2FN0'444325322/232000/0320//300-*-*)-**))-*-*--*---0--*)')3&%#%%!!!!&8BPX[^^ePE3!!######%%#%%%&'))'')))/-*/-00@y‰€˜–ЖЈиЯОЭЩма|8jіџŽ60NH/FVTUQQNJHEHI=U`t‘ŒЈ…•’–€zUh”šЙЫт\#™€cIJEщЧЗ‰xЗГЮфовПисдЧЧјлЦиЭhLp\[J\џўзфыЮуфжт№ѓq%QVZ^_goHPUZ^2ЮџСЄМЏ­ЈРЮумооыЧыЯУаТ2/QTdj3`}|)0IKJIIHLKIIHWKL8`PNRWcQPUVVWVWXXXZWXW[XWfXm`@P`aRQZ[[[[^^^^\\h\ZZm^mW0Pag8Ue[_[ZXXeZ\^ZkWWXWej0N`fBTmgXXWTRVT0>Td;QQTQLIIf5CHLNUXiVPIJKJKLLLLJLJNRUX[ZdZVWUWXcVURTVUUVFXXWX[UџџёёџлЊсХЯЩЖЛДоЧЗБљ8%QPLLKLLNLLLLJLJIHHIIIIIIFJIHJHIIHIHFIHJIIKIKIIJKKnџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ“;UQQNNKLLLLKKKKJKJLJIHHEEFIJJKHHFHHIHIIJJJKKJJJJKJK/4щфРчбннсьнмРџџќњјџэJdeca_``_^`^j_```^^`_^^^_\^^\^^[TFA======-BPa[_cec_^V6x„t``s‹‹)Hmj^3xŽ|{wrqnr„y‡wpd5W`a[;z„ykjijnoronnjjhqp3Uf^V>^nhjhnmggfhimjknqz5CjZEJˆnnnomkiihgdn_\[\ZWBBXXdVRWXZ[ZZZWXX[XWWWUVWURvЫJ4^ana;f„we^UKC><<<>;@@EIQX\^[<LV;*PKKIHECHIQ`o‰œЄ—™ЄЋЌt}xhkœ…Дегн‘i­d^_#2ЩџЧ–fЋ‹ВУЫнаЯнџдТЧтсПХщХJ>g_`Qfџџёыпжњћщџ}QX\^^ehЃ‘>;RWX_)IџѓИЏ­ЂБЩбхЯнлылЛОРЦ|5;PViVEnQ0HJKJJIKIKKKKKLXLP^LPTha3RTWVWXXWf[XVWXX\\XZZB>HRX^aded^XCCˆ‚r`od0Wh^JRŒzŠzwq^pvxyyszKEgkxC^|omhZgooqpqppkmztLUZfZBV`fZwnnkjhvkijjkmz}\8XeZVBejgW{nnnjhhfgc_^^[dR=adZUEUVUXZZVZXWW[XUWWVVRTNPh\\VQQTTRT^TPPPPQPLPPQ\L5*_;^^z`FP’’pvrVQJB@>;<<>>ACJRVU8EZdЂJHUUQPPNP_I25IPgdZW[g^kP6^qH8JEhТЋK3XXTTVXWXL^fhjkkosv…sfxz‰hvrŽvA52/3€џџё_-ACUWVfZC%2422I/2032222222000220//-----*))--*---*-*----*-***'&*%!####!!!!)5@XVZ[\mPC6%!#%%!%&&#'&'&)***----00/0-023#!zРПœЅwЋ‹zБ­Ч­ЏЏЋЧтЂn5ШџJ=\UP8IHHFFH@Zm{‰‡š ВƒДœ“„ˆd‹—‘ЦЛђљЙUFzeH^<™ТЌ{ЖЄШСЧЬмХГдмЮЮеёнШмЙ­y4zt_KPџџѓттџџџsQh[^Fdzfe\B!&AWZ^zўЯ–ЛСЖСьдљлЪсоУаЏœ‚3BTWiT=T[\[[eVVUdy<==@>=AJU[`aed`\U<==>BBHIN85EHLVdz™•œЄЛТ•ЏБke}„‘ВЗЙЪисъrˆQ^Q%[Л’ŠЂЦЧЦйЯЯбнлСЮаЫэБПЌ›Оh*<_^\RiяџЫгєџŒ#RX\\P`f_X@џoWW\PЁцТМЋАЇГзВТљгЬЊ’ЙЪŠˆa6TVdh@JIIJKJKJJV)FLKLJLLPP^N>PXk@RVWWXVUX^Z[XVW[g[[\eT>PWh5V\^^\[X[^^_j^^\^[^sC;><@==BPU[_cna^WBE’s_oˆŒf2X^mBJƒŠ‡xtomoytqzP=><>@@C8P[a—\FcWTPLKNQRVWzU0*JPRiJXWUsB!Q\H‹ќ­=NXVWVZWZn^adegimmrqprp‡wwtsx’…r3-/Q№џџm2/2EHJPTfvZ`X=433322002223230000000//-000/*--*****-*--/-/*-///-##/!'#!!#'&##'##!##'&!>BFK\cIK5)&#%%&&&))-***-//00/0-0/220203oЉњбЌ|d„in€…‘ЈЏЊЪЋЏЖ ЋмЖБiRзЭˆ/KXQ<4;R^rw”ŸгЏЛЩЄЌЉТЈŒ„h„wœЉ вщЯЭјРd|cQL*<™­všЈЮЦпЦбщзеЛРаЪњлУВxЄЗ€&*^[\TVџџџџ•RZg_^c‚y^V08ђџџWZ\LУвЅЉЉЮбдЉКсЧЇлТС­‘yfVPQXdf;KJKKJKHJIJJKJLLKPP^Rc>NTqW3VXWXVTW\\[XVZWf[Z[Zk5LRga5d^i^[&Wh^_j`\\[Z\^c5Pak5U\^_^\[ZXWZ\h^^[ZVjj3dca_______^^__^^^^_^^^\^^^^^i[e_JCA>>>@@>@JTZ^aaa`[U/c‚‚a`q…ˆ=>f^[;g}‹yrartyyxs}dHZi`X>e{njhgjnpo_okjmhhp;X[\U>jgkopzniihgmnooqq„o4WZXVJan^><>4Kdax‡^>VWUQLLLNQVe\`yTEHPVsjTLw&Q\WЙЧh>8FVUX[\\[^`fyix[pqptqqpss‚Š‘e3%)Pдџџ{)3;5A@EHJPUX[XiaB54323202/302002322200-/-0/------*----//00!)*-AABBCCHTIRXRXXXRQEECBB@2/'&833#&&''''6*)--/0///2/2202220223#oУъпмЄojyRtam‘ВЅЗ•ОЏЊЊУАЙЖš\!%=хсx5NcR4Te˜™ПЄЫВДУСУЌВУ‡Œpˆ–У ШСУЖъќы6A•d^^>@ŒŸЃ“­ЮфодифелЯЧяя№вИ™…фВ™%;[^\H^џџ{QX\\^cŽp^WE@џџњџџV[_CЙŸЃД–ГМХгбЪсСЧЉ‡yƒseZPPRUkT8IHJKIIKKLKLJNLLLPPQTTNRWcTCgXXUWe[^\ZXXZZXX\\fWPhT6a\^ihVUVZvP@ThNPdURPNJXF3EJPUXZgRJLKIJKKJJLJKKQRWeXTUUXVWWXVWaVVVVVUWZ[Z[JџџџиЂнбеЦДРУХЦЬВџRPPPNLNLNKNLJKKJJJKIFIIIU5HIEEJLKIHEJFEIIJHJHIJKNLpџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ}NTPRPPLLKLLLNJ6JKJKJJJIIHJHFFHHFHIIIIJJIKKLJKIHJJJK/AъсжщоонщсомЯјџљџъTdca````^``^^___^_^^^^_^^_^^^^^WQFB@@>>>>@CNW[_`cciZT@‰qmr€–j3WhnKEƒ}‰tppsvyxszK;\siIPymhhgioqppmjwii}vLCd[WBXetjzqokjjg\noprppI>CIJQQVZ[\TI'4324222002320002023//000--0/--**/!/ABEJL_[^_`aXXZddjf\[[e[ZXcXcg`_edTQRNP;E2>&!##%---/0///0000320232H332rыЩЈЫаА|_T^q{…‘ЈГ’ДШ—ŸТИ›Ђ‘…aW/6rуЬ[6\XC=€ЁЖЇЏДСЬЄЏЙŸЅˆœŠw{ОзОСЗЩЩђъp8a^^H0yЉ™™ДУщузжзддйљАцнОО™ŸœО™!\q_UХ PU\^^cgt\V>4ќџџтяџм&Z\`/UМИ–ЖŸоРТвЧжЪБЃ…‰reZQPQTdqPIIKKIIJLLKLPL-KNNQRUiANPXj8VXZXZVX[[^\XWfZ\^^^fQ@QXh*eh^\^\[\\_[^N\\^Z\r'_XkQUZ\\\^^[Z\^[ZZZWVXZx3>Vo3Rj\^[WTUW[g===><>H^X\qaa`^V>`‡‡oas‚J4fo^5fŽŠ|zanpvwxxwpxAU^p[@vyihknnrrmymjgh{a@WeZUH`rmnnrnmmmmmnaqr`2T[jV@{jhfVvzznnkmkhhhfdiV8aZZRCUZ\\[[\\XXVZZZZXWXUP>RX[WTU`_QRQaQQ^QRR^PPЂ{PPL=PZ^phE>AEKPQUZ[kjK<4234332022232303322/23/0-/002!#'&/BFLZ^g`gZ^___aaoeqwwommtomvrccz`rna_`_`_^`gX_^jdg\ICB-)!%3202020003433402245RЁџьОгтТЄ}^V[ozpЈЖДЛИ•УЛ—š{QZ`NA)!ŒёŸ8C\C*vОЧЙЦдРБ›ЮВЊЗˆ‘‰rŸУЖйРгШнОхџ™d^^L!TЙЦ­ЏЪнЧыЧТуЫћ§мфРГЇ… ИО%^^^LAHQc^_dp^IT@фёяххэєџВA[^_0eЛ˜ЏдМЏДсЅЅЅ­”xm^U;[LQTmW>IIIJJJJLLNNL-TiT6Xn^^[XVWZm6==>@K>ALVZ^add^ZT=i‰vcpxƒ/VhiZ=€ˆzzvqprvxxwtjP4Zi_BNpmmjjqst{nkhikivZC[eVBKdjnsrppomjkpp|„€IEXeXCP€}mwm}onpknnkiigfd^BUWXXRTW[ZZX\\XZVW[XXWXXVT@PaXiWTTUCTP=QRPPPPQQPQARPPKNh^i^VR8[џџЌЄŠjpd\URQPR\NFA/HU\p•^QNNPLLKJHLQ_WW^`cegw}W'*/BIN^`W[^_`dcsnx•ˆˆŒ…˜”zroyƒswnzzzzyƒƒ€€‰‚‡…|a^Z\\ZeWemjc^HB@-#%3332333334434#[ОџхжэеВœƒfWT[q}œИЇЈД™ЄЋ}n^UNIC2>'B›пŽ>PP*0™ЮдУДЏАдЛЏЬz…Їh}zбВоСАЦоРЬуџЗfva^^/_ЖЗРУЫе№жЪибхџъЧГАМŠЉЁЄјР*Kf\fV8JPX^Qr_XF%ЧмйыяњчёёџrL\^^'‰ОЁ›БЗЙКХЊЙ•˜„vggNJNPLRWhULJIVHILKLJKNNPxRTQRUaR>Qga@RVXZWZWX^^ZZ[[eX\\_kQ@RcX6V^__Z\^^\^^a`IZ^i^s>PUW4VZ\^_i\HVZf[[^^WZ\Wh0N`f3V\\^h\[HWng>>=>=EPc[_aen_VCB‡…sptŒc%[o^6RŠŠ|ƒtrptv‚xx€xLFip\Cdƒnhih\qvqpnkjjzk4X\[UCjso„}sonznQjmrocr‰`!WjeH=fxqzompmnoonmmkkhesVAcdZURVW[[Zg\ZWXZXjZWVZXaQ=VZZWRTTTRTRRTTRNP\PPPPQQPKLV[_wITTTA‘члЄ“€rdJXVXWRR^K5;e\eˆ^R;FHJIIIIKLPaX^`cdcdfrzR!JWL‚ђz>4/5A&J_Z^a`ogreek|yjUnmnzo{rN34/-ˆџџ“Pgqo_XTLFFA>@FJK^UZ\fWPE64332332232202322432!#0CJPWXPHdgiˆš‰ˆŒŒ‚z`p_^[[WWTTUR[ZPLKWLNPPQPPQRUV[\\^aqxv…zy{_[\\\[dfd[KFA!%6%433443448}лџялђЬеŒ€zmZf^y„“ЉЂЃЅЋЧxrUXNHC@/&;A!UџСWIL3`бљЂš­АЅОЋЄŒЊsˆ|™ЋгвЇЧяРРзЫјт;d•c^^>ЪХжзвЬфМйёцщуђчЯД Ѓ—ЉКєт%VXfjV0@\g{z_JT2ШоТощосфэыџџXZhN&•Ш”ПРЧдХК—™‰ЅqwTNT`RPaf^^_\XW[m6L_n2TgaT^LPc*EHPRWZZRP>=<@><@J_Z^`cdm\VAfˆs^c€‰…e[XFXewpssrqoniijo|rr{ˆCTd\WF_…znpopopzoppokmjht^0VZZTRaX>f^[Z[[W[f[ZVXeZX_5RdZXTRTQUURRUPPPRPPPQ^RPPN/Rfi_WURQTR/&„пРgtf^\[h^^ZWQ=T^eŒ_QFBCBEFEFHKPRV[^dfghhZi}P#HXTдy>PgRPK5)NiqeQdUtiihokm}n^xkrdJ286KќџУ5=fpfo`[TQIHB@>@BIKPPXZWaQU>4333322423323243#6&0ELRWNPCmrЈЁ­Б‘va\ZUWRPLNIHIB0-;#'#'@)'&0E5KBB3>BEQTW[ovy‚Œzrca^\[XfaKI3>&&44545TŸнхгмчЯжД„zUjPo|ˆ“˜ЏГМ‚И‘T^RIC@@@3JP8#2o€ŽFRHПеܘБЄОАй–Єpˆ‰’’СУ­ЧЪхЮчоЮјмWC{_^`%HПзЦйеылн№џяознЧбВЏšВтџцNUdZmV6zЂ_VA2'ЙвЗПМсЯсыфхђџс%W\^E6ЈЌЌЫЖШЄ—a™„’nH/6IHKZKPTdW;JJKKLKNPPNPPTTPRUTT`R=PVhTRWcWW[XWW[\Z[EXf\^^mV_`^_^W[jV0QiQBgVRURNkI3FLRUXiVQNILXNLKNLKLLNRUUUUUUWWXUUUWTVUWWUgUWXWX[_џўЈсхЫХБПЩУЦЯВёNLLKJLJJLLLKNLIJJJKIJFIIHFFIIJJHJHHHFIJFJIIJKIKLKNnџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ}CTRRPPAPPPNKJJFIIJJJIIJJIHFFFJ_IHHIIIJIIILJIJJIKJKL)>ђнз№пнпощомЙјџџPfdec__^_`^_^^\[^^^PЄC^^^\^[[[[XQI3@><>>>>BNW\``da_ZHPƒ„o`szŒh*Xio;LŒ{|…ˆttyzzzxttA@^`\5_zjjkkotvvrpjjj^zs@Xk[UE^hyprrqpmjhjoqt}}a0WZeU@q{pnpqppmnnookhhepHEcZWQEX[X\[[[Z[ZZZ[WXZZWU=PXejUQUVTTURQTQTPRPPPcPNLNLQZ^y\URQPQTR5IХёсzk`^k`cd{m*P[d…_Q3@>@@BBCEHKPTZh`UhjkkjtzhQPWN„К6_’s[c`P4!T|ffhjjhh|okk}|ie^5658‹џџjBH`LPUVVUTL/54454343434446&)/HPUFKBXЖЙгЇœjd^ZUTPIF2>>=!!!/)###%#!#24&&v'#&XFPefTf0FEFILPQUe\€ffdP[Z`aLE@'%6%fЙњыѓыЮоУВЁ…ƒ^g^v‡”ЋœЙw‡VUCCJPRPQU-6СЂ^J^6ˆёЯМДБЄШЇ™Žˆ{t‹ЉаЧГЭбЯачдяолh4{_^`38ЯѕцосфЦсњцоДбСсЖšЉВоіГ5K_X\eI^|ZEB/‰ЅйЙАХЯхоъсссјџ 4[m^5sЉ™ДЗАШ—o‰–€‰cAHIEHHJZNTXqU8KKKILLLKNPPTRQQV`TUTL>Thk@@WV[ZX[\^\^\Z[^ZK\^s>TfQPknj^_iX[fh5Pfh&`XWWR>PW0EINTXWWRNKLKLNKLLLNPPQ_WWUWWTVVWXVVURVVUVWdWWWVZKРџЋлоЪбВРРСЭТПљCNLKKJKJNLLNKKIIEFVIFHHIIIEFEJHIFHHUIIIIHKHJILKKKKlџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ}CTTRPPNNNLZJKHIJKJJKFHJJJHHEEHIHII\IJJHJJKKKJIJJLJK&JътзщоцчоспнЦџџ›_mhc_`^_`_^_^^[^^^^TЂ>\^\\^\\ZeWPC2 /=>>=>ERZ^_d|m\T;aˆ€na„ˆ’JF\p_8m‡zyhsvx„zzy{e0Z_oKCvwmjnrqvŒsonmjnkPFZ\X=^g€Xompokikkqsvt{z>HiZVF_ƒrqnnqopqmzokjjhhtZ0VXXVEZ\[^fZZXW\[[XZ[ZZXaP@VXeXRTTUUVWVRTTRUPPPPPPNP=PZ^pnVQPPNPPREEСєЗ^WXRcWhppUA[_…|UH0=>>==AABEKRUI_rehkmwgwqEAXLЂЙ[;<[rPZ\ea^;#Ryztv{kigknknmxmX3<5PжџЈQ`cc^`_\ZUTPKFBA>>CFIJNQUVXfPE6434344345&&-6NUKK6QƒУоЯВŽTNCJTLHC@-26<63#----&!#*-%%'i'&-5)ENQhWQHA=!'&>BFILQU[hwХЈŸ‡dK_^W^ZJ30‘џџєсѕѓсУЅЗЋƒ”dZhnv}™ЊЂ‹pphNQFB@/CIPXiKHXV5*mзЃC^J&ЂчиДТИЈ‰z|‹БЦЛ№ЯуХжоя–*Œo__/ОяъЬлцзёчслдвсКЏЊ›Эё‡02LVj[ZVTA=#лг”˜йМЖЮгмяосясџџcHZ^_#yœœгА™ww…h0;JHIFIINNNTZcPJKKLLNLKPPPTRUTVUAUQc3NTiW4`[ZZZZ[Z\\Z[[\[Z\\ka@NVkBVh^a^^^\_^pP^`^`^^m3Pcj4UZ\_`_[XX\\N^`\WZWng4P`_4V[\^`kNXKjRATh>QzZXRNKaHCINQVZcUPJ^NPLKLNKNLNNTRWXVVWVUVXUWURVXTVVVWVRVWW-џЖжмЪХЏвРУвЖГјXKKKKLLKJKKKNJKJEFHIIHHIIJJIFFFJHIFIJHIKJJKKILJLJLkџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџuCQPQQN[KNNNKJHJIJIJJIFIKKIHFFHHHFHIHIJJFIIJKKJIJJKK)QъЬЪщЫмвосооЦџџ2N{tc_^^^^__^^^^^^__``^\^^\_i^XW^IA/!<>><@N`Z^`dd`ZR2‡`_q‚…v@V_jNI‘…|xssxy{yz€„P;\p^A_mmk|stsromonp„y-Z^fU@axrspopn[jkoqrwr|_3W\eU@xzsn_mprromqqojkziqETcXWEUk^\fWFdZZ[Z[WXZZh_5QcXZTRURVUVUUVUTTRTTRRQ\PLNa\`iVRRNPPQQPQR%^ХЮTeVno}xACZ_ˆrI>C=>><=><=AFKPVZ^aeifhjqk@=LC{Џf;3Ndz^XZ[\XQ;U|gkjhhhjhhyp^<<4)ŠџџKE^_^j^^\IWURRLJHB@=>BCFILP^UVifH<332345&&06NVP@4fРоџеЁa<=WPJC@-%&#!200-0J03PJ<80%2/)%3)%&)&&/C;FPVWUNFBI/203#%#*@EJK@XP_‚ŒЅЃvUB^ZVT3|оџџџџњУЖЂЪ™ˆ}qQkoh™‰pN^UPFCBAIR^iz€PZ^r_)<…ZLI&tцггЄКЃ‰n›‰—€ЉЩЯчбїЊд№баујџУ*|o_a/ЬъщЧсфўџтыыезЏЅМОЦŠ4H5/RkX[W>40х­КВŽ­ЯУРеляммхмщїс%&WWgL3Д”“z{Ž‹ƒƒ<<0FJHFH2H_=QWig>>-FRX[_aec^TFL‹z[`€ŒJ0Zo_6[}|wvxƒ{…x|3I^rX8v|ommrˆxvpppooor‚PLg^ZENszsrpommmooqrvwr{x>FekVQe\zZTR^PQPQPPRRR)jАдЅtzx}…^;[avwIQKCA><88;;<=BJL`X_`vefggt@=[PЈВe<2IRXg^\Xf[XQ6!WkgjigiefpzX08<=ЬџЋ&5^^_h^[[[XUTQPPKFEC@>@AAEFKKNLPQaIB%54%)#5LEB8@tЙєџп}E-;RJC0&!#!20022/*-//006[<0E0''*&&&'))/6yнџђщГЩЩ­‡…z_mn^ryqhPTNKFEBIP_p˜xod^Lcy>eЃ W_F[гпЗУЈЄ‹s|wЂГаЫРямЧњЯУбхЧщ˜#o–^`/ЅџљмхчїЦсєэЛВМЇг|KPPR=>TVXsV#єіО€Ђ”zЄзйезйлщлГщфўи4VZhIK‡ˆˆ’…‚–‹K5IH4HIHHFILPLRXhT>N;KKLLPQQRTUURVUWWVe@NTmX5X[XWXk\h^^\[ZX\^^^^q2AWh<<88<<=AELQW^cdefyk@8ZK’ШPIPJEEIQWfZWX[fXR8&Tzxtsfgn^/8BFtеўd&HIX[X\JXXUTRQPQPJHCB@>CJAVFeœЧМЃV>=J8#ЁдгХЯЪА}‰w^hkjj{XvWLJFCEIPIi‡tznW`fjˆЉrЌ˜ia^-ЇжПЙЊ…‹x‡™™лаЩЬЌЯсУЛЯлЭГщР'`^\^<иџцјзџусПѕфиУГz#N_gZaŠ%N^Z[i@џпЧ“Ѓ‹ОчвжеЩихзйзмџzIW\n2T—•„Ž`4JIIHIHIJHJLZKNUXgAKKKNNKLRRTRRUTWWZXURT>QWkEThZ[[Z\\\[[^[Z^\^^^kQ>->@>=BPX^`cdc^V;J…ƒaowŒˆe%\o_;Pmttw{|…{xi>Vhj[>e|nnosvwvsrqomq|x`0\r\>Jsƒvetronqrqrvwtt{@HdeW@c|qrqqorrrrs{nqpnnw[=Z\ZFUkh^\^[[^g[^X[ZXXWWe=RhZXTRaVWVXVTVUVTVVQTQTQQN>CIPUX^rnds@C[W™ЊWBEPPN32HPaeZW[\fdRKX}gger^=>E;ЄџЪ*#BWWUUUWXVVVRQRQNLLHCA@@@AACCFHJJKJIH3'-6F<0dгџџуr'BCBI3'胼/0200/0/----/-4P5'>;4/-)&2A3-'))))/-8=KVZ\\`JA=2322032204233445556%/38N@>RБлдЉE>;E&IМЯнЏe„pkfd^\^nT5FBEHLXdvˆСšioeW^‘УmШe^^5„СвОЁvno—–ŽГОХеДльЯТЯъхЦЬОВA*_oP_0ЫѕџЗтєсвсауЦ|PVX\PjОP!LUdXKЬџЪЏЅŒЃЏЗЦ№медЭыйъонхјPUV\[&…ym•Єd0JHFIJIIHJJJKLZLPWi`3INNPK=QTVTUUUVWXWaVdPLThWCTW[\^[g[[^\[\^Kgi^nh5QVhiUNRjU5d[aa^_^[hr>PU_*jnXkVP[`5JKQRWZZQLKKLLLKNPKLN>QTaWVcVcTVTXXVUUWXVVUTVVWWeX˜ълЪХгЃоЯТВњZKKLLJKLNNKJILKJFJIIJ5JHHHHF[IKIIFEKKHFJHHHJJJKKKJkџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџhARTQQPPLLLKKLKJJJJFIUIHHHJIIIIHFFIHHHHIIKJJKIIIIHHJ3VѓузфцнпсяпэмЌ!Vaca__^^^^_j_^_^^^\^\^^^_\_^^\ZVNC@><<>@<>H^X›`co`[R8az`py‘8>gr[>}”‰zvvy{zzzte2[jq=Ko\nsttrqqpnpsƒz6F[nX=aktrrrqqpppqvvwt…a4ZZXCJ|‹qprqrtssrssnoppzd0V\\WTV[j[[\^[[Z[^^[[ZXVaP6aZWTRUXVRVWTBQURCUUTUTRQN>Vf\fURRUUQRP[KNPLNPQQ#|СеъЄ<8;;8=@>EIPWZ\_h>C\Q›—eAUUQQfN65IPgs[XX\gd_>&TzzyW-AARКђ‚04VTTRQRTVTR`VRRRRRLKJFB>>@@@BFFHKJVH865@N4UЏџџџ6*<53-'6#33322220/20/0--*-////-364&qF=//%HP84*)-*---08>NVW\\XNB=4203222233443453455456)-38&B­Џф{N5AK*‚ОЏЉ|rW^ZUTTPPHCBFJFd€ЖЁЉ”xnUT‚„ŸдЧ_;f}PaE#FР•ДkrŠ’’РзИяЈЬЯСЮЧўђЙЙЏКО@%\r_^/иџщъљыэЫоїPW[^afoЋ0PaZ[NОтРЄБ•ЉДРЭЯеыпзЪыРмгЮО)ьоЭщнннпщнђпhEgc_``_^^^^_^^^^^^\\\^[^^^\\^_^WTIB@>==>>>0LV\aacd`WQ2zmTrƒ–z*W^^BI•}|yvy…‡{z‚vLHn^^=_zoqnqvxtqpmmqta3V\vHEq}rssqopopvwrs@UZZR;dy‚trporsstsrroomoy[Cd\dFC^j__^\^^^\[\^[X[jWU=VZZcETWWVCVVUUCVVTTTTURTP>Pd^wdQQQRRRRRLN[`NPPPP=%‡ліg*^^vaBRi…x^UNEA>P;;;<=@BHJPajZTAX_’VLTTPQTVWR66IPUdXWZ[^ddIPqE;C5oщгP&KHUVRRPPPQQPPUVRRQRQNIFC>>>>@BCFHHHJ0<=00pзџџРB/C6-&4322420220202000//-/*//-/0246>‚CXPP46*c@63/)---//28>NVZ[^kPBK4523520233453434335444568Jv>eеџСR%E@<*!vЅЖh^TNKNLLFBBIT^oЄŒ”™ЌŽ‡}oXhaŒЈ­зˆzŽ`^^4=•ТГ‡ezМЗ№уИЯамУлмЌРОŒЗБT^p\^&гџџ№жўчџКP`Z`ci‡mrm06X[^EЩГЇЂЊЇЊЧсббжъббиИоЪР}4BV[k@L™r0/KEHIKJKJIJIJKNLPLPUmcPNPNLRTVUVWWWWVVU_%;P\=>>=>=BPd\_ddc^UAPŠˆnp…ˆ‘Q'\q[5h–}}zvxy}ˆ{zod>XioX@p{mptw€xst|oopr‚…ACe\gAdyspqqrqqrqqrtxttˆc;UdXFCyqssrsrvvttrqpmm}nFV[ZUB[ar`_^_^^^_^^_^^\XaABXXXUTWXWTTWTWWUWTUgUVTRTP@CFJRVCAXPRJQQRQRV[h}W/4JN`ZZXX[jhJ=CEKŠџЈ/AXVUTTWURTPPRTRRTTVVURPLICAA>=ABACE/<;@5BЄџџэ^'C>4!'543323332220203//-/--/-/-/--034!UAif6<'iK630)--*//06/L`Z[\ZPC@555343233233344534444565;^ЙџџбC#˜џыŽ/'LI2*W{zWRJHIIJEB5Q^\z™’™Њ™’„yNkX|‹ ЂЦЪВAV‰eQ^F*‡Уp‘˜АВЧЩлЮЮщаТЬйЬгУЌ €K!Nz\^/ЈіычџџХPVZ\`j‹y`NVТ6WZ^0FпАЂЁ™ОЫУиЮЯОбХЮзеБВП ^0RUj[3yHKHIC4FIKKITHJJKKNL[LPXjV4LPN=UVVXWXTTRTXgQ=nPgg4Zp`aca`[\w6LTo*Ud\ZVQN^*FNRRXZZTPILKJKKLLKKLPVhZWZdWUXXTTTUTURUVU`URWXXZXˆџвХЏЌЮТгРСќ@LPJIJNKPKLJLKJKIHIKJIEHFIEIEFHHHJUJHIJHVJIHHIVJKKkџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџh>QRPPNPNNLKJIFHIHJIHIJIIJIHIIIIHFFHHIJIJIJJIIIIIJKK*CўмЮномммнхџ5eca`a__`^_^^^^[Z^^^^[^\^^^^^\^f`KB@=<=@=>/IU[^``c^ZT;dmaty‚„5V^nI<€Š|xxz|ztP<\_^=_{nnsswvvssqoqpv‰r3X\[[P‚q}tqsspppprrwwz@FWdU;c€ttsrrvstrspqqopozECXZXTWjcca_`^^\^^`_^\^\ZT2`iWURUWXVFXWWWTTVXXWWVRRR>RZg\UR@PRPPQRPNPPQPPPPPQQ4I=C^mr4F{xwx`[TICA>>>;<<<>AEINNBX^z`JQNNPQRUZ`dsj4-8PVZXm\W\IPPRДј{4PHTVTVUWVUUUUcVVHZWVXXWRLJEAAB<@AB6;<6'PСџџЖ;HQ-%44443223323202030220-0--/00-**0;AB-B@/C@8/'_;8B/'--//00P>Ka[\ndNEQ453433453334344445445488;zЬџњџџў„cчџЏP/8P@-WRNHCFCECE=Xiv˜ОœЋ‘z‘^jWf‡ЋЖЋКеj;f‰K^NZРƒ‡}ˆЙ˜МЧлЮМњЯгЧЪЫђПВВ™ŠЙW'[o[^BОџўџ™RXf\`j‡i_X@ћџЂ8Z^^&`Ю›ЊЄПЅеЩЫРЫмЮЪЧПИ­›˜p[CTVjW>8HIIHHHI6H5E!FLJJKKPLLRdmPN`RTUWVXWWVWUXe[aTAQd;Pga8U\\Z[[\[\[[Z[[[^\_im0<<>><dworvwssqpnps„‰IP^QQQPPPQP`;2U^^cI8}”{wmc^VLFBA>>>=<6;>BEIPV_ƒQWTQLKNNRXI‘Upwo/38QUjmhNJ0*QRZгиT2JUTRTRUWWXXXXZZ[f\n^i^ZjVQJFBCA@028;=*[уџџЋ)P32'%32332323322233022@002//--/---/-**0;E|^TC@B>80)J534-'**-/238@Na[h^dPE>34444443333454445558566*sађјїпђјзЇ6;АџиT&;NU8=F3BBAEKUP‚–ЅЄŸЖЂДЖpqWf‹—ГЉхХёЈ€‹d^\)RšŽ„}›ЈЄйчиДсмЏЊзТщР ВœˆŒЂP^q[^-џџЇQk[\PhŽy_JIыџўџ_LW^^%—О›ЂЉДЧУЩдЫЬЪЧУОГП…so`BBTddQ;HHJJIJJIJFF/HLLNKLN[L@Vmg2PPUaUUVWWcRUX[ZXZVWf=@TjV8qZZZ^\n\[^[^h^^[^_\R;Rmq6[ra`_`_``kanec^^qvCPRgEVfj^aa^ZXX[^_aj^^\[j>PkV/fkc_dc_^_z5N_d2fk\\c=PL5HLPW[ZWPKJLW8JLLLKLPQTWWXZdXXXcUTVaTUTVVRRTTRXcVKтнХЏЮУХиДРі@PKJJKKLhJKJLJHJKJHIHHHIIHIEFFCFFFEJEFF\IJHHIIKKKJnџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџhCTPPPPNNKJJLJJIKJIIJJJHIHFFHHIIFFFEEHFFHIIHJJIJJJIIKіхЫыонллсѓЮ2Hqfaa`ac__^`_^^i^\^_^_\^^`_^^^^dQC><>>>===C\W[^_mjXQA^ƒqnv{>3fnZ2o•Žzxsx}ˆ}}zpc2\oh@\xnmqwywsssppqpw…ƒ4WeZIHƒsqqssrprstt‚rrrsCBXZVC`ˆvtwtwwvtssr}}rozEEi[VFXvn=^``_^i[K\^\^^^[QBaZdTCVVVWWZXWTUVXWZZWXXTP<<<<@EKc^f cXQQQPNPPVe[^Qyqwj/6HN^a%6WVdУе@6XWVVUUVTUX\\WZ\\\^^_aa}P^eTLFCC24=H6)Xџџџz//RHK2!23000220332002/2022000//0--**-*-/*-05PIFV_E>>80)I440*)'*/02480NW[^[dQ4A555444534344344446656686d‰СРЦхлдезсЮЩa”џџq#J[UL3A>>FR\j”… В›œЂЄЄ­‹Ѕ‚ƒr\zˆœ­ГЂЧсдIZЁaP_>CƒЂzmЖЗЭЭббвЬЙХЭщЬлЗЂЃ˜’ВЇVPh[^))˜PU\\`h’s`WHјџуџџџBWZ[Q‹ИŸЇЂУиЧвсЧЧеСУЙС‘^oc[>RTip<=>>>>>H^W^_aa^WB^iZ5aqarvxwvvs_rtt€^;X[W;a‰tq}ppqpqtstvswe4VXhF6hqtsvwxyxwtsqssqwdC>#223220200222/000/2//*---/-****-**''*3;LAJ`JC>80'L6532/)-0244<@cX\[\dPFL86654544454434654556668'yŽЏЭЯыщмъЧПИнЬО…3џьy-JZQI0&5Zev}’šЁ’ЁЏЄЂ›’ˆqx^W›‡ОзИЙЖщаX6ˆc__P*oŽŒОГйЭхдхЭКЩЭлЙЧоЉˆЃ г_K\Z_L!FPeaN\yjPXUщџљЬјоџі[Z^Q'›ЂЋЫЛСШеЧЮУООО™˜akc[UPTWjfJ6HIIVIKJIJJJKJ8JINKdKNUdgPPRVVWTUTWXXVW[[[Z[Za@KThV5jW\^\^^[^_i^[Z^h^_oR0RhV6\^___^\^^`dd`a``w3Paj8aZ^caa_i^XZoa```^^fV=RgU><=<<dZW;astrevxxvwsvrsvsp€KCdXWFZdgdda`^_`[I\i^^\\ZRBaZZUTXWdW[XZXWVUWVZVVUVTPAWkgXTTRQRTPPLP^RTTRPPPNPNNU^LVPKIA62232203000000/0//000/-/-I0--)*)*)%'&)-8>EFJ`>6<'P>54K2-023458/^g[fkZREB65665444454445655566888=wЇЁЏЛХътЪгВУЬРЇУПƒ>{јхn3JWPJLZ„„ŒЃЖЄЈ™ЄЂГ›o‡ygzˆ‰ЇПЙКККЪэ’owQ^Z!n’˜ВТмщУвХРОЮЯвВщИЏВy‹мј[JeZ[U;4PZgz ˆv[H#ЮџѕнОЪьяљо6XZm@>=<;jkJE€š|mz|}}ytvF>\i[<^|ptwzƒzxso`ptgx‹o3UZXCN•wvwrrrrqrvwxwvvrrBWjXC@||vvtssvyvsvwsrye=WZXUEkqfeacaca`i^_j\^ZX`5TiXUEWX\[EZWXZXWZWVXWTUQPPVZm\TRRTPRPNcLKRRTRPRRRQPN;T\__ZJ=ЈъџіЏ˜‚fgQZTQPQNNPLHB0C^\naWJHHFFHKLRW[\`cegjiiwqr2&P\RАе^-BVJ0&I^WZ\_o__Pcdc_ad`peh|geqkU3B>;єџџ >NPZWWwVPJC=20//>/2///-0-0/0///0-/-*>-*-))*))))#%-6BCIC%4/'RW@200334543'Xh^`afPFB85544555565555446685868c‚ЙœЂИ ЋРеАКгЖОЉИ•Їˆ`E)'w§њz8QZE/c• ™­œЁХЇИААА‰€zt_‚ЈУЊХРСЭнџХ#n}\\[4JЄЭсШаъёпзЙфЮм оЄЪ‘ЌcД№џqUXXkR;PJXЏeN>'™єфлмщёпсщџŒ>V[^3v›‘ЉДвЏРРОжЂЄ™‰–k|R;[>QW[j>IHIVJJJIJJJKLLNKPPNPP>PapPQTVXVUVWTWVWZ\fZ[g>QP>QiX)g[\^[>@><>K`\^___ZTCAnp{Žz*Xo[5T{z{|‚rz6VhqZ>tiovwz„xxsqnptwƒ„L=cdV;''88!%=-4IN^[BK;854558566556565666668*{ŽЈ}{ŒЃЇЏЧйГе“ЙЈЙmcVBE='’ўжWC^K88ГЙГ‰КЉ…Ц‘ДЊЄ™xeywoš™ЙОУмЩЮЏгеЧ#It`^^'aЫябЩвзжоРпПбнлЂџЃ‹›…зћџ==A>=;APW^^^^\WUAFnmr‹{U4[fW/mˆ|wj{€|„t}c5[h\JLoqsxzzztropsttŽg2VZZH@‚p{…vtspqwxvwfsrr8WZZU@s‚yxtvvwxy€svwtvwq6Z\iT>cikkfeetca^^^^^^^fV5UXXWCaX[X[eZXXZUTXWWXiW`P>X^^WR`UQPQP;L);PRTRPTRRRPL@X\nfUQQ8&3КџџгŠnrV\XZ^^^^[j\ABCEJK^W[^aeqzjthpqe4UPRЙЖK2aoa[jcTI&;_i4TZh^[URN5FLRVeZXUPIJLILJJJNPNPTUcXWVUWWWUVhTTVVTQUUTTVVcXZЙеОЖЮиСРџfNLKNLLLNJJLJJIKJIJIFIIEFFFHFHJJHHJJJFJIIHFFHKKJJH}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџR>QRPNLLLXLKNKHIIHHIIIJIIIIJIHHHHHHIIIIHIIIIIHHIIIIIPђвйщллоњРdn^^_^^a`^`__`^\\^^^^^^^^_^\^\\ZQF@>@<>><fˆaov…”…/H\\J@‰“}zxk}{tq|\E\^WBa|qvx‚zywqpctw}EP=XXX@_‰f-orttv‰zvx€xt„_@Z[X>R€vyxxvvvwttvvtttƒP@[ZW=\qjmjhheea```_^^^mZ>BcZXATU[[[ZZZXXXTUWURFWhU=Wf^kTTU_TARTPQPPQeRQPRRR\N;T\o^UTQPQRXМяЯ”€mWLN_`acn`ZBPX^‚jUJ0<;<^^ЉЂJ0Fpt^K[fi^<48hrcaopaURqh|tffz\3%6*Vѓџя<-><24KLPVcVZZgWTLF=-----//------/*/-----**-***%#=;-ИџЏ_L^^%5илЫъсуЛмўєдмШЮЙЛЂлђˆ0Lp[[Z8VB<%œТДЈЈЏщђЬлмбЩьыєЦ4X[m4;ЩсОГззzЉ”’ЋeAJIHJJZKNTX`>JKKKJKLKKLLNVINQRj=NTcV*TTWWVUVUZXVW[^\^\WXf#PUitUf^\FdZ^j^j^Zo^i\in3Pgj/cq^m`_a`caecpgeaaZ8PRr@`f`aacna^^^^ama``_^g4QaW0p`pfefe`^V/PrR8miP^VR[6EJQWZ[eVLJKJKNJKJNLNKRTUVdXUXFUVTVWTUUTTT`TfTUUWe3FмШРЦУРБ№eNNNJKJLLLLJFJIIJFFIFHECEIFFIJHHHHIIJTHIIIIUFIVJJJ}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџRAPPPPPJKJLKLKJJIFHHHIHIHHHHJHJIIHHHHHHIIJJIIHHHIIJKZіпйщмхгхz>>=>=8>KVZ\_^[XRPB„‚or{{–i%Wk\>Zˆnwx|Š|ƒvzp3Z\\XP|{tyyyxwvessvywoy6XZWTBŒB*}sttwv‚yxxxtƒxBVe[W6x„ˆyyxwtaNstttrg6VeXTKszmmjkieaQ_^_`__^[R=Wd[URXXZ[ZZ[ZXVUTXZcWTTU6CZ\^WTT>QRQTUUTT_RUUQRQRRL8Rd^ˆXTRPQQRE%[ЙќэЁwdPcdefhfqH8X_szWK2<=<==>@BHLTd^``docdpqX8W^iЈЏA50NV\^ZW[fiTK>wqadddpeddgqwyK0;)@ДџџnC>22ABHNPPW[Z\eVUPKU40-/*---*---*/*///)-/--#&%-2HVPRVXZ^`aUcpfvp„|{n{rzamƒ{drm`a`a__^g[ch^^QLH54-'*P8686;88;88;;xЂъРИО•mwƒrб›’{zpfXNKIEEIPEV<3Ъэr3PL&8ЄђМЈЈЊЖ”ozthoŒЉЄЏТЙЁРРЂПЭЯлz0\^\`'>хвщызиољЧУхИоЦЅ­œFEI-NaZZc>2БГВДВеИЮоьРйзяђмъэrWWZ^ƒЦИСœВšŠ•„Š“v3KKJJIJLPLRVhT=KWKKKLLKLNNNI0VPNPPQLRWqRPTUVTRUVXWVZZZZZ\\ZkA;QXX-Zh^sZjZ\^k^io[_P`nE=RgE6f_aaca`acd`fpdcQiXARW`*6n`^dc`_^_^^acaQ`^d)@`g0Z`acdhgd^k0NVe-W_jifWQH5ILTX[[WQJKNNKJJJJJNKPUTWWVVVXTTUVVUaUVRTQTEWUXXWNуШУлХЮР№gKKXLHKKNKWIKIJKJFFFHHIHIZFJgEHCHHHFEF0EIIKHIFIIKH}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџRAQPPPPLaKKJKIKIFHJKJFFECFIJHIHHFIHIJFFHHIJIKIIIHJKK!QџмЬцмчущBE``^_^^^`_^^__`_^^\^i^^^`\_^\^^XRHA===>>;)A`W\\^^[WQ5^„rawŽ”’J8Z[X8zšzym‚‹}|zrm^;ifZ<_}vzzxvvtttwzz‡‡a0iZV=HŽpmoƒvvvsvyvxxyv„I4X[XEIwxwxvwyw€v}vtvs}ƒNEZZW=^zkjmkjhec`_^_a`j^c6RZ[WTVe[g[[[\^[XWZe[VUcW^>c\gfVTU_TRRTQTRRVRTRRTUR^L<<<;>>>AHJQX^a_`cccqW);;88;86!sзџудПŒtsj|“ЄЄŠ{of^QLIHEFQWn_a^'!`ЮГ`EP3kЧЙЇМЋ’ЊЏpxtdzЋЃЌВЗЉЙсЭТЮОУи‘Umj\^ZP^5HNQcXZZ_KJJNKKKKJXNNQUaUUWdZWXVVXVaUWTVQRTWWTWZZXЈлЫЦЏТВўhNLKKKHJKILIKKLJJIF[JJHIHJ2HEHEIFHEHHFFFHHVHHHIIKK}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџT>QQPPPLLIIJHIJHEFIWLIJIHFJJIHHHFFHIHFIHIIIIIIHJHHJJ)[џйЬллзќВ%V`P\^\\^^_^^_^\^\^^\^^^^^\^\^^\aNC@>==><<*F^X^^\\XUQ;pssz|™*U[[@A“ˆyzz‚{zrxLC[ZU=pprvz„z€ttvxxzˆ{5Hd[VWeXU=dwkomkmhcR`_``a__[T6a[dVFZ\X\\ZZ\\\[W[\VTUf_=Tn[fVTVTVUTT`TUUTTV`TPTURP>BEFPTVZ[XdWWV^K^#/-0*------**0#0#/BHPTWPIfi…ŠЂЄЉ‘yec`^\XXT^PZXNKNPPPPPQQTRTEUUV[hjpƒs‚€|‚rnoa_\\Z_RLIC-@=;;8<I™чщгъдЋ•a`e|rЁˆ‰qgKWALIIF3Z_yhie^J/-ˆж‚ ТеЭЈКБЄxzxxvŸŽЉТЗЙИšПУвЮКЧа42r\\^3-СњЮРЯєщРКЪИМЩМx&NUZ^cœ3>Qi\fNRџёЙ[y‘ЖђжœАсззжизЩэнП&Ueg@CЁЉЅ“š‘ЏˆŽL0IIHIHHJIJ`KPVmg;KLLNKLNPLNNZLNNP\NN\NQWrTBUVXWccT8UC[[\g^\^XmT@Qaa5X[[^Z^N^^i\ih^_\^ag8@ThUCqadcea``nscc`cda_T=RgTBva`mcdac\[`^_ooa`^h2Pja/Z_aehga_^a2RfQ4r^^^XC_3EIPVZ[[T\;JLJKJJJLL=QTWXXVXnXVUVWVURaVUTTVUVWWWX[5QђЩЭЮРОџfPKKJKKLHKKIJKKJIJIFIIFCIH^FHFIHHIIIIHFECIIIIJILKL|џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџYARQPPNNKJIJKIHIFIJKLLIHIJJFHHIIHHHHFFHHJIIIJJIIHIIKWџхзъчмьr;c`^\^\\_^^^__`^[[\\\^_^^\\^_^^[UKB@@==>>;>LW\^_^\WQCI€qcsz|–gHXfj>Z—Ž{z{‚ƒ€zzsq)XkZUKsvˆz{xtssrxz{z}q2VdWUK|stwvvxzˆzyz‚z‰q3Zg[VR•ˆzyyyzƒzxwxrsstŒI4dZV=^ƒypoymkhcana``_`^c>RZeVEW[[^\[[[^Z\e[ZXZFRQN5XffUEVVVVURUUTUWVVWTUURTP>Qd\^WRPRQPRQTUTVEFˆвТАz‹ƒ‡sy@J^dsZHUQJC><;888;=@CN^ГƒQar`X0WPf }IXPPPPH5FNRdfXWZm\WN*2kejˆЇd\E5F)yџџ‚#Ca[VPIC@=2-A2-/B4CCCCEHLB<=>VVWf^|™} vfcN^ZU\LF30>-€ДџиднйиРrUqsxyƒsj^CRPNIIPB^xŠsqha^\E'6ВмjB_<_ЙЫЉВЂЋaozgq‰ŒИЦЈШЙЙЧСЦРЭИСЈŽ-J^\^`#хјоЧїяМпэщзо|NVZ^cmЏcJ_n\_gчШ‘ЌЃ”РзВмЦЧуъсцдЯођ›HU[^)cŸЂŽ{š‘P*HJJFHHHIIKKP>QWkPIJJJNKLPPLKNNPNNPPP^N4Rih>P`WWXWXWVVt[Z^[gX[Zh2PVg;Tk^^[^^\\^_^^\^_j`od6Rgk-f`Reccnae`PeUcds`ƒ-P`f*n\_``cas`_^^Qtp`c_n>@TgAW_cefea`^n4P`nT^o^[T\F3IPTZ\\URKLLKKJKJJJPNQVWVVWWWWVWcaUUVTUVVVTRTVVXVLхбУбХЩяqLXLKLKLLKLLLIJJFIHFHJFFCFHFTIFIEFFIJHHHFFJHJJJKJJ|џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџRHRPPNLNJKLJiJHIIIIJIIJHHHHHFFFEHHIHJHFHHJKKJIHIHEHJQџфйячщщNFa__\^^\^\^\_`_^^^^^__^\^^\^^^\ZRH@>@>K>>;2QZ^_i^ZURA^…ocvz™@3ZkX2z•zyzŒƒzyw‘a@efZFarzzˆytsttx{{x…P>XdU4csvtsttwŠzxzxww‡PFffW=W„yxz„{{xzzwwgtstrr>VZXRVWdKEA<88668<>AHUvˆcQiZ<<=<</0JPRNNJKKPQUKikƒ—Ž—‡cPN[XRPH*)|вџџјаДЛЯ‘^onkkjd_eQPKLJ8V`i„|€…r}T_^aBnЗ„JQKCЉЧЯЃЊxzwjƒЁЅАЗЧ­ЙМЭяЈХИЦЊЂfC5[h^`2%бџећлесЮжУƒP`X\I[Уt/LX[Z_™ЦА‹ЃЏКЮмыужРзЭзжЯЮЩОXRVf[•ЅŒˆV-4FHUEHFHFHHKXKPUhf84JLNNNPPPKNNPNPPPQRfLQVhR=_UWZXWVXX[[X\\\[A\iRNTga6jio^i^[\\^^``j\^`_yA=TcTHmaandea`dc}eecaaoBAU`EW^j_tcccda^k`cccdm^T==@<<*Fg[\^^[WRA3||`p‚‡ƒx5Ve[HIŽŒ}zz}‚„zjt=J\[V8r€;[xzywststwzƒw8V[ZUBy‚wvtttstyzwwxwx‡|)X^[EEzvvxw„zzzxxyxv€x„`;WZW=\zpom[kmgeˆfdcdc^<=TdZWRV\\Z\\[\[^[ZVZXXIZV>PcZXURRTVTWUVVWVUUVVVUVU_P4Ue\XTRQTQRTRUUVVUUF8qАухО”Јc;Z^c=Nq\RLH@<;<8888<@CJT[{pW*АыџџўОЙ™ƒ`hdRa[UTNLPKNB[z„zƒА„|qPaei‰n&‡БfIL=™йЬЄ›v^yWƒ“ВОЧЗЬЄŸииСОЃЬ’Ÿ‚B*\\\_тљјсеТяїˆQWeNPg‘{`5\X[P—КЁœЙЦлУнсУжявѕЯИЖЂД>3UXfEH‘œЄ—d-JEEHIHHFIIHJJIPKQVqTTTQPNLKJJKJJJJKIJLJIJHHFJJIFFFFCHHHHJIJLJJJJIFHH‚<PџнДщцњz4_^^^\^^^^^^\^\^[\\__^^___^^[Z[[U8A><<<==;)Kg\\^^XVQAI€ont…Œd2X\X6h™ˆ{{‚ƒ‹|zˆŠ{5\\Z>Nƒqaˆ{wvvqtwvxrd0Z\Z;Qox‚‚€wvxzzzzzyyw’U5j\[Acxwyzzyxwvvyxtyyv;HVXVUXeWTX\\\[^\\[Z[ZWX[eXVU=aeZURaVVWWUkWUVRQVUURTCU^4RX\ZURURQQPR_TQVTRUUH3ˆМяџл’!N[cz=L’t`WPFC=<<<886<<@EJQWV8UPsšhPUPPPTUVZ[jf=3FKU[\ZZXfcc@=>JI­џИ35a_\XZUQNKEBA<<>>BJPeTWZX\ZUaTJE6!0!>HE@CPŠфџџщK;6QKE'#%)&'')')*-/-033)'#B<=>;<=;<<<<;)F``WWRJAB<<;<=/@BFKNEFPfЂПЙŽL4AQ2œхџјСˆad_KZUAPJL_KB\Tvˆ‚ˆЗЄƒˆkUfm…Жx5X„L^JVЩЙЈŒzhpœРШЖУЈИеЖРПЧМЇБ’ЗC)Z[\_)мьѓЯёјPVZ^_jЄnfP>ј8W[\E)ŸЊ›ЈСЯЫЯЧснмОУЯЮЭЊЇ‘*AVWf2k“ЏV/4CEFHCFHHHHEIKLLL>RZp@KKLPNNPPQNPPNPPQQTRk;PUhTBTaWUXZW[[[\[^\[\\\ZP3QaW/jo^j^[niq`aa^_j`_^\4PUkRVZjk^adfeTddfee`ap4LTf0\j_&NdfaR`aaccadsakCPVhFVjcff{ifdm-N`o'Xo^\\XRF4HPRWXXURKKNLJLKLLLLNTRUVXXWUZXZVVkXWVVQTUWXUXXZ[CплбЬСѕ`#JNLJLJKLKLLKJJIFHJKdHEEHHFCCEECFIIFHEIWJIHHFJJKWJ|џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџIITQQNPPLNKKJIIIIKKKJJFEFHIHIHFHEHFFIHIIKKJKJJHIFHHIPјозяяѓK@```^^^\^^^^^^^^[[[^^^^^^^_^\\ZWRF>><<=;8;APX^^^\XaP;_Šprz‡‹>Vj\W0zŒ}zz€„„„ozxˆQ6ggX>f€v‰yŠzƒywstswxxƒACd\X6w„x‚yttxy{zƒyzzxs‚<<<8;8;<@FI=@FNPRUXWXXVVRNR>)%PE6FpжџџмxC=@CEJ@KIfЂЯу[2Uj;V^``^^^^^aam_^_``aqXCUXW/Z\`a`efcdfdgffdcjT4TfTEjt^`cffaaa_ndTcaQ^c2RjW=x_egjggviU@Ro8Um_^[WQW0FLRUdXXRLIKLILLKZPPNRVVTcWWWUWVcUVXUUUUTWXVVXVVUVЛхбТД§nLKJJLLJKNLLLKKHIIIFH5CEIIFEEEHF^KHJEFHIJIKIFJKKJJ|џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ=>=><;;EdZ^\\fWTP;smnz}ˆ)Vf[FB–ˆzz|„ƒƒˆzxƒ8Xm\WE}„y{z^yzxvrqgŠŠ}x3VeZVB„zwsstyy{zzcz{ˆf3[\j@Pvx{{|{z{ƒxxzzyw„BI[XW=o„qspqprmiihfdca`^W;deXFc[[Z\[[^^[[XZZ\^\ZXR6a[eVTV[XWWZWWUVUWUTWWUVUQ@UZ\WCRTTRQQQ_RTTTTTTTQT8)Зџ‰^`z_=ir‹qUXPLEE>@@<=;8;<>AE;Q\c‹g^BQPPPQTZh`k_`joQEHQqeWRI&!JVC{яЩ3EQFUVWUUURPLIHC@<8<>ACFKRUUTUVUhcKH/3HIHeВџџфn&*@Bk‡oWRPKKJFF=UdqŽo”‹ƒДЏˆymRj[}œиЋ!VqJ^<#xϘzzo‚’ПВвЦЖЉвМЫУДлЄ™›{›šF=__^a%јџŒ!PUZ[Um‹‡gC@ўџџџхTaWXXXWUXWZ\^^^o_\iP>TgW=;'La\^_[[WR@L‡^^w{‡Œf%ZfW8jЂnz}‚“€}{y4[^[FPˆ{|zyywyvwxzzra4d\Z=dƒwxvqtvˆz{‡ŒzxxyˆHI[[V6s‡zyzzy}{xzzyxyzy‰g5X[XUA{zprstrno^kggefa`f;U[[VAV\X^n^^Z^\^[[^^[ZeW>TXeURVZZZWVXWUVVXXWUVaTVTPPXffUQTUTVRQQTVVTRUUVRQPC*P‡<_c`;owg‚e[QLHHCAB@==;8;=05P[d‡o\RPNPPTWX^^``ddermP&CH`f`44)>NK™ј˜!KZVRTRTQeT^JIFFA=8;8<=@CHNcRPRTRQ52;8;;;6;;<<;<<;=>0'0KЙійn83JF;3HRPNJKFHIC^n{ЌŽœ—АЅЇ‹‰p^z\tqrзЫŸn6‡_^K'oЁyw|‚Š™ЗЅЙКЖЋЏЛОКВ­Ѕ{‡‰Є–N\^^^mЂPV\\`hЅ‘g[4№џёёџџsKZ^_Г‡УвУЪёуМДлЮзЄУ›yaI^@PU[fU-FEFFHHHIFHH[IIIJKJK[LPRZaEe[WHe|oqstrrnnmmigqedoV/WeZREj[[\^^^[n^i\[^^^\dR>hZXTRX[[XWEUWVUWXVZXVUTUP2a\^ZTTTTTWVTRTaUVTURURPPQB25E_zU;ƒ|Ž{fZTK3HIHHHB>><<>CPX`xKQKJKLQV\_aQ^cdadewqA)@ABFF4RP[ЙУ[3LaX^\cNCP<8;8<;68;;8<;8;8;<;›ДWџџ;@ZF>;KIHHFN[mŒ„Ё•Џ‚˜š›Њ‘‡w[i^o|™ГО‘б•iˆR^\>Pˆƒtr•ВЗЯвЉЧ™гОЃД›ЯœzŠdЄБЋ2\Z\^BFRe^ah}cI>џўџцџіщі3VXgQЋУ­ЗПšЭзЮсмлоЯЧ“^md^X6QUjkK5CBFFHHIEFFHHHIIJLKP`NPakPKNPNLPPNLPPQTPRPTUV`=PRg`6TUTTiWZWWX[\\\\^^ZUNLPfQFk`^```^^_`a`__k^``e6RhW8gmdadcamEdfegceoPcAQ`W8q`dpWeedc_`aQБXfnar*Nga8pcqhhgdd[RPQq8VXX\fVQJ4FPRUZXWRLIKLJIKKNNLNRVUUTVXWkWVUVWiCRTTVVTUaXVTVVЬєбПэkLNNLLNKPLJKIJKLKJKIHIJJIJHIHIHUHFEFIIHIUIHIHJKJJKџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ==;%Ed[^i^[XTP/xxmsƒ|‹„)UfX@LŒ}|ƒ‚€zzŽ;XfZHJ€\{{nzivwz|…z…y'[mZAP‚€vttvr“zzzzzy‚{a=[\VNNKIHEC><;68=>AAHIJI/-ANPnџоt;IJ>&0/-0/------)*)''%#&&&&*)038F8;<60-!H;;<;;;;;8;6<0NVZ[\XNCA;;8;8;;;8<;;;;<<;<c џџќ˜EЫџъ_CZT@sofe}c^cfdqfdffco*<_V0ka`dfefgea^aQЗPcaan5=Tp8eadfqgfemd*R`R8hZ^\ZRPFCKPUXZdVPJKKJLKLLJPNNTRUVXZVWWVURUWERRUWWTUTVVVRVwєСШєgPNKKLNNKNJKNLKJKJIIHIF5EECHIHIJHHFHIFIFFHIIKJJJJK|џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ<=8&I`^^^^\VQAKnowzg%Zk[6h|qƒ“„‘zz…}0\^X>P}wŒŽˆ}zexz{||{{€T<\h[4i‹yvxxy‡qŠ‰zŒz{ŠˆŒ=Zk[T'Š}|z{zzz{zzz|{zƒRIj[WET…rttstspnm^nhged_=8cZZUF^i^^^\^^[^\\\\_^LZCCcXXREX[\\[ZXXZ[ZWXX`UUV_PBi^gVTTVTVVUUVUUUUTRQRRQPPL2Pe^a<џџЈ”o^hXQPPPP^QRNJE@/KW[t{ZQ;IFIJLPT[`R`^`Tdceacm}I;XNxзЃ/@!/F--HPQRUqaPKNJECB=8886;=>BEE06HFEmЧј }8PWL&!00-0/2/-//-)*))'&&&%&%'')02688;<6HCEHHIFIHFHIJIIKJKLdKPVkV>NQPPPNRQP\PR_TRWWVi=NTcWCUVXXVX[ZX[ZX[[[[\\qA@VpQFf^jpi^j____^^```kih=QaW2^cfgdeTepffdfghfpTRjU8^aeVNizdy-PVnag^nZXcFCJQUX[[VRKLJIJKIJJLL>^RgTVWZXcVWWUaVVaUWWWVUaTTWa-єЪПъmKLNJLKKLXKLKLKKJIFHJIHTHTFHHIJHJUJHHEFEFFIIHIKJKK|џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ<>RQPPNKJLLLJKKIHIKKIJIHFIHIIEFTHIHHIHHHIFHJHHHFHJIIZѓощџ_/_^c`_\[[Z[^^\\\^^[[^i^^\^^Z\^\eTF@=;<><<6)XXZi^\XVP8^tmsz‡‘F>j^W8€ƒ{{ƒƒƒ…€{’T6f[X@v…Š‰}xiy|{|}|‡6VfkX=…Šyxwyz‚xzzz{‡xt/Z^[>P|{}||}|zzzyz|z…„CJ\[T6y€tttrknmk{kgfnk;TdZWTZo_^^\^^^^\^^\^^^fg8WeZWTWZ[ZXZXWXWXZXZW6AUVQ2VfmXTTUTWUUWVWURQTURRQQQP[<>Xn`^!‰џџўБ˜rTJRPRUTVWVRPH2KV\s‹[AHFABHIN^W_q``^adsodca`t^4K\h“ѕxCлZV\I/!JdRUXUTQPNJFB>;8858;=B6;EKEwыџЭjFe^Q!//0---//--/*****'&&%&#B%')/248888<;E26!!%F;8;88868868<*KV\^i[^FN86868888888<;<8;<%šзџъщћџъџй}8oџџŠ5;ZR>>hЄŠЃЄ•™Ћ˜ƒšЌДЈŒvnWv‚’УЅ™Љ•ЦмЙ%cŽN\[8H„ƒЄЅСЖЄжССТРЧЙБЦir˜ŠЯАџџ)@fZ[kBQZ™aKF-8ЋъиъвпяЫцџычіp@@W^^˜змРеХЂВЬЫ Œ}pd^WTKLKPUifPQRTUTVVWW_<>=><;8BeX^i_[ZTP8wn…Ž|Œ…/WffHBŠz{ƒ‡‡„}‰‡>Xk\HCgwŽzxz„n}}Švr-[[V;688<-;B>4gоџЬR6h_A2C#0--0*//----**--**)''&&&&&%'*238668668E2/#F5668;8;8558;0^UX^_[T6N'68666;888;88;88<TЊџџќмиёолГ‘‹aB#oџљ2BLJ0h™Џ’˜Њ…š ЁЉ…|vZtМ™ЈРТОЌбЖ;a‚^[\@JzЁЃвХЦЙРеЖХУУМŸТ{ftЦйџЅ&NaZkXFf_\U@)5 ЙЫаэЫоётбџзщзщ'TW[^TПсОРгг‰УПЄˆ‰{a[RL8HKLRXqR8HFEIHIHIJIIFJKJLLNLc=PVqR>QQQPPPPP^RRRUQTaXWi@@WZT5hXXVZXXXZVZ^Ap[Z[^k5L_jCUm^^^`^^_aac`Q_dc`hV5RkX;_teegeveeefhgff`v;@Ta=\jasfgghfeccecdefc^RPVgBJkchjhhVzW)RfT6VZ^[fTZ)FKQV[ZXTLJKNZKKJILNNPQUXIdZVWWVTUXVVUUUUUVWWUUccV›хЦэeLLKIWLNKLLJKKJJLLIJIJIJEHIHHIFRCEHICEEFFHJIIJIKKj|џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ=<>>88I_Z\_^XWU>Hm_x€‘g%XkZ@h–‡zz€…‡„|Šj/[\ZI^jt}|xw{}{||‰rT=e\VBhzzwtvƒƒˆ‰z{z{ƒ€2Z[XF;„ˆ|{zzzzz{y{{zy=Xk[V5q€vttsrqzznzgreoHTZ[VBXi^am_aa^\^_``^\_\W8VZ[WAVe\\\ZX[WXWXeX[hW`eQ=W\gZATWWVTQTTVaTRTVQRQPPPP8R[_hWC!œЮілЋЇ‚„i^EWp—qef…^T4_[szhR4'=>=>AHK^H^qcdood``am^X86\ZœУZ48Cgj8[[eWP6)KdXVnWRUPKIC=86;-C=H5aзџуa2#{џџoxcrhicc^*Pf_2_Z\^[Zc6CILUdXdTNILKNJJWJLJL\TUhXdVXhWWFcXTUWVRUVcUVUVhVW#*јЯњqLLJIIJIKKKJJKLKKKJVHJIIHFEFHFEFFEFTFFFEEUJFIJJJJK}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ=<8-Na\i^[XVR;_‚^pzˆ“P3d\W=‰{z‚ƒ„‚‡“W>o^W>es„}zy{}{z„6Wg\EL€zxxdh||||{zz{Œf6ZZV>U‰{||}z|yyzzŽh-X\WHF…}vrftqqroppmiXfn^=XfeUH^jPPmca_k^^Œq^i^hfT@d\dRTV\\ZfX[ZXXXZfZZWXaT@Qd\jVUUTVTUUUUUWUVUUURQPPLL@X^nZQP/ЄЧьэфzT_e[J_eikgfh;QZ\t^TH-;;<>>@AFNU[^_a_ceedw`e)TPjЊЊ[22IRk^[[X\pcP6&P`[X[VRPLHE@;)00JAXВџџt/\aH=86685456355;)WUW\heQEB6555654666686888%€йыо№ё№лЙБ‰ecZTKJLT#эмW4PE%H‰ ЖЂЃЁЂЄД땇z^yt’ДС­Џ ЁЖ оЩ[UZ_ЩХРШЩЈ•™‡‚jZN5BEBFLL^Uk_;HFHIHFFFIJ8JLKKJJIL[KQVhU4PPPQRQTPRRRTTBUWXWmK>TcVEcjXZXX[ZZ\\\K\\\[\p=P`p5Zi^__jamacdd^^_a`QnT5UXTEocagdgVdeegfhfcrt3N`a2wxfacehhhgcfdefghey5PWc!ndfhgWgv_AAThAQZ\[gX`;4FZTW[ZWRKLKKKJ^KNKNNTVUVUXHVUXUZWVVXVTWVWWTQCTXTVоЫєqNKLJJLKLNLK^JKJLKIIHJIHFERETICFFFFHHTEEEFHFHIIKKK|џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ<;#A[X\i^\eTP8rj_}z€Žˆ0HjeJB’ŠzŒƒk|BEKRZg^^\_`ccsZ6>^^Љ•WZ<*FKRZeZX[gmXPHQt^_[WQPJC@-*Q@C‰џџ“@_gX88HIEFC@U4-///)%;)-/-//---))'%&%%')/233246886662/!%E568555354355;[^d\m[RFA6545555688486;;;F•јШЦэъоЫИ€hK[TKJCFJ4I5&”№Ж>2Q=)UЙЏЬЏЩ“­дoš{Tgr™ŸОиЏ™Жб‰АаЪEyi\^&ДЮУОлДЬВРлЬыؘ”oLPRqR6UXZdU#FГЅ˜ЄЏКЬхђоннммщСбйЮУPWZ\UЮщжЛ“‘Š’œ‚poR6EBBCCIKNRchP4HHHJHHIJKKLKKHKKJNPPLTZhPPPPQPQQQRTTTRCaXXaN8PUj5UdW[^[[ZZ\[\[\Z[[\iP>RaUFo^`_\^c`cacaa^ama`s3PgV%mccfrregeeegggdTw4>Ug<;<=<;%F^X^^^\XTP@|k^v|ˆk*X\Z3f|o‚…ŽŒ|z’|*\mXHcŠˆ€Z}|zn€|ŒU5k\Z;k‡xiyz…‡k}}zy…}“ˆ2ZZX=F‹z{€€{}{{{{{Šˆ=\^\U8{}€svswwvrqqnmh|h8UjZUB\aaca`^^ca_^^^^^\\UFi[[UTZ\[WZ\g[\XCdXXWZZWT=TZ\ZRTaVUTVUUVTVVUTQRRQRPNJPk\\WQPLK>5ˆЙМЊf[zkm|pŠ‹^3X^qpXRIA<;88;;==AFLU[[Z\_a`^V6VToВ‰KZTLJEFJQWZZWX[fcQ;TorooaPKF3NN=pяџ BUh^46KKWIIECAA;0-*/--/--///I-*-))&%&&)**03223465666840%!%4645554444452!EZmWmX\HR%345445588556588|ЄЪМШђъсŸ‘}jZQLIBC*PTZLC%=Џѓ˜AJP25‚Ц У–ЛжŸwvˆ\q{Š‹•ЛЧЂŸП›УОфЯ…&/i^^^4&ЊсЈОРТХЬщЬХЖЙЂВWN^X^g#P`Z[i6яЖŽЃЇШсяђщллущдмжЧбА)4TXo&[хеЄ‰ЄzŠ{JIBEBABBEKKPVihPUrV;LNPPQRRTTUTUTXWXWUc>NRgUQX[Z\m\\\^^\\^^Z\ZZU8Paa)ih^\j^kam`aes`c__mp5PVgF[tecgshfgdceeygg^W0PiU3{fIdfffsgdcediigf_n-fdX3iahhhefem8RjV*aZ^^\ZgCJPUmXXTP=<6KfZ^^Z[XQ@\xjpy}}Ža0ZfW0}™}}„„‡„‚pˆ˜Z8f\X;k‚|{{yz‰€€‚{€2Wg\JE‘zv^yn||{z‡•Z8[\U=g•ˆ||}{}}|zzz“ZA^ZZ>Q„t€wrsvv€vrsrongnWX\eHUWVVWVUQUTRRUURRTRQQPJ3aZ[VQNLLKKL&0—Д­tezee[r6X^apXUQKB><8;=;;=>BFPTcZ\_^[W;ET`УX[CPPPK6EHPTe[ZX^gdT5!RnnZWR8/;F>ВџЬJAi^IWRPPLNKKFEC>;2/-//--**/-/-**)*)'&'&*/0/220434588)<&6&/#*0)''<&'&'CFJQaWCK423444346545556!—ЂšБЯЮаЙ}\^TKFECFJU_ccNKRJЮъpCQ=LЏяЙ­ЧЂ‚|”dsc„” ЊХЏ”БМСЗЇПЗ“<0hz[^5ЙтХЙЯЄЬпЯтЗЏi*PUX[XŽЙ<%PpXf\*ВДƒœ“ЇмажлЪиъжзщЭСЯЧаBV^aЌ­˜–ƒ’–˜‚c43ACBACCEIW=QWhPHFHIJIJHJJJJLHIILLLPPLRdj=LPPTTQUQQTTWVVVFWWaR@QWi4Vj\\[Z[^\^^^\[\[[ZR@@VjQR[^i_Pk_^caca_k^`aiW5UhW4rceWhfefeagxesxfo&PUf-qtfddghfgfacxthsfsf4PXa-gdfjhedqpB3ao6eX^[ZZ‡5/INUUXZaPJNKJ^K^KJLLP`VUXWWZ[ZXWdXVWZCTUUaUTQTaTU5ьѕcKJJJIKKKKKLKJIEIIIH5HFFIJJJHIHIHFFFI[HHFHIHFJIJKW|џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ&HPQPNLLLLJJKKIHFHHJJIFHFEFBEFRFFFFIIIJKIHJJIIFHCFHJmџѕ\2^_^^^^^\[\[\\\\\\\^^^^^Z^\[\\^[dH>=;<=<86@_Vf^^[[UQ6qzn{|„ˆ==j\W@‰‡}rƒ‡ˆ‘…|=Xg[I;ˆ’}}|{z}Š€ˆ‹{'eg[5W•ƒzz„ˆ{ˆ|z||ˆ4ZpZU6Œ|{{{}{zz‰=Lg[XBe‚tsvwvwvvrqpzkm{p=UidTT[add_<_``^^^`p^^[ZUAm\dTFZZ^ZX\ZXZ^[ZZZZWZWV*Uj\ZTXXWWUVVTUUVTTQTQRPPPL2R[^[R^PNLJJKL8sz„ŸЅЅzŠƒ{t}<8<;;=<>@AFLRWZk[R4V`nЛUZQ@PQRaPH5H^k[XZ[[miQ;*LwkV>EFCƒ№џz3j^EFVV`PNPPPkJFB@<5/------/0-*--*--''&))-//0236%'*356JK^W``aah`\aea\[PPLKHFC'%8440=#22233254535466XЈРŒЅ­УВЅo^RPJEEFЗзГОХлмьџТЋa2PW[^c`‰в‘6RhZ^J!ДВџЧИиЬцегТЧжУчХИМЙЈN2UW^J*’œŸЂƒ’h8EAABCBBECCKKLUio=5EIIHIJLIJJLKKKNNNKd;PUhU<;<8;;<>>EILhXWU8UPhЗzIZPPNNRRTRR6/KQVX\[Z\\hcBIQ4=X[_6@ЋЇЙ’еЗмсеввновмxДКЇ“>>UXh@CАŸŒ„‘z2-B@BAABCCFCHWLRVqP8HFHFJJKJJILLLLKdNNPP;QWp6QRTTUVUTQ`XVVWVVXXdT4Pgg4gfg\^\[[\^^^J___^Zk6Pai4W\^[^^^_`^a^\_^`o_wC2Uq=XqfgihfffpegdghrsW2RhW><;JUX\^^[VQCZ}iqx}e2ZfZAj‚}ƒˆ‡ˆƒ}|ˆ˜g6f^W8i˜}ˆz{{€€}‰8dLVe[IE‰Šh{}}}}}zz}šWA^mV3h‰{{|zm}|{z||‰z‰‹V3^^X5c‡ttwrsvrrqqrzpwx@;<<=;<==@<<6!^W\\\[jVQA_rmeƒ}‡ˆN8e^W3ŽŒ|‚…ˆ‰‡ƒƒ'J\fW8‚”‚€ˆ}•‚€’\^4V[[5cŒzƒ„{||ˆ{‰Š!X\[WUd^^ZZhFAFLRX[dU\5H^LXJKKKLXPRTVUUVTVWWXXWUcVVXUWVTUTVRTWXџˆJIJIJKKLKLJWIWKLIFHHFFHUHIJIEIIHHIHFIEZII[EIIJLIJ}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ&JQQPNPNKNKJLKKLIJHHHFEHIIHFCEFHFHHHIIIIFHFIHHHFEHIIџ^6^^_^\[^\\^^^^^^\^_^__^\\XZ\h^[dRI@>>@><662aX[^^[ZUP8tin€||'FefKI’}rˆ‡ˆ‡€€Ž€#W\[@H‹ƒ|€€„Ž‚€‰|Ša}„a[RICCEBBA@<<8<>@BH>CHNUeWWdWVVUQZIFB=60-------/23;PVNLVcŒЂЮбГЃƒheR[ZWVT[JITHFFJJIKKJLKZNPQRTXZhniz{Š™{€hfe\WUKE#&œЮэЇ”ne^TNJIFFKEap{šЊ•™Џ›tjiozЇИЉ_RВ|H^F#^ЇХ“r`zZ ЗЗŽУЪЬВГбАЇœЂˆ•€I/UwZ^>УўџRWfPcnodH<цџщџ%\Z\P-”ЦВВгАхбвдгЯл№ЯБЂ|ˆ6QVZ\%{›N*A@@A@@BCCCEBBFFILNTigLFFFFHIJKLKLLKKLPLPP\LPUkVBUVUWVWWWWZXWVXVXeX`>iIv8V\h\^^^[r\^^^__^k_kR5UpAUsN^Q`^K@^`caE^t`PpRNTcVEsgghfXghgTgheefet3QgV5vsjigefVhefVehsghn[3RpU=;@>;NFdZ\\^^ZTPEz[azˆg0W\Z8hˆ€ˆ‰‡ƒ€€Œ›k8ngZ8h‹‚‚ƒ€s‚‚€{Š>XtfWL€yz{z}{z}}‚€ˆL=\ZU4m‘€€}}}}yzz‡•TA\fV6hxyy‰vqpcqtqonykm4W[ZTAmt`deeeoddacakhXUhCT[ZZTZi_^^`__^\^^^^[ZZZWPQZ\[FTXWVVVVWWWVVVUVTTQTQP8_Z[ZUP=LKKLKJIJJIKJK/BЙџџI`s`4i‹sxeZRJHHJTHE><<6;==A*P[dŒy_VAPLLQRTXZZh`_achU;CEHKKE%<;<*BIPUZeXXZWVURPKIHB=0-----0!'%LUR>EcСзУОqmNJCUQQLICB@)8###!'%#'#''%%-BBEK@>BH>W\m…’™Ÿ–‡xhd\TP5oићЫŒzQLZQKIHJK@_o—ˆ—ЃšВЂ•noZnxˆЈЃЩk%%z˜UN^3;–Б‘{p‰ЈЈЖБГРЋДЅЬЄЉ•Јœ…mQ2X[Z^)'ќ”QW\\Jk™ˆaKE8уџоСџдEkKhAPЖЊЩвЪЮЮОХЯЭЬЮМАЊ›‚exc-@ceZ=c%@=<<6*JV\^\^^XQBZxhqzˆŒ„>2Z\X<|ˆ|ƒˆˆr€€”E>\[J3€‚…t}€‚ƒ€{„0Z^XFE‰{}}ˆzm{|}‘ƒ3WkZH>Œ‚€€}|{z{yX„8Z\Z>^„wyt‚wttqqs|poomy^2XeXAV^acddecadd^j^^qBN>cf[VCg_j^`_^^_^^Z^\[X[ZR3W\kWRWiWXXWXZWWUUTRTQ_QQP8Phf[URPNKKKKIKIHJJKJI;^лоAcef>=8<=BHKRVW[\jXWaUNJLKF>6--/!#2IJRPIB/'&)'5432/!%%#%/[2222002//25'-&8KPR>KNN@IKe‰ ЈЂ„rne^CIЂ›eXUPKJIKQ`U} ‘–—ˆŸВ­w_\eƒЈšСЧ–ReЈc`^E-všzyWs’ЄСЃВЈЬД™УЫЗЅ™ŽŠšx‚d)Zm[^8JKT[\Kk‘kUX>/Уоѕлалњ™XW[^ДДСЫхЮЯиЮОЛПИ­Ћ•zXi‰L@RX[V%3=QXmTPTUUcUWUVUX[XXZX[XX`2ƒLc0hZKZZX\_`^aq_acarPr3Nfa;a[^RT^^^Z\_`^a^^`^t8ffmV>RgI\vhfhhijifTnqrhiig`BAUk8^rchgihf^Q6ja3RZ\^XZf*CIPTXZXR[HIKKKNKKKJ'=UVXXWZWVWZUWXdXXWXUVRUTTVXVXJNЊJKJJINNKKLLL\HHIKKJFFFHIIIHIFEIHEFFFCHHHUHHJJKJKI}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ&FQPPLNNLLKJLKKKJIJKIIKJHFEIIHHFETFHFJIFHIFIIJFCFHIK'ЃЏ<^^^^[\^^\^^\^^^^^^^^^\\^^^ZZX[[UJA>>==8<5'^c^\^^kVN8^fkv|…5F[\J@ˆŠ‚‡…„‚€…“–2Wf[JN˜ŒŽ‡“‘ƒƒŽ–g3[fXAgxm}€}zz{|d€‹’#\mZ=XŽ‚€p|ˆz{zz‚{f4efXЙЄitk`VPNKNNNZNHB=;;@Ic`w…\V=JHHNP_V[[Z[``fgfaw_#6RP_Ће^>E2'><>@=8;&#!223422006!#!#-0002000----48>HNQP\LC@-BHNTCaz ЖГšpVNE*BT\TRJJIINIv{ˆЏЅЏЃЈ—ˆzckc‘ЁЈ’ПЋЌK6rwP_P5x˜qvn€ЃзбЂвП‚ДИГЉ‰ˆŒzzЂk[kZ^U#5IVhIxšŒaXIсџ˜ЮЯбдџџ/EVZ^ВЧМЧълЯпоЭЯРЙЖ”[jj…{2PVXsN3AAAA@ABECBCBCEBBFFKCJPVZX\ZVUVW`QPLVFA)-JKF4VКџџч…F6QI02#-**-//0022030-!!!!#*0Z20/0/-**-48BXUWUQK3>3!)/EJA@HišШЧŠtNPJ8;8PJHKKWaw”ДƒЌАŽЃЁЁЗȘ}rkp{Ё‘›БЙМХŸ2™R^\8Vjeˆ”џЙЛЖПДаДвъ‹“hŠknаNXXZkQ;'4ЮяіЭОЯЯвяєы%-VWmB-ПЪУзтаХЭоШбЭБwNThgk[8UXie4BAAAABEBACPBBBEFCEIXLQXkNHIJJFKLKLKPLNNNPPQPQ8PVkTPRVVVWZZXXXZWZX[eWgQ>Pcc5Wgh\^_acc^i`^`_``iq4PaV*k`^_^^^\kka_^j_aakw&PXk/wdRdhijjgigiyshhz/Pak'pegigjzhsqe`Ugiimhg'PVa/xpU{gihvX4Qi_5UXZ[ZjPEEKQTmWVcJFJKLIKKKKLRUWX[jeWXZWZWWWZUUVZqTTVUcXXXU<ˆ&JIKFFHIJKIJIFIUIHJJUIIFIIIJHEEFIIHCBEEEHVJIIFJKKL}џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ&;PPPNPLLJNJIIKKKJJKLKHKJIHFFEEFFFHJHFIIFIHHHIHFIIHK/“d^[^^\q\^^[[Z^_`^\``^\[\^^\\h\[[WPC><=>=<8HdZh^^\XQNVvhqz|„f0W\X6h‡}Ž‡ˆˆ‡‚€ƒ™\-[[W6z•ƒƒ„oƒ‚……ƒzˆ-Wo\FP…z‹ƒ‚ˆp}‚ŒŽŒ4W\[I;‹Œ‹€€||{{|z{zŽ„8Z[d=BwyywtqrtrokqpowZ>eZXF\oghfcdeceeeda```nHRcXWEXh^a`^A[^`^^\[\^^^[E8h\ZUUZ[ZWVXWWWWUTWccWUTRP5g\[VTQPPQPLLLKKJKKKIIKII8FJQ2>rЈлЈz\Q^J8=5JP\x{‹ЋœЂШ˜ГЃЄ“ƒЇƒs_mvЃГЅЄБПЦ=cƒP^^I;„eЫУйКИИЉлЄЄОЃЧtjqŠОЧL0VXZhQ;@aЄ€TXF/=СяЖЬёЮЭибпЮў™5VZ_!gбмЭцлмПШУщСšoeggefyrAPRZtNEBAABABCCBBCBEBCCHELKPamhVp<><=<6&K`\_^\ZTN6[ehqzˆ“H8djI;xˆ€‚ˆ…ˆˆ…‚‚”–AIf\J2‡‡…ƒ„„ƒ…„‘k4[fX5f„im‰ƒŒ€€€ ‹y6Z\Z@RŒ‹€ŠŽ||zz{}{{“eC\[Xqrhieqdecaadpdda`k6UZZTRim^`a^^__`j_\[[[\\W3UjZXUX[XZZVWZZZXVVVVWTTRQ@Vj\[RRRPPQPPLLKJLKKKIKKJF/U^e{2Iџџќ—ˆˆVg^VVXZL\_^\VQ;5RZk{\TH0>AAFJNRW[^^^_cm_w``_Z55NW’щw8=W[m^Zda\F-655;>BHKPUXZX[ZVW`TL>2;HHIJJLKKLNPNLJK[NPPP\>QXsBPTVVWWVWVXcZf[[X[ZVPLVhaCW\^_`__`^_^_a^_^agR'^aV=p^`_^6^ma_^^`k_aP^W3UkUFqggghjexfgjieei|\4TjUZgfijhihhhgikjizvV3VqHXvcResgpoA@Rq3eUZ^ZZ^'CINQWXXTN4LLLLKKKKKKaQWVXWZXVXdXWWWZWFXWUUVZeXXWUUc<;=>=8-_W\^ih[UP@^fmz|„„-EdeFE‹|…ˆˆ‰‘„…š‡5[h\>UŸŽy‡„ƒƒ…‡‚v‚•UA[[V5{xz‚€}Šn{–Z@fgX-k“‚zk|ˆˆ{z|zz‚Pdf[XTPRQPNPLKLKJKKKJJJIIFNkdweбџыъР‡˜|R^WWmsccccm^T;RZ^…oVH@;<>BCJNTV^_\^`^P__t^ZC;\h Оp/3@`j\ZWZ[c^H=688>ABHLPVWZUkUT^=6E>8NОџџПA2PU)!00-*)))&&&'''**-000200/-###%)//-/-*-*))*4;HU[[n[PE>!-0/0202223)ˆЂW%)sЮъЊdWRZ=>j ЉЋЁЙЄŒЃ’ИДЊЂo`[jsŒŽœЃЃ˜™ОДЦ€'yp[^I=wЏЈщ‹ђ›ДИИЧВОЇРŠnj”бp)NpWeZCnwH20AЁ•­зРХнЭЮщЮЯЬЮЗа&UW^@5ЯзШтЮвХЯОŒ™|ad^KZcP)VLTXiR2ABBACBEEBCECCEFCEFVJNUcg6JIIJLLLLNKLc^___i^h\\\[\[\[\a_^\^^^^h\\Z\[[X\E@;<<=<6@a[^^\\ZUPBpfox{{s)U[[AW“‡ˆˆˆ…ƒv‚™z&^_^A^““”‚€ƒƒ”ƒ„‚‚‰™=W[[IE’{|}€€€€qz˜5K\fV=ˆ‡€‹‚mPzˆ{z{zyˆv5f^fICƒt€vvvwtsoqqrpnkyLHe[WC^tefhfedgccF;`ceonUhTUe^A^^aa_m``kaa^`^n4NUg5Wscccm`^_^^`__^_^^qBBac8^cqedf‚iijdLoRtes5LTg0yygfVkkmhgfhjhgwh8Pcc&w`chsfdco'QfU-aW[ZWUK4EKPUZ[cRKJNP[_JIJLLNRBW^[XXHWXUdWVVWVUUUWXoXHXWXVQJKKJHVJKKKKJJJHKIIIIHI[CCHFIUHEEIHFIHHEEHJIFFJIJXKџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџERPPKLJJJHKIIJHHJIFFJIHIIIHFITHIHIIHUFHFHIJJIJHFFHHKa\_`^_[^^\[\\[^\_a_\^^[^\\^[\\ZXV[C><><><6E_[^^\fXTPVqhszzz€c&cfX8i’’…ˆ‡‡‚‚„ƒ™\;g^Z;ƒŒŠ€…ƒ‡‡„„‚”-Z\Z@V–|}‚€‚’€%\g[@L–”}‹}|}|{|{„zŒd2\^W5dˆtvvvrtttrsrpqzvr4W\[U@tfeeeegegfo`=eefsf5afZREZ\_^_``^^_^^^[^\mXU@hfXTCTVXL<ЅAWdXUUWVVVUWU=МъЯB5QCHЄБЩЖŽЄ™ЈЄœ™™njfjvƒ’М“ЈККЇœПуЊ3`i\^F#eлдсЪЉРЗДВЩЊО|„š’aJLN4=QWZfV2'=’„{œЋДЏВЦЦЧЪЬелЗЬ­КwTX[cХхВоЬОЈ›{ˆ‹h_X_J4@@BJPTXr^2B@CB@EFFFCFEEFFFFHLJPVi_8JKJJKKKNPШPPPPPQN@d8NTqRATRTTRTUVTXWZVW[\XdTLQkX0j_j`ca`_aQ_^^`^P^qX=TgWCzdc_dac`ParQ`^`qdq[&TtU;secfgmkjjXe|P„z=0TpHCƒffpffvnmjjZjmjkh`F6WkC\sghgyrem-P`_*iVZkXXa2CKNTVeZUNILLLKHLKJINQV–WWZVXXXWXWZZWXVWXVk\XXdWVVP`KJ\VIFVJWJIKKKJIUJUFFIFcFFICEHFCCHFIF^FHIF[HFHLJJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџFPPPPLIHKJKKKIJHJJJHIHEFFHHFFFHHFFEFJJHFTIIIFHHFF[HNW\_`_^\^^^[\[^o^^k_ZZ\\^^^[\^\XW_LA><<==;4)Va\^^[[WQ@[a\v„‡ŠxA6ifW—‘|Uzƒ„‡ƒ„……‚€j8[[Z3i‚€ŒdŽ„›h8\^W3iŒzZ{{}z{zŒkyxˆ=I[\V8z…vvvvrrqsdsrp`nz^3dfWFX{hgfcfhhgdexeh“gaH;dZcEWg`aaam^[_`j^\^^`^XCR[\WQUaWW[FЖEUXUVWWVVTWWR0VefVQQQPPNNPNPNNKKKLKKJJF>d`epW@ЮьџтъЪyeqjWhixoxq_/W[kkZRH><;<8<<>BFK\Tf^c`_\ea4F^WЂЅ^`UNJJECHLTXdVVX\deI0<;>BHXN\Q5;K6CŸџў‚@PhXV32220-20/-)')&&%#&)))/0//0///--#!%#///--*)))'''4=Jf\\^[RE=#*-02222235dŠkd^HA>RV=)<мџЏ8@H3)RРаХЃЃЖЄЈЉМ€VfXtŽЏЂВЪЌЇœГГлО4^n[\PŒхооЃДЪЁЗИРЏ‚€Ђa!LgWVsk6UZ[nU0Є zœЬВТсЗХгШЪйзЮЛЌœ–C;WX_2'жХмВЉЁ™‘…td^fL4BAAACIPWZp=C@BBBBBCECEEEFFEFFJNKRZzUhW\fZg-CIN_Z[W`\5IJXKJIKKJNRXWWWWXWWZVXZWdFUWWZfXXkXXRRURRKKHEHJFJIKLaKJHFHHFFCJFJ5FHFEHIEHFFHHI5FTHIJHIIILџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ@RPNPLJJLKJIJJJJKHKJJJJJIHHFEEFHHEFFHEHEFHJIFEFEFFIPW^_^^\^^^^\^\^^\^__\ZZ\^^^^^^ZZXTIA<<8<<<-ZX\^_^ZVPCgakƒ{…y|6FekJ<ˆ‡‰‰‡ƒ…‘œ”5[^[>N”“ky€ƒ„‘‘‡ˆ…‚“I=fkUУуыдлИoVtr^`qr|o=<;<=>AEKPVyyq^[R3;\f›•X^VNJJJIECFJRXeVVW[i_L0)#&-/222203cfЄZJ\eRKJ@C^c><вы™@@H)jРЉАЃГŽО‡chZ^z‰ПЇЉЊПšЈЉЙсЊP#^pZ\IШыЂЇУЗОИоВ›„a/N`[[Q|`)N`d[j5y–Ё”УЏ›ЯмЧвЂдПзХКАЁЅy%\_da^WQHC><<;<88>>BHJPVX\eU=Q[e–™f^C;LKXNLJFCFNUijWXX[e_K>&=A4/6K8eЯџО@ZnaITLF>43/2-*-/-/-***&%'&&`&))-*-0*//0/)!!!%!)/-))))'''%'4=K`[^^\_J>/&*-032232#oh•IZXV@K=PZvzdTC-Bэџ}0LF#=ЛЋЖ ™’ˆthekvƒВЃ—‹Т­ЈЉЈЫД—X0Xk\^K#эТЈЧДЇГдЧПR0PfX^ToЙЇ3LeW[^8”ŽЃИДОйЧЖЙЦЧЯгШЏЉ’“nTX^UУœ“›™‘•wUWP4A@@A@AABJNUZpKCCBAEBFCQEEEEHIHFFJK=Rdg>IJLPNPPNPPPPRRQTRTTN@Rc`UjTVrdqehtjvfggdgyzcFAVg3^z{gzkj[\mmihjxxkr^BQWX3y}Wfhfzaj4TjR5eTVZZ`K'FLQVVXaRJIKJLKIKLKJNUTZZ[WWcWXUUVVVXWUWWWWn[VVWWWRNKLKKJWKHIIIIIKHIJHIFHIJIKJEHHIIHFIHIEIHFHEIHJIIKџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџFPNPLKJIJJJJJJKLIHHJIHIIIHFHFHFEECCEFHEHHHHUFHHFFHK`Z\\\\i^^[\\\\[\^^^^[ZX[\^^^^^\ZWPE@=;<<;6!Eg[\\^^WTPV`gp€zˆ€`&Xg[;t€q‚…ˆˆn‚‚•šX5gmX/… ‡‘‚‡ˆˆ„‡ˆƒ„‘6Zg[5Vˆ€rƒ……„‚„‚”m5Z[X=f–€‰}z‹zz|zyˆqN‰=HkZUAh|…vttrtsssraprpz^/dZX8^seafggefgfhhhedgzBCi[T5[i^`a`caac^^\^^^`^X4V\nVAXZZ[[Z[ZXXXVXVVWWURLBig[TQTTQPN[KPPNPNNIJIHFF6XjdkXLHHHI0‰схбЦЖˆm‰ˆiŒz-Z^kaKZTNICA==<<;6=>>BHJ[RTR=C[a‹ˆW_Q=ILJLQPPXF4H=_i[WVWfieP!@5RCNŒџџkFqhFIT^KIU6/20//----/**)''#%&&&%****---P-/*####//-*-*&''%'&4=K`W\^\UF>/--0-/002#Banˆ^ZTPPPQ[fn€neB\;%}ѓЙ^>>@AABTKPUr^6AAABBECCCFHFFIHFHILPTVVVVXWWXHVX^\\[^rBPWkAU^`_amad_^^qQt`^`_}*Pg`)[kdm_adchht=^ao`^^w*PgW-xNsVgggjkhivkkkw[-TcWIyigkmjzj{kgiikjkgrX@Wc=ZnVfgedfp-Pf_=TXXXZaZ0FKQUXXcRLHKJNJLKIKHNTUd[VWUWVXXZVWWjZWXVVVWWiWVUVRQLPKIJIJJKIJVLJHLKKVHJJJIHFCHJIHHH4IIFCEFEHHKJKJKџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџEPPPKLIKKIHHJJKKJHHFHHIFHIFIJIFIEFFCFFIHHHFIFIJIHJPVf\\^\\^^^^^h^^\[[^^\[^[[[^^\[\X`K2==;<=;5I`\h\^gWQ6Zdktxz…P6ZyX=|ƒ‚‡ˆˆ•…‚‚ˆ“–CXg\JB„…‚Žˆ‡‡ˆˆ”‚‚‹‹g;[^X8jƒ€„ƒƒ‚ƒ‹‚ƒ…‚“NBf[V/|Œ€€{|‡x`ƒoПxr_p;\g[HA‚vwwsqstrrqsooqpzCUeZTE`wgghgedghffgfefe^0W[XRE^qcdna`ccc_^^k_a`fR@d[XRT[[Z\[Z\\[[ZWXWWWVfP0Ue[WQQQRQNPPPPNPNLJIKJHF-Thmm\PHFHIHI*ŒПјК‡Ь˜ƒ”Г™p-Ziak^_gVNKHA>><<=;<=;=BFIJP>>[cŒ|`\CLLNL>RRTPQNFCFKQceZUXsk@6[8Zпџ“UyhBWURPQNWH;2///000-*-/))''#%%&&&&)**-*-/-/)#!%!#)*--*)'&'&&&3=W`Z\^[_F>!*-2--/00VW[^IRQN@CIepˆxnPZ^d@‹џ‡ICP*<–ВБЂ’zmXZq{™™ПЃ”–ЮЗŽВЊУЇ‰[R;TZZ_L•ыїЗ˜оХ_#PV[^Lm‹jQU#@>@@AEJNTZjJ3BBBACBQCHFFHHFEIJLKKTcaPLJLPK`NPQPNPTh_iTUn<@VhU=PVVUVdZXZdZ[Z^[Z[ZT4RcW;i^^^`_ca`^_^ja``_k8@Vj;XiQ^_^adfivPweeaaqp;Aag0[^aceUhjgjkivjkj*UcX2{jm\kijmjiZgfgi[jQm/RkW&{geedwyr5=Ui=ThWZZW[)FKQUd[hPP4UJ^LLJLJJJRUUVWXVZWWeWXXWZXWFVUWUWWVWVVRPNKWIJIKJKLIIJLKKVKHJHHI[FHEHIFHIIFCFFHEFFFJIJJIIџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџEPPPLLKKKJIIIIJIKHHIHmFIIFIHJJIFHFFHHHIHFIFIHFFHIHQVZ\X[\^^^\^\^^^^^Z[\Z\[[[^\\^^^X^IA@>;<<8!`XZ\^\\VP@^fo„iyw„6E[gKF‚|Œ‰‰ˆƒƒˆˆ‘‚0W\\6Cš…‡v„…ˆˆ‡ˆxsŠ˜KBmmW8ˆƒ„ƒ‡”ƒqs‚„„n3Jk\I;‹‹}|}z{Šyeyz{wr}‡e6\^W>`zwvvsrvsrtqsqqqyt5ZeZTJsigjigfgfhgdfghqvXAceVAW`aadd`acadc_`k`_^e;Ve\VRX\gZZZ\X\ZWXXXWTUVfAPd\ZTPRRPPPPQPQPPNLJJLKEF=h`voUL6FHHIIF!'ЙЧЬйРхŽ‰АР4C^`c`Nq_WLIJFCA=>==<<;8>>CIJ@X`ˆ_[Q8KNLQQfXZWTRP85ELTcdW^NC'PIU™џйUXzP=PQPPPPNLIA3/0000//-**)*)&&'##&&')****-/0-*%#!#^!*/-*))'&&%%&2;[gZ\h[UI@0/0/00/00*jaZVBQ^PCXfˆ‚‚Œtd\Pc{R/*—оpE^C!wВЉ™zoeUoz‹˜ОЃ”ЉЖМЊДЗЉ}j`4F[[_>ЙіъИфn'PV[_dmЈePI'уWd[g0sŠРТМЊЯХЩКЧТОЙИЉ‚pƒ­U%TZqFE ВˆinsN/>=@@@A>@A@AUJQXig3ACCPECFFFEFEFIJHKKXJPVtPJNPPNPNNPQPPPP@TWTRg@Rmp=PUVTVXXZW[XZZ\\[\fj0Pck#X[AH^aaa_N^^[^j_^^V5QhWaVVWcR3EJN`VXZTP4IHKPLKKKKKQVcXUWWWZWZ[XWWZWVXXXUUWWXXUUUQKKJIIILKLKKWHIJFHEFFH[JHFFIIIIEIHFHHFIFFIHFHHIJJ‹џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџCPPPKLJKKKIIFJHIIHHFHFIHIFIHEFIFRCEFFHHFHFIIHFEHHIPXZ^\\[^^^\\\[^\\\[Z[ZZ[^__^^\^\ZRHA>=;;;6/ddZZ^\ZTPAoi{yw|f'Tk[AV‡…qˆ‰…w€‚ˆˆ™p#Z^Z6oœ…ˆ‡‚‚‡‡ŠŠ‘„‰’2Z^\ALˆ˜„ƒ…‡„€‚“‚€Œ{#[^Z@T–ˆ}{|z|zwyvzxwwˆ_A[\W==;;;;>@48W`ƒ_ZPJIJPQUUV^n\[Za^I5EKPcs;#5VPdЬџ=hL5<@@A@A>AFJKVjkL4CACEFECHFFFFHJJJJKJLVm`=KNPPLPPPPPPQRTURTTUPPWhQPfUWWUWXXWXZZ\[\[\XP@VqFUd\\\`^^^[^fHdg^__w-TXa*ew`p`cgffgfgqqvd`Bs*Taa8^sdfxghhhesi{mj^;Vd=Jzn^jiimmjkjmhvhkitJEVg*mtgadrhmW5TpR5ikWZc^I0HK_UdWT[FFUJKNLJJKLPWWWZWVZVTVXdUVXVVWUWWWTVWTVVVPPJJIKLJXKILKHFIHJFTHIFIHCEFII[IFHIIIIFIFHFFFIJKL•џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§HPPNPZLJLJKJJIJIIIIHHFCFHEHHFEFECFIFEFHHIIHFFFFFHJRV\^^^Z^\\^\\h\\^^\^^^^\^^^\\^^\cPC>>>=<;6Cde\Z\gZTPF_iry‰xˆn/XkX>fŽ‹„ˆˆˆ‡ƒ‚ƒ’’›\8efX0Ž›ˆˆ‡ƒ…’“‰ˆƒ„ƒ/^^Z4i”™ˆ…ƒƒ„‚‚“…€™h3f^W6j‘||z||zjviˆxwv€sv><8;;;)8`^ˆaeN4II\TRUUX\aQP^\XdI0BB3IF3L[RqьзN#;/2FIJJK20-/2/00%`WhCPPTHPjx‡ЃЂŒsRQ`ZpЂЇn-/ˆ–WF^<&…œƒVage…Ё™ ВЅЧЁЖЛ“ЇЂЃ‡vmŒe/X\\_C4џW&QWZ[`h€eJ>4лзРђлXZ^NLЇЉКзТЫЙлЧЙТнСЂ ‚’„’mE[^_*zЂV&A>>@A>>@AABA@@IJQVme8CBCFFCHFFHFFHJIJIIXKRXj@IKLPNNPNNPRQQTRRRRVR=TXV4eWUWTUWXXZX\[[\[[dR@Tic*i^h^\\i_^ngKNc^^_x;PVgAVo^codefegdVfedpZq3PV`#|`TcdeNgggegkiws_0Uih„wko}nkjinnmhkhwmg_BWhB=}aafhhs[5BpU)hTRVX_L0HNRVZZWPJ2IKKKJJIKJQVVXdXVdVWTXXVViZXWVUThWXUFXVVQaKIJLKNKKWJIIKKJIIHCFJIECFCEFFIHFHIHIFUIHEIJJJJJŒџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџјCPPQPKKKLJJJHFHIIJHIHFFEHIHHHEEEHHIECEIHFFFFFHFFHLRZ\^[\[\[[\\^^^^\^[^\^^\\^_^^\[[WPB@<==><4JV\\^^\WQAXai‚‹Œy}^8ZfX5m„‹„‰™y„‚‡…ˆЁ™AHfZF6™–‡„„ˆˆ‰ˆv„‚šg;f\Z;cZUEZrgdddcccaa``_a__hX5cfZTRZ\ZX\^Z\[ZXZVXWXXVe>Ve\WQRQRPPPRQQQPPNPNNLNK2U^kpXNIJIFIHHJHHH3ŠЩђїџI/`ezVR‚zjaWPLKNN\PLJE@=886;0Tg`€cZP8EJNRURUXX^a›`^n[Zg8!%#4RRP §š;*!BP@CRFF[KKL`LJF@4///C---*-)&'%#%##%#)&/%#&)-CHIJ^g_`d\eeeam`^XWKJF3!#2JIB>2/00020&p[XQPPVRjzƒ‰Ј‡ЄЃ„wZ__dp}ЅВЉLJЙ€H`Pe[^'^жЗЭПЯИХЮУУРЙЙšŒ…k|Љ==X[mC`ЄL>A=@AA@>>A@ABB@CVNRXq>CCCFEFHEEHFEHIKIJKN=PVcT=LNPP[PNNNPPRTT_TTWeQWf5R_QTUUP)FNQVXXWRL)TJLNKLKKLPfXHVWUcWUWXVWVWVTaUUWWVXW[ZVWPQKJIJJJJIJJKJJJIIUEFFFFEFECFCEEHFEFEEIFIFHFIKJIJŒџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџјEPL[LKIHJIHIIHFFIIHIFHHHIIHBEEFHHFHFCEFIHHFFFETHINTX^^\\[^Z\^\\[^_^^_^^^^\^^_^^\[[`KB=<<<<;F`aZ^^h\UP=Z_^txz„|BBdfJC|…ˆˆtwˆŠ‰—2XfZHF˜ƒp…—“ˆˆ‡‚€‚ˆCKf[F@…„ƒ‡‡ƒ€€ƒƒŒˆt5Xg[EF‹||}zzz{xzƒywvs…_2f^W@`PIsvwywxxtxtwwqw`5\\VC^ykjhkjghhiifggepihfZTQTQQPPPQPQPPQPPPLLNI<68AQ[r‡^XK5EJLQPUaXWXiPe|N^^ZhfE*3VRgЦчo6-;4/<>=CBBE0HJJKZLFB60/---*--*'&&&%%%&&%@EIN^`kefg^^`^__^^^_^^^_^ngeijf_RP@-#420003P|^TQPH`z|ƒ ”—Ј™Ќ ‘qdQKnz‰ЋЙБn4z“a^\5Lq`da}ŒЄŽЊЂЏ•›ЊЈЄ—xhrwzБrA[^^V&8Pc^QarxaXE'BЬђејЖГЮўmWVf^ŸГДХЩвЃиКлЫЙЈ™ˆvfz ˆ!TXfZ)s#/<@>>A>A@@A@@AAACIIQXv^HFQEFHFHHHHIJJIJJKNc=Qcj=JLNKKNPQP^TQTTRUVzU@QUhTCWXVXXXZ[[\\[\\[^^iB@VkTRe^^^^^\\nih^i\q*Pai)d^^j^`daofeeJcrHqsc2PfT;`ddchgeehttgiiwƒ3Cik&_vnpmmnonnkkmxjms^PQRT`Tm2BIPUZWWRN5IINLLKJLN>RWZXXVVVXXWUcWVXTURVUWTTi[ZXWTQ;<<<8#)Pd[[^gWR@P[fo„y‡pq4Ee\HJŒƒ˜ˆ€ƒˆŠ””{-Zg[;j“ˆ‡ˆˆ‹‰ˆ’‡‡‚Ž‹&X[Z@T‘”ƒ„……‚‚tƒƒ…H0Z\Z=d‹…{}|zˆyzyyzyxv}0V\\U@ˆ’ƒwwyzwyvwsstrzJV\[U@wtjjijkijhihigigt^0WXcRIjpeddecaca_``__a^eAU[[VEd^i^[[XZ\\Z[g\XWUU^=UdXVQTTRQQRPRRPQPPQPKLLJ6Tm_^ULIIIJIUIHFIHFFFAЉЪо/d|Epœrth`XRQTaWXZZVRJC=;0Ldjs_XL0BCJP^URVX[^x^`at^[Xef^2;XXxЫМH;yUNLE@<@PCEFCEFFKNNIC>3/--)****)''&&!=EKTdP`Lcgqq€v‡x‹‚r|zz|‰}ƒ‡dmcc`a`^h\XQK50&!z{oABTNmzˆЃ™šŸЏБ™w™‰Rca^xЁ ”Ъ™F{‰`\m@F\n^Š”ŸšЂПЗУЉ–Ш™ЯВv}exe‘ЪqW\[mU=LIUЯЈ|[I&'РбтЬлеКЧъм#WZ^F*СЛЊПРзЭЙиаУМ–„Uqty‡ЃL8TWvU0/>>>>=>@A@@A>>AAABFILRXj8EACFFHHIHFHIJIJKJJ_=>=;4@ai\\\ZWQNTifrxƒ€pv2Vj[Bdˆs…ˆˆ€…—Œ›^5f^Z8€’‡“’‡ŠŒ‰ˆˆ……‡p!Z\X6[™ƒ…‚„ƒƒ„„ƒ…Ž‚‚‘^=Z[U3z‰}zzzz}LqxsvzzyŠ{4ZmZ>Nyyxy{zyxxttpf3Zh\HIvjmghmmiijigghjiwKFdeUFgrcpccccdc_^__aa`hW5ceZRR[[h^^[[Z\\\\^^XZZVP2g[WRRTUVUQRRQQPQPNPNNLL;>c^nVPIF4HHHHHHFHHFEE2nГJ%dinPVВг{tj`XRTXf\\\^\V^KB-Kg^z_VL-@BCJLRVZZXZ[^`___^[\ZU<=[Rzеš20^\WWhcJA)PVEEABECHLLJQ@52///----*#&CLRZHNPoЏЋГŒ‰t‚`oh^\[d[iZXXZefhnnr‚Ž‚xhrqd^XPH-0—ŽhLgv–ЂšСЩЉЁЬе‰ЮЉ€`sy“œиj2ae[mQ>FmРГnR@PЏжЧЗбПщеЗвзО4ZZi*WфУЬИУ­УУЮРЂ‘|q_ow{˜ˆBUXhK2>@>>>>>AAA@@@AB@ACHZPVrT4FBFHFIEIIHKIJJIIKNJLQdgg\R=UoRE[_^^`_a_nnNaasaToq8Afg8npgdchefgshvjkp…p#TmX‡}}j|njnnzzkim|jgw[@TdWFx`^Laa^V4RhV'eTQRV\I3HNU[\ZU[HCIJLNKKIJNQTXWWdVWXWZZXWUVUVVUVUcWVWXWTTPNJKJHIIHJHIFFIJIJIFHFHFFHIIHHHIHIHBFHFIHIFHKKINџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџіCQPNNNKKJKJIJJHIJIIJIFEEEFHFFEHHHHIHEIFIHHTEHCEFJTX\^^\^_^^^\^\\^^_^^__^^__\[\\\[Z^F@><=<84FTX\\ZZWR=V`j|ywx^0W\Z;hwŽ‚‡‡‡‚‚…ˆŠ’ЂF>ggW5ˆ™’‰ˆ…‰–‰z…„ƒ„Ђ\3d[X0p—‚€‚ƒŒ€Œ…„“6UeeH/|‚|{z{y^wrUwz‚{cB\mZ2f„yv\‚zz„yxhtvvƒ€`BJNQUeZffZZ^_^Ig[hR>EP^д€45[jjZVXiVN4#ACCBBBAIKNJF>F0/-/--/-CNX@2KhЁИЪЅoiU^ZWRQNKJHFEEIEHFCCHIJL^TW[^a{„ˆЁ”–kg_[T>>@>NA@>@@>ABCCEFJPUep8FFFEFHIJJJIJIJIIJKXKPghPPPPPLNQQQQQTRTRVVR_@@UiUAcZXXWXZ[[[\\XXfZXcP=WmFEe\\h^_\\m\__^^^^\a5PWU/ii_`P^`^_a^K^andesV5TaFXshhfdgsgghiijnns-QXh&tomnUnjnnqqohjijiw\)Tdco_\\`_\VPPahXPkstwsjL/Xk[B{zŽ‡…„vtˆˆ˜*Jg\=E‹ˆ‰z„…}Žˆ‡ƒ€• 6@e[IF™‚r€sƒ‚‚ƒ€zjV\eUHˆŠzy{zxaqt€‚yzzyH@k^W3zŒzzvyz{zzyw€wvvBEf\V;=>CIKQaXW[\WV\^^KeW_*F^VšУvQ->op\IX[ngLE0CFFCECFHVKH>;20-03!EAJ26H™ўџхКpWH\WTPJEB'&!'!!#!!>B65LC8=@Qf‚ЙЇ „pZVIJ/6WzЃЁ…ЂГ­ЂЁ …РŸƒ‚shWfoˆ“И ЛœЦВ0'cz^\Z6L‡–…ЂЗЈГАГАУ•РБi{Vz•Уg6PkZfeFoo<8/;‰ЈТœЗСЦиймМ“лЮЋ0VW^=)бвЯзЮБКЧК‘„€[jmn‡nn5PVZjLA=L>>=@A@@@@BA@>CACKKTZiR8FFFHHHIKIIHJJJIJKKKNTXV4PPPLPPQQRQeTTzUUVV^4Uic5aVWZV[Z^\[WZ\X[[gX_0ThW5d^[N^^{\AK[^^_^^^q5Qaf/d^_ak``j``^^`Pc`ecd5RWV4kxiwReijiZjmjmx}4BWm%t‚zymoopqpnyjhhik‚r;TZp*jo^\\^^WPAf`2PcPQUcX4HKTdWXUPJ&EKNNNKIKLPTRVdXWZXUXZZWWUUUUTWVVZZZXTU`PPKIIIJKJHIIKJJJFFCCEEEFEEHBCCHRBFFFFEHIIFHIIIIHџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџїCQLKLLJKIJJKJIHIHIFHIJUHEEFEEEFEBFFEFEFFFFFHHFHFLT[^^^^^^^\[[[[\\\^^^^^^\\[_^Z[[ZVJA=<=<<8_W[_p^[TQ8eawqvƒqFAd\WE|€‡‡‡‚‚‡—˜•}&Z\Z4hŸ™Šˆˆ‹–Ž‹Š–…€r”Ÿ3X[jFC‚|{€‚€sŠ}h)dgX@K€‚wzz{ˆz‰wCƒ|y‰3W[eC0€‚xƒzzz{{zƒxtsw„‚4X\ZCKtzkjjjmihhhiijvisJTe[R8iZ;nveecaRaa`a^^^^V;hjXQR[^^^^[\\[\\XZZXX[`=Ah[WQRURRTQPPQPQPNNPNPPL0T\pdQNJIHHFHHFFHIIIHHEEC2P\e‡B^џџЯ› xZ^^_cdgsie_^j2Q[\_Z^0&;I<<@CHPUXVXXXXVXZehR)TQnЈБrw65EKRe\gXWkfha5-FRRCCBEFHEB;42#3JUB#PЄџџџ fB@WQJC0%-'&%%&!)0---'%%%##&3=>'8=PRPP8;ERvЈЯЙ^NWP6&X‘šХХЄЖЄ ŸЗО”…{meWonˆxЌŸ“ЁЂХЂUL^^\AI—ЄŸЄЈ”аЄООЈЯАr{c e%4J)RW[\W=Q4/P‰ГИВЦМТваїзЖОзЯ}/HcZ_wлаПЦЙЧЉ„z}dgdevnjQKRWig6>><@=>>>>AAAA@AAABJJLT[r2HHFHHHIHJJIKJHIJKKNKQcs5NPPPPL-PRPUTUViVVVU=RXhATcWZ[[X\[Z\Z[[\\^^W2PWh*Zh^__^^iX[^\`a`^^ZBATpQTk^__`^4^h_amaddckj3PWg3jhghNfhjijkjkiz\5VŽJAinnmopookmivfjkhfk=CZk0Zh[W\\[ZRPTfPPfAQQQX4CLRWXZVQV%QJN_KNKJL>RTRWWXXUVVVX[VVTTThiWZWdHccT`UPIHJIHJKKJHJKJE4THITFHFEFCBBRFCBECFHEEEHFEIJJLKŒџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџї!CPNNLLKJJIJIKJIHHHIHHIIFFEFFHFHFCEFCCFFEHHFEFFHINU[^^\[\^^[\\\\[[[\\^^^\[^^^^[\[[UJ@><<<<6-cV\^`\ZVPR^eyrvtny4Re\JJ‹{ˆx€v‚ˆ‰‰Ѕo*[gZ8qˆ”ˆˆ‹‰‹…–Œ‘œ‹!Z\X6g˜‚‚“€{{|Žc5fgW6sƒ‚wzzmŠzj‚z|‡zy|c)W\Z;_“ƒzxzz“{yzyxxwszd*j\d>^wgjjjmnmhgkiihgrp>VedQAop_dfeeadd`m_``a_fERX[VQV[^_^\\Z\[[[\\XXZcT4UeeUBQUUTTRQQQQPPLPPPP‚2Lp\[VNJJHHFHHFIIIIIHFFFCC/W`hkцџџѕ–“`H_edVgjƒie_;@e_i[eF*658;=>@CJTgXVZXkTWTVU3F_j™ЃdqR/BFKQXt\WW\gkP5-BFHC@ACFEA='4AE#eџџџЗP)>ULA&3220/-*%!&%&!)/-*)''%##!%28CJNReTPJE%FLA8QsГфОi@TH4!X”УЧ АВ •ЁЈ•špfV^kЈ“ЅА›ЁЂБЊЊОeEx_\g;NЄЏРŽЇЧЁЏœ’™Г{{cyI)JLop8Ri[nU=-Bs’Ќ„ВЮЉУЏК№ЪУЏоЮz\&VXfPиЭЛЧВЙŸ‚ynd``ocf‚V*IKUZqK->==@>>A>@@BBA@AAAEVKTWzPFIHHJIJHHIKKIIJLKNP6PWqQ>PPQPQNPQT_TRFXVWUfPNUrV8aX[[ZXZ[\g^\^^h\^iPPWkUdg^\^_\o_\^___^`^\`=RgR4m[\^jn\[I@_da`c`a\APUj2^wzhgyih[t[kji[hz*TZW&…ppnjnnnpojjgihgfkZCXiTT\\WZZgjTAUh_5\PQPPN4BHPVeZZUL-2IPLJJKJNLRTUXVXWXZWXnWXWjVTVWVWXWCcWTVUPKHIIVJIKIEIHIHHEIHFFCIIEFFH4FCFFFEIHFFEIIIKLLJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџѕFPPPKLKKIJIHIIIIIJIHHHCFFFFFEHFHFCCHFFFFEFEFFHHKQVZ^^^[\^\[^\[\Z[[[^^\\^^^^[[[\\Z^H@=>P<;8AaX\^^\WR@Q_irsrxz3V\[Acv€…‡ˆƒ‚ƒ„‰‰‹œK5^^X=™Šˆˆ‰—ŽŒˆ‘`#ˆЃj!e\W5}ƒ„‚€ˆ{€‰zz{…>EkfV<Žxzz{|f}{yz{}}|x}`3i\W5hvz|{{ˆ|{zzwiyse‡Q4o^V@IPTWUWZTTRQP=T_i˜ŸnpV-A=>BFJPX[[XX[ghPF-CXEB@ACB0&4;4KУџџъz=ZJ#'*-*-**--))&%##%%-**''%!!##08BZ_WWUKFA4#/;@'UЩџп…EBI&FЛ֘У Аœƒ­”gPdfaЃЇŸЂšЁЙЃЁЙВe*JmXZ^<8ЉЦВЃЈ­П­ЈЇВ‰‹‰I4P`[L„%CVXXmEHЃš‚ƒЄ—ШЧПмЙтимЌЙВЄ‘”8;TZ\;HѕЬЂ™ЄДz}tha^_N\ng!3HI^Xee3==@>>AAA@@@AABBACCIKQWiU5EHHHHVKJIKJJKJJKLPP=Rhf4PPPRRRRRQRUUVWWVVWQ@TdX4`[ZZ[X[[\[^[Z^[\XjU5RdX8i\\i^^^_^_`k^^^_[g)Rge'g\=h\Z\_i_`d_^^_`oX>ThCXvjmXzihthghzggsq*Qic%|o‚U^}nomm\jfgeqdZ5RiX0r\ZZZfXUARdi'dPNPPLFAHPVe\XVP3-UNJJKLJLNTTUXXVXZZZf[VWUUUTUWVUXiXXUXWTPZKHIKHKJIFIIJIIFHHHHFTFCRFHIIFFIICFFBEFEFHKJIJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџіENNNKKKJKIIIIIIIIHIJIFEFEHHFHHFTFHHCEHFFFCCEFFFIRXf\^^^^^^^^\[[\ZZ[^i_\_^^^[[[\\jRE@=<=<<6EcX[\^\VQNTPhq|pni^8c\ZBh‰……‡…„‚ˆ‰•˜ЂHNh\H8”ˆ‰ŠŠ——‹‹ˆ™[xЇV>e\V-ƒ–„€}zz‹p}{zzyˆˆ*Vfe;>ŽˆxzŒ}ˆ}|}„w„KEffW5z…„zzz||zzzyz‡x‚„5Vg\UA{jknmjhnxmjjhizjvE;cZW@Vi[afdddcc`_PPaasV;k[XCTf\^^[\\\\\ZXZ\[Xd_4TdXWPRjUTTTTQTQPPPPNNLL;8;;88;8<;BHLTjtLA=@@A@ABB@AABBBECBHLKPXsKFFHHJIIJJJKJKJJLPPPJPXk>LPPRRQRT_QTRUWVUUWe<;><;4JVZ\\\ZVP=c_jorrkqZBd\V@jzŠvŽƒ…‚…‘‰Š—)\h\>L“…ˆŠŒ•|ˆˆŽ“j™–>W\[H;‰–zPzˆ}ˆ{|{xs*ZfZ=<;;86888>CVNPPPNKK2R^j•oxCFA@;688>BFIPcfZWX^nj^C-=@A0;;6VчџџД48`P!#&!!!!#!&'''***-'*3%#%&&'*''%#!!!!#/;JTW\fWPE@2/2ˆ— }s4єџnZ\^'eДМЙЖОГХЈОJ;Qa\^LxжО8PWX\I6–œЈВЂОагЦЯЙхОА‰ЄŠ—X&UZ^H5ПУБ›•‰xiRZV@ek3>;>>EHPXjU3@@A@@@@BBACA@BCECEJJPadT5FIHFIJKLJJJKKLKNPPJLUtTLPQTTRTRTUTTTTWVWWUP==<<8!&`X\^^\dTN6jcw{s{xt@<;I888=@AH^KJIF/P^h‰i|86A=<685!46AF=6еџџ—-F`0-)%&#!!!%&')-P-*)*3%&'&#)*'&%#!#!#2===@FLTXzK2ABA@A@BBAAA@/ACFFFLLTdr=FJJIIJKLJKJXKKNNNPZLRcg2NPRQRUTUTUUVUWWUTW^4Rdh;aZX[\[\[^[[\^^`_^gV6TiWHo^^_`_P\^^\^^\\`^g2PWV;r\\^__iL[[^@j`a`anV>Wh=\thffXhVZhzhjhjpp6W[W!ƒrt€mkknjfhxepcd\VRWcRP`VaVRUTTPWp@I^LLIJH2EKPRXUUPV&FIIKLKILK\TTVXWcUUXWUUWVcVQUc[XVRTRcdWUTPJIFHIJKKLIHHIHHHEHHIFFFFFJIFFIHFEIFFHFTHFKJKJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъBNPNKLJHFEHHJFIHIIFEFHFFHETHFFECFFFIEFFHFFFHIFJPWq|`i_[^i^\\\^\\\^___^\\^^^\\[[X_;B><><Re[EEŠŒap‚‚vƒˆŠ—o0\^\3|Ѕˆ‡‹Œ™pz‰‡ˆ‡œƒŽ|#e^[Aao{n}}{|}„‹PCZ[T/‚‡}|{}}}€}}yyt‡a0d\V2fƒƒy}{}{ywvxv‚AIjeT53[СЋтхЛОŒŽЋЏ{‚z•;If_nXVKFBHHHFB>=<658=ACFFFE6N\g‚’hh4C@<<;856345>@E8Qdv^\[keE-VEAВџџПPc`#2///P'##!#&'')*'))*)%&&2!%'&&&##!!!2;K_X^[eTH>0-/zЖ‘ТО Ј„‚cP0ƒщс|EX6QЈХ ˆz^c`ha‰МˆТЄЄЄЗŸš–’’{ncVBm[[\*jЈЪЅРУМZ3Qq\QV\Ћœ`aF'-UVZ\0Ј€ЦЧЦОЧРУЦмЗЫЏ{‰–RVf^ВЖ™|€cULK\C>>=>;>>EKQXs^)@A@AA@ABA@CBBCBFFIKIPVmP8FIЇIFJNLJJKKNNNPPP=NWkQLPRRRURTUTVUWWWVWXh0PWkERZ[ZZZ\^Z\\[_^_j^_q*T[r2e_^j`^__^^__^^^__k)P`_'X^\^^_i\nVZha^>;6A^X\^[fXR@R^ekopngp8VkjFQ‰…z}€€’Ž‡ˆ‘R4\nX)…›‰|Œˆˆ‘‰ˆ…Œyg6j[X@is|Œ{|Œ|z}{zzˆ0U[[HC‡Œ{{|{m}}|yz‚ŠF@j\V4‚€xyz}{…zxwxwvsr6W\jBBwopommmjimmjxkkj<==<<@@ILWZpKB@@A@@@CB@BBCBBEEEHJLWsW8H;I8HIKLJKKLNLLNPPK=TmV0PRRRRTUUTVRTVXXVW`P@UZVEc[[[^^[\[^^\__\^^j4Qdm=W^^_^Pp^`o^^\[n[^i=@ff-Wf^I^^^^o=r_s^^_`r*RcV;pesZ{hfhhvik\kzvERZX/siokoo^nmXjhKQamPmh8U\ia`VRQPPPaNQhe6IFE3XEAAHPTcXWRW3AZKJNLILJKPRURTWVXXTWWXVTRRUTUhVirVUWVVUPLIHHHHIJHJJHHJHEFJIHFIIIHEHHHCEHFH6EFFHKHIKJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџьBPPNKKKHIHHHIJIFHIJHFHFFFBBFHHFHHEFFFFIHHEFFHHKTX[[^^\^^^\[\^[\^[\^`k_`^^^Z[[[XWQF>=<<<<4Fm[[^^[VPLT\gnnir_8WfX=d}€€s‚…ˆˆˆ˜;H^gH5Ђ‘ŠŠŽŽ•{…‡…‡…Ž‚H=e\U;Ž™{n}|m|{{{Š…!XfZ@R…{z}€|zyŒ’3Z\eUC”€y{zzwxxwttt)Z\Z=^ƒpnonkmjijkmkkmiy&ckX;Vkdcefgfedggfedaacf*ajWCAfj_^_^^^\\^Z[[Z[\X>RciUQUWVUUTTTRRRPPPLNLW8Ph\XQNJJJKJJIIIJIJHFFIFF-U^pt^0/PЗЄЃКхОИ™}8P_yˆQ)ˆџwTdT#UœP`Rn {ЏЂОЄЁЂЂ›ЂЄqnedq=Cd[[[дР^2RcZ\BpЂƒX64JЯќе*TXg@QЏ™зЮЮЋЦОРЉОъЈ‹™n‚Ћ“RVe^0˜ˆpaRJIE>=@=<AAA@ABA@AAABCEEFEJKV[zAJIIFIKJJJLLLNLNPPQP8Rda5PPQRQQVQRRVWUWXVXUT>;<;F!I`Z^^^ZUP>T_hn}khp^-d\W6z‡ƒ€}ƒˆ‰“Ÿ3X^g@IЂ˜‹‹›‰‰ˆ…ƒ‹z‰CV\ZH<…z|ˆ|z|ˆ}{|‰h3Z\W6i–|zz‰€‚‚Š€z{|‘…0Z\[0Qˆ_a‡ˆ}Œ{zvvwsv…|P>i\W=_zpnomzpmmmmnmmmx^%cfX;ZweeqeeefffedcdccsXecs`U;EEEBE)/ОЭмјяыгŸЏЯЈ6Ag^^ZfVQLL^`WXXiNJB=844466-FV`trmK#;;6664552303258=B>@0&3a0›В‹…РёХяМri_`g„š‹@>ЄЏ^e_E8}‰d_ak|Ќ”‹ЂЏЏ’ РŸЈЌ^Ue€8EZX^P4ЉU)PW\^P^ЌŠhK=<Къмд“VW[`%ŠМЩжПВХšЧОЏнЇ„„}o|ЈURWfFJКm[@IC>===>==><>@CIRZ^p6FAAA>BBB@@BBBCEFFFIKPXe_NLXKIJLPPg`=HFCAACA/FNRaXVVPHBIKKKJHHLN_aW[ZVWFWcWUVTTUTTVTVWXXWWdUUPKKIJKHFHHIHHEFCHIIFTHEFCIIFFFFaCCHFTJFCHIHHJJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџьENPNKKLKJFEEEHJJHFHFHTFFIFFFHEFFIHHFEFHIEEFHFEJRX[[[[_^^^[^\ZX^\\[Z[\^^^\[\[\\\WPC><<<<84%_W\^_^[UPj\XPNNNKKNNLJJKIIF[HHHH5Vidk[>EFFEEEFЏО§џотлЖЯ\^qX[vVR>PRUZ[XXjPHP>;555;/^_g|zf#);886864442202245;>P@))!8WBWЏџЅ84%53/--*--)***'%!##!!!%'&''')*)&%''#!&'%#'0;JTX^^\TI>-А–“УџвБОРhL_QewЉУЃ3n­„U_L<^k^chzЖ”™Џ–КЁ…О Јoggj…*;[\\^H#Jef^`t  P@2&JЧсЮШЦЫZVZ^IœЊїДЮЙМЧсКО €ƒnyvz“Ђ#8TZ\2”‰eUJF>=<<>>=AA==@@FJ`fjQ2ABBBBABBCBBAAEEFEHJKVZf3HIJJIKJKLNLNNNLPPPJ=TkTNPPRRRTRaTVWXVXZXX`=PWrTEVX[[^^^__^[\\[\_[hBQZm2Zi^^_`k^[[^_i^^_^q&QWg3Pe\[^kckj[J^aaccsZ@UcT[`tdggffgez^nwkzo*TeX2ampmotihhfQ^^\\eX_@XsT=KHHFII5h5``KFCB>ABA>FLRXXXUQRBJLK8JJIJPRUWZXVXWVFVcWVUQTURTTWWWVnXWTTNKHIVJIVHFJHTFFFHFHHECBHEIFCFFFEBHEHIIFFIJIIJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъRP`LKKJJKJJUIHJIIFFFHEFIFHFFFHHHHFFREEFFFFFFHHLU[\\Z^^[[^\[\\Z[^\Z\[^^\i\\\^[\ZVKA>>>;;8-^W^kc^ZUPPW`imkddyEBn^WH|‚{}|{€ˆŠˆp*[^\8p ‰ˆ‰ZEƒ‰‰‡‚|ˆy*ZfXC'T{€Š|n{‡zz‹E>eZI3‹ˆ€‚‚}azIF[fV@zˆy{ˆ|zyxwtsrqpy)W\dEIoopzoommmoonjjht3VedREkfgfTggffcdedddcak6V[[UH^_k_\^_^\^[^^^^Z[X6RdeUCVVWTVUURTPPPNPPPPN0RZ[WPLNNLLLJKJKKJIIIFFHE;jarhQ8EEFEEEC5[ЪяѕіосОЦB\^\H[pZRPRV[o`^[eRKI@;638-P[efx6!6;66654446300/024;=UP'6ZIfџіe&6=3@83//--=*))'))))%&%')'))*&'#''!'/'&##08UTX\_^VJAmМЂœТјџѓзЏxaT^RX–™ЁДВV=Љze`^>H\_Xe›™ЏЂ‰Љ”Џ’Ђ€q\[ow!ImZeV/CIX_PPyzeK<*RЩгЮХЬОсД8WXq>JЧЩЧОККМвДЋ›Œspez}Ђi&TZfJHwZQJ@==>><<>@@>A@>BIQWko5CBBBAAABBABBACEFEFIJRXqPHHIKJLJXILL[NNPPPPZ6Rcg5PPTQRQVUVTVZXW[XZXQCj^[^``^\ieFnaca_`j4UhV8^defhyUq8txnj\jq2U[h'}o_}hfLepc\[XVcaTe@Ve`@>A=BLRV[ZWPZCIIKJJHINPUTUVVZ[icUWWWVVVURTVWTUUeZZXVePKHHIKIKIFHTFHIgICFFEFFEFFFHFBFFXFIFFEHHHJHHJ‹џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџшEPPLLKJJJIJJHHHHHHFIJHFEFFFIEHFFHFEFECHFFEEFFIPVZ[^^^\[[Š^Z^[[\h[Z\[\h^^^\^^h\X^HA>>=;<6@\X^nr^ZTPPX`qtseap6Rf^KRy{|zjz‚‡™ˆšj8\gW#‡™“‹Ё’ŒŽˆ–„‚’‚}”d2Z\WRAˆ|r€}{z{zƒ%W[ZIP”Œ€‚€Œ‚}{||’4VfZCB|xx{{{zzxxvƒsqrm&cfW2\„np`ommnmjmmkjvq^2X[dFX{gegffhgfecdfdd`pZ;c\cAUq^__^_^_^^\\^^[\[a6f[ZTRWZXVUUTUQPRPNPQPPL;feZTPPLNNLKKKKKKJHIIHHH4RhcjWJCCFECEBB@-[щђѓіџњh\_qZ\^[VRTX[\_sz`fTPHB;66-Lmczo\P!;<86653455J40//2325;AB4N[U“џП=3RPLJB'2/-/00/***)*)&%''*-*'))'''&#%'''!#)6XcZ\_^`INВМЈ•эч“џьz{sT^ap€œ’ЂД­3Pšmc`X>\cp‚Ž•Ћœ›ГŸ  Ђ™x\ZˆhИoUTWk^5=Hx ‰c^2'QОШИЯЮбжиоaEW[^™ЙєЙЊЄЙЩЇЗ–yjo\pvzŽ˜-;U[f4dVNA><<==>=<>>>=>>BINR[rN0BBBBBCCECCACQEEFEHJPWsU6IIJKKLJKNNNNNN\PPP=LWkPPQRTQRUURUW[eZ[XXZ_ALThZVWPI*A\ILKJJILNTWXXUZWVVVWVWZWWRVWXVTVUWZZZVUPJH[IIFHHHECFECHFHEIEHEEFF4IHHFCEFCIECEHIIIJKŒџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъRQPNJJJFIIHHFFIJJIIIHIEFCFFHHFEEEFCFFFHFCHFFFIPaX[^\^^Z[\\[gZg\\^[[^[^^^^\^^\[XRE@=>>=85CxX^w`[WR@PW`degd^n/Um[=cˆz{zwiyŠ“„ˆLB\^X3—‰ˆ–tšˆ‡„‚€Š’U;ekX@€h‚Ž—€‰}n{z’‡)[g[0QдЉйЈЯУдРЦИ—N-RVmFПХЭИДЫЧЙЌi`ik€x||™jRXoWQd4-=<<<<=><==>>>>@FIPWnU6CEBCBBCCECCEFEEFFFIFJRadH==;;<@NAKTVVUVR\0'QIK^JWJLNUVXWFccTVVUXXZWTQRcdVXWUXZZXU_PLFJIEIHHEFHFECCIFEB^IHCECJJJIHECFEHEFHFIIIJJŒџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџыBPLNKKKIFHHIFFHIHIIHIHHEEEFHIIFFHIHEFHFHFHFHFIRWZ^h\[\\\[g^[[\^^\[[^^^\^_^\^[\W\E><=><;4H_Z^ra^XP@RZjddt``Z/cmfBcƒy‚zzx|€“‡ 3WggLFšˆr˜mH“…w„‰{“>>[fVBŽ|}}Ž{||}‰i-Z^[)dƒ|€‰™!Z\X>`pxx‚zz‚trpppnnzBFZeW=p}poononpm^mmwhsr>EZXTCjffggffeffpdeedacy<<=;=<><<<>>>@@>BINUep83ACBBCBCFCEEFFCFH5JIRXvBILJLKNNNLZKNLPPPPPP8RXj2QRVVWUWUWWWV[X[[XVAPUiU[^_^^^^^j^^^_j^_^iZ2Pqk5gZ^\`__^_a```a^_rn4Qca5i[[\^^^^`\^Ekcc`^hTCXc/WrfZjjVzjfvjynmzL/VoW5nmjea`h[VRNKIIKI[4dhKCA=;;>=@KQWnH=<;56<=AJPUVVWTX@EVKLJLJKP^TWWVWUUcFVUcXXVUVUVVVUUW[XUV_PNFJHHIHFFHFITHFHFBCEHHIHHJKFFIHFHdJEHHEIJIKHџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџъFPLNLKJIIFIFFHIFFIJFEERFFFHFHJEFFHIIFIFIICCCEI^X\^^^^\^[Z\\\[\^^^\^^^^\\\_\\\[V[F>=;<<82U`X\ca\WRNTX_dcc^nX5Xg[@g€r^yz„‡rƒƒƒ‘;W\\@Pšˆ—z•…‡—ƒ‚ƒŽ{‡%Wf\@H‘|€‹€{m‰|z”}–ds…|{c||}}‰–X5i[X4twxwvywwt|pnTIzs0V[[VA{zpzoopkmxmxmhgfp2WedEEkggfgeeeecafeddc`[*XeWQFhmc`^^^^\^[^i^^^fW>V[WRBVWWWVUVRTQQRPPQPPJ;feVQLNPPPNLKIJJJKKKJIHE0Xkr\QHEEAEBCABABA>BЯдо>`^[CЇ™gLVcZ[accfcc`XTLFA&Nfmtag'!423544344322020020/3'4URoЧГPP*JPrxiZW[ehQI<44420--*)'#!)!&/BEKL^hh[dddkcf_^XFAA*0-<==>=><=>>=@>@FIRXr^5BBABACBECBFFCFHHIIKPVjf=KKIJKLLPPLLLPRQPR\8PVq>PUVUUVWUUXZXXWXW[We=TiZF[gh\^^`^N^^^\K```e3>VmE8H^^___pK^k_`^__`f8Pja)h^[[^__`k`_Lcedca_W;WkTUjwtkihif‡_fm{o6U\d*{Rmjfc`\XUTPKEBCFFjPcd\3><68<;)UPgiJ-85458<>ENTVWcVPCUJKJKKNK8RWWVVddWWcRTXFaTVRVUTWTWX}HWTRRLIEHFHIFIIFHFHFEEIHH4CJJIHHFIHFHFFHFFHHIJKJIŒџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџшBPL`LKJKHIHHHFHHHIIEEEECFFFFFHIFHHFHFIHIHEEEFITV^^[Z\\\\[^\\[^[^^\^^^^^[^^[\[ZVPB><;=<8'\V[`m`ZTN>RZ_c`^[kV8d\X@hˆtstviz}‹ƒ‚ŒoX\Z8iЃ–‰ˆ‰‰ˆ‡…ƒ‚€€ˆ/W^ZAU•‹€‰{|{mm|{4>[\I6|{€€zk€€|||‘FE[ZT=qqswtwtvvvsooiga/c\Z>`{ooooponkinn[gwr%XfZA2Kсj^^\3_Ќ{^LXV[aK}fdac_XPJE4JmatkcJ)4430433334220/00//00&EURpЪ{Q…R-FJT[n_[X[ZdgI>&5B-)'&''%!#*CIZTVZ\\^^__\^^^\^\[Zkcih^P>>'/5E-fВЄЏБџўїЧн‰ “–tN^ao{ŠЂšЂЂ›–Ђ—K^r^\[&ZВЊ˜šЄ™› ЊЄˆs[Eˆ–C4AB6NTWdVEQ4/K™ЄЈРЗКнЙЌОЩЬЈ–„pE4RXh5NхВЋРЈ ’€r[cegyiŒr—…3=T[mK0==>=;<>=@<@>=>@>@EHPUjf/CBBBBBCBBEEEFFFHHFWPVeq4JLLKJKLLNPPLNPPPRQLNamT=TUVVWUUXV[WXXZe[ji5PZZ0UK[L^^i[i`^_^``^ahVPkmTUd[_^^``P_^a``_a`^Q=Wj>@=2[/\`iB@–pQN[P‘WZhdc`_XPK5/WjsreN432202003243330/-00!!BUa}Є‡^…T/FEFJPWqZWZojUI@;;2&&%''&#!!!%>J`W[Jdfrf‚’qzzz}z}rtsazcra`^^[ZWP/eЊУЭОџџщоЏvœ‘ˆ‚R_Q^”‡”ЌЁЉ››–А•›^&[h^^^3f Є›Є™‰ЈЏ’ŠˆqXeЄ@JKHJKLPVWiT<=\‚‚{ЮЛДЙЙ–ЮЛвТЙЖ„s3PU\^ЗаšДЂŠˆ|e_aeotŒ‹‘iX4Q‹kd2>><=;<==>=@K=>@>@AHIPdqLB@BBECBBBEBEFFHHIFJJQXvB=<>==>;4A`Z^cn`eTLLQX[^^ZWj6QZ\IIfxoppqtz}‰˜W2e^Z0‹€„……ˆ‡„‡‡ƒV……g3e^X2ƒ}p|‰|z{|y…!Wf[@R’€‹€Œzz{}}‡zzˆ„'XZZ=^ƒrqvwwsrsqoprrp€CCe\V5y}opniWjkmoknwmzd@>>--C^j_/yЪ‹wmNQF„yjde`^WPJ-Ppnd\c#3323202220202220/005CTaoВnd\/5ACIFCHNXqiZJZ\jhJA=@V'AKU\JJm“™ТЏ™vxm_[\\[\Zo‡mktgtv|’yZfT^gX8PЂтџџџџЋšœ‡‹`dV^w…‘šЏ‘ЇЋˆ–“Ѕšg@FkZ\\*\Л ЉšУ›”…zmeiR8QUT=d)@RVZg6Ugˆ—ЫГЁКШМТЌВЄАˆa‰QPW^6CЙБ В‚‡…qK^^gztv•rfj<@T^t<@>=<><<=>>===>>@BBCFPWmR5A_BEEECCEEEHFHJHIIJ@cn`2LKILPPLLLNPKPQRRQQ;RZk6Q_WTVaVUVXZZ[[[ZfcP5VdXHf^JAy_a_aa_`^``aji*Qmd3vj^``a^K^`a`^_aa_i3RcW6n\VW^`k^aaasaa_am[@PcW5r`tfgrKhsa_ynxwL8[o>Zfd^ANHE@=<;85656AWRrqE654233&AJUce0550/34;BWRTXWWPT==><83CfZ^as^XRLNTZ^^\VXf=TdZHXojkkh^rwzzŠz’J@\gX*šŒ……ˆˆ……‡Ž‹{w*ƒŠa=[\X4Ÿ…„‚€‰‰}…yz„„i3Z\Z2f|}‚€‡athƒ{„zy}q*ZeX;`ˆttswtvsrpqqsr3Uj[V8‚znppnjhQkmnj\ht|;U[ZREzghgcdgfgfdggdedmf0c\dRHg``^^^^^^_`_^\^kU44WdUAPVVVVVUTUUUUTTTRQP8QiZUPNZNPZKNIKKKKIIEFHF-UsdoRHECBAAA@AABAAAA@@A>*`ijP'ЩКvzxropstƒngec^ZPIKXpn_iE&2222U22*00000233302%/T_vЂocf0>ABHTEBHNWvh[W\gfVJBљџџџЙ|U<@/Q‹ПЧЙУzkd^XVTR_^JUccZ_KHIJKP^W[_dЃПpKBLB-5џџџхЂВ™Œake[w‚ŒЅšЏ›€ЇЅq``Zp”ТЇБ™‚y\`[^hz|rme`fIHRXrTC>=<==<=>>=@@A>>@@BEJUdi53@BBBFECFEFEEFHIHIK>V[k*%#!#&'#&/&&###CHLB@4AmЖЯд|=<;гъЏЏО}‘hwcUp}ŒЄšЇ›œ—Є™„yi^<;kXm^#xВЂЁД—‰t66NfX\VxзВHLUWeJF‡…—ЇсЏЭгТЄйАЊЋz™€x‚d-RW^T0БЈŸŠtf^L^fnkcsW;/FKU[oI><<<=>=>>@@@@>@@>AFIQZkNECBBCCCFCHEHFEHHIIL=R[iPJKLLLKPPNNPNNQQTPPLNTZf=TVWXVWWVXZIXX[\[eT4PdiBX^^^___^^cca`c`a^kR=WiTIom`^^P`ac`^```a_Z4RXW;Xip^`k^ccda^_^P^a^WBTjR3Xcd>d>ht…|pkn‰j^8WfZ%i\jLE@<;400/00022#cPXh^%330/04dKKLIWJKPTUUVWWXXVWhXXURRRQTUVUTTZ\nHT_PLIHJJIHHFHKIEFEFTIHUFCBCIIIHCFFCEHECFEHJIKIœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџлRPNKKKIEIHJIFFFIIFEFHEHFFFTHFHFFEEFHFFIHFFFEJ^WXZ\[\^[\[ZZZZZXZ[h\\^^^^\\[ZZZWPE>=<>I82!IV^ezd^VP[\V-wŠˆ}‡zxwt„xss‡FI[eT=rtЄxtttvsvrzop}o0dkZ;`}qprponnmoppmmmw^*X[V6[esjrddfefeffeced^&%&/!%-/*'!!#4*3NUW@3'5ˆяџЪ\)2rЉСЉ›“zgPTm{“•›Ÿ Њš™—‘‡{pa\;@WZ\^*kБЏБЙ–Ё}88PU[[RoЈЂ{JQVZe/j‹ВЄРЙЙКДŸМбЄЊxt•d|•4'V[hŠАˆzW[[^qŒsU`cN%'CFRXkP-=<;<>=>=@>>>@@@>ABJPWne4CCCBCBCEEEFIFHIJIKq`_^^^`^`_^`k^^`gRPWhAF\_L^`_aa`_a_^``q^V6ThUA„mmC_ovXXXimmoi^EPVdVXQN@_LXLJKJJNTUVWUUWVWUXUVURTTR`TgVTUXXoWTUQPIFHIIFFCTHIFFHHHHIIIFECFIJ4CCECCRFEEFHJKIJџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџй#ENLLIIIHIIHIHHHIHECCFFFHHHIFFHHFFEIIFHIFEEHFLUX[\^\^^ZZZ[[\ZZ[[\^\^\^[Z^^[ZWZaPB=<;=;6#\ZcviT\UPJLRVUUP@QP4afZP™‚……ˆˆˆ‡›…‡„„T#X^\=WŽ|e|}zI8„xz–>>j\UBŒˆŠzyzz‡wtvw„qs„5I^fHCyrwxvt‚ststˆhCx‚_3[^ZBBKih[TTa^f‚ˆ‰•–™…w^we^jP'Wo`^UF'3323232200/0//>0/-2-Zfe‘rh\!033446;>>@>@BINat„a>3#%8B2TQџџџj)KZH&#!)--))'#/8@KVs{U88ъџъ|8=/!-zАЄƒxgHNix–­œŸЃ˜š™Vi[FAjW[^2}ЅГМŒŸ4HQck\Bx™™\\P25RVnX&ˆ‘ВЂДГДЩЈ›ОЄЁ…n_q‘PVkH4­˜…|pc[W\rd^\kL2>=@CNVen2>><<@=@=A@A=>@@A>AFKTjs8CBCCECFECEFFJHJKKKKKU[g4JLNPPPNPPPQPQPRQTQLRZh8RRWWTV34d[J[[[\\ZXR@UvUBe^a^_``_aFj^^`a`ik6TZc8f__`__`^aa`_^`azjZ8UiVA[jj_^`a`_c`_a`on\g6UXV#f`cdv^|a}rg‚imza=T\e@PH=54---)'))'&'*-BPVXe!3/20//QPcoL'22--05vsgdQcrhffgfgggecj-f[XAW^_`^ac_`_^^^\^\^jR@q\V@UdX[XWVUUUXWaRTPPN3WjVQLPPLLPNKJKHHIKJIIFE8enz[LECACCBCBBBCBCBBBA>0TkhWQ-T^hi‚‡ЄГЂ€}^hc_X5PkjoVN'454222302/000///-/0'JZas^Q!#00002366<>Q<8>AHJQ^P*0>*3ŒџЬяF#2RI&!!'*)'&%#/8ANUXHVP>#gšџьˆ0B@*A™ЈgP_hw…•—šЄ‡š˜”}nK^zx0RTX^H0ŠГЛ=5QX^^LyЏkREI5'Й46TWe0oˆКЌВЪ™ЖЯОЈВ‡^k^o‚Љ34Cen&‹Ђxm^XX[ZK[k[/=<<=EJUesK#>=>>@>>AAB@@>@AB@EHQZiQ5CBCCCREFFFHIIKJKILJPXqPKLNPQNPPPPQQRPRPTd>PXmTQUTURVVWe\\[Z\\[WdT5Rek0X_`^^_^k`_`_`_aa^V6Tii8[_mc^k`_kc`^_^c``j8Uia0j`^^^aa^ac`c`^Z-ha6Qcf/eceUd=/2vxCikkz}ERkoPE<50*'&&#''&'&'*--;VRckB!2/-/0#E`VjN'32*//4TVWUaWWXVXZXZVTVRQVR`RRTWUUFVVQNHHHEEFHHHHFHFFIHFBBCFHHFHHHIHEFFECFFHHFIIIœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџкCPNNJIIHJFHIIHHIHIHFEFHEFFHHFFEFEEEEHHEFFFFIPWZZ[[[[\\Z[Z[ZZ\[[[^\\[[\\\\XZeXeLC<<=<;4>`KoСrT[TLJJPQQPLLXILceVCVWXXUF[^^_`apZ/X\Z/n–……„‡ˆˆ‰ˆŠˆƒp—v'e\W/w’„ˆxtˆz‹||…‘{…‚ŠW[e>N‡z*L„srqsvvvtsv&Z\e<_ˆ}vsrs^attrz^n€x6VfjHA}zrroo`onpmkknnkq!W[cEKxihfsgghhfdfqgeeaV4gZV@Z___a_aac`^^^i_[\c6Re\WCVZZ[XVWVXUUUTUUQ\J4angTK/)_caƒЏВŸЂЈРzœnmd^T2Wn`[cB65332000000-0-0//-/!E``ywif3002/222566;<868;<<)0I6@5pџџџK>)&&&/!)'&!n8HPUX[WP8/УИy{џяj6L5)hzt^Qjwƒ••Ѓš‰Ђ–Ё‰o`Pczw)AW\^N@ОЛ@HPX^^In™ˆUZE&KЂж€TTd[!ŠБОЏПБДХЂ™О’oc\iqzЉ{QX^K2‹tU[VUUTVaa0<=<<=BEPWm^/===>>>>@@ABA>@>AAAIPUnV8CFCEEFFHHIIIHIHKLK;QWnT=NNPQNPPRPPPQRTRTTP>Uia6UUVWWZXZZ[\[\\^[XfAQei*i^_^[^__a`_`_aaa`\AAdm=Zo`a```^_``^`acc_[@TXW0r^^_`aP_`dec^ZhjW>RWa6j^fwaayt0g}w„Fg|2;etc)2-&&%&%%%&%&%'*')%HTXxE00/-2CNTadB32--/2;BNRVw•VPF<<<<4CcIsСc`[UKIINPNJFHK4PcjUQ_UVRPAUWXZX\eTCXfW6ƒ…„„ˆˆ‰‡‡““ˆƒ™h*[kV6‡f/Pnh[\C<-2WxdЅЪОЌЏЫܘƒsg^8Qfo^VK'56543332020/02/-//#Bd_v^g#->0/03/244565564565%8=!Nўџџg2)')%&&&%!!/8HQV[[dQ8šаіџџ„АџУPCP>>>>>@B>@@BAAA@BFJRwh=EECEEFEEFIHFIIHJKKKLWfg[jU)xnpstvttocz^Wrst0ZfZ8^p2nppnnnmmkjmmjvZ6c[WB_hjkimighhfgefdecp0UmcQ;k`ca`c_`_^_^\^^_mV*feXCQWe[WXWZZXVVTRVTT[&UZZQLPNNLNNKLJHHIHIIIIE>onrXKFHCECBECEEEECBCAB@2`n^TW/;&**mnoКХœЄГа­‘phK4hg^W\C;65444000-0/E//--/'Qnfai-00---/00/3544344536&*LF/|џџ‡3K85>3'%%!%/*##&%!&%%##-8HTX\^eR=ЌАЮџџџВ3Сџ€FLIEVZct›‘Ё–Ђ™Ѓ–”ЊˆpF^ak„šgRW[\U'Ig[PPŽ–UXI#[ЋОЂСŸˆ>Qd^‚ИЊЄЮЈЯвн˜‹zjeUo‹mQWjLHƒkdV@JNdc6><<;<<<>BEPWqN->;<>>A>@A>@AAB@ABFFQXmP5ECFEFEFHFHFIJIIKKI=Veq5LLPNLPPNQPPPQV`URRKPhiETVXXZZX\ZZ\[^\\^\dTQVeUVrc`mc`c^ca`aaded_[;a[X;gaad`a`a`aa_`_`jZTBVhBWX[\_aaaddd``6\^h\c@TkREjoyfvmVWN{||WzUBVom#!!!!%%'%%C''&')ZPZmg%//--/0<>;;2RTF•иoPXQJHIKKJECFI'R[ZPLNNLJHIJKKKLPP8Q[\V6„‘ˆˆˆ‡…‚‡‡…Ј5FfgV2…ˆxxy€™{…|{}}y‡N6X\W2tprtsqoossssrrt‚‰@U[[V3ppssstqrorqr|t|^;ZfX/ksiooonnooznEkmmoFFmZR8ksijkifCeffhgfecdk/WZWBRnaccc__``\`^^^_^kR>c[V>VZXXVZ[ZXXWVVVTUTNL0;6553222200/00//-0#K[swckE!0//---/00025533435##/PC@Ыџо@™sEKE=2!%##%!/8He[\o\T8ЏГвџџџиЛ…)eййWTNEF_pЈ–™Š—В˜Šœ™|oJ[PnzŽЇF&RW[pK3JV[PvЪcH=-TПС’ЂЉƒЂW)@U[P0ЪШЂеЂЋŸЂ…_hdeky€ЏВ!6RZ\6€rjQIJLwg0<=<<;===>ELVmd)><;=>><>@A>ACBBCBAFPVmU8ECEFEFFHIIHIJJJKKK@XrTBVZ\[X[Z^\\Z\\^^^[V>WjVEq_Q`ac`cccnc`ceapi-Vjr3gad`c``a`cccm`cs[U>giERi\^paa_`oed`gZem^d@TcV8yiAxzP)ktxoZgNPUprA&!#%%&''%&)''&)'!WNWmZ&020/-/6TTZdB!/0*-06AJPEPšjRK=aILKJIIKPTUaVVWUVZXWVVUVUCQTRTWWWF[WUUULJKHFF0HJTHFCFCHCBFHFFIFFBCIHCFJIHEHBHHFJKHœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЫQNLLJJJJIHFHHFFIEFFHIHHEHFFHIHHHHFHHHFFFFHFJTX\\\\[\\[\\^^^^\[^x^`^__^^^[ZZ[XPH>=><<8ZVP|ŠZNWPHEFKJHBAFF4djdPJLJHCBEFFFFFHJ;R[eCJ|x‰’Š‰‘mXi„rrƒŸWm\V=‰ˆjyzˆŽzPz|{ƒ……CAXjW>p‚srrossqdrsvvtƒ4U\jUAƒrsvrrq}rqrqrrrKCZ[T4w|qqo€qpzop|jknw{4UjiREvjmijhgfgfheffedmZ/aeg>Uocndda__j^__^^^^i-RieVBWZXVWWZWVZWVXVUTQ=Pi\W@NLNKLKJKLIHJHIJJJF0ds|^QHFFFEHEECCCBCA@A=-%TpiUL/86665*Ÿ“МџСЫаЧВЌn%W\gXa4=<654222002020///-%Ef`xs\L23//2/-000022530334;5RUmўјm&Pco\X`PF=-!%AџџџџџЦ'%#&#џџџџ!=;JUZ^h\U3ГРЮџџџ–ИЫАRЯqciXCg…œЄš˜‚БЅš”š}pUP`m…ДЇ0/RWji<@IArЖvVB=WДЌСЄЂА{“‡5@QV\#sЏЉКɘЌš’‚eXPaic—ЃhQUk[_|jK5HK^3<;<=;<<<=<=>=@@>>ABBAA@BBAEKUio6CEEFFZFFJIJHIJLLKJINXeU;NPPNPPPPPPTUVTTU_PNUjV3V[[X[X[\^[Z[\[[\^a>Ted2f`a_`aa`adacccd`aW3PXi3mkaacd`c_Qcm^`ao3T=WdV@X^IN`^L_cwc^vA<>=I82#Ka[P`^\VQHEFIJF>AEC8e\hPJIHEA@@@cB@BCE-TfeTWoqx€—ˆ–ƒ‡”v’#Xg\EQŽˆxx{„yyˆtv{z5TZjH8ƒs|Z{prrƒsptvvqr‚&W\[HL‡rqtwvs|rqqtpqp‚@VfeT5wzsqrpqpqqnnjmomv!W[ZEA|imjjifishhfgdeeqWAcjV4Xjca`cc`^`_____^\j*V[ZT8WZ[ZZWXVUWXWVVUTP-T[\U;LLPKNKLLJJIKVIIJIF4mtsXNHHCFFHCEBBBAAA=>=)^iomTI-88;85PЉŸШЧЙЧЗВД!=e^[UN0;;665333002200/0/3/\gdnmQ-2000/-**/20003A/3!&HXJzтпA-5\zcQ\ZjiTJ=*'pџџџџџў'%&&џџџџ%E;J_[\\ZU;Ї}АјџвhŠЙЄАБ/rЈtc_C/qЋ’ВЉ™œЇЉЄ›€od^ak…‡АЈŸ=P_XjWR\ŒЅ{dB;8PВЏŠУ˜ЃЈ‘Œ‚c-PU[P0ЙвЅЇИЇŽ‰cf_ahtŒ‚™™@Tf^5zP6CHZA<<=<;<<;<=>==AAABABBEBABA@FIQXqNEEFEFFHHJI[FHILJLKKPgfg4NNPNPQNPPQP_RR_RT^4Tdh8`ZZIZ[[[^Z[[\\^h^V=PiiCZjaaaadcadneedcec\>PXr;[p^acc`caa__^`aoVPAEBHVnXLHHEC>@>@>>>@@A3efeQA^dz‹Š…‡ˆˆ“˜ˆˆ™ˆZ^Z@RmŽzfz€zyxvpnZr0W\eUC{rqoppssvssvsttƒ}%XkX3_ˆvttttsZ^qsrsoq*Xg[FB‚qqqrspoopokjpzq!gXXBZ}jjjihiihggdeegesCEd[U;j`ddaaacca`ak^`^[V3WeXRQc\[\[WdWVVWVUUUQP/eedULLNNPNKJKIIIIIHHJJ8R_tjU>><=hУЭїЫБЏзЖZ\[VPF>;884433302222//-/#Kikz^m3%2230--/--0000022/3IZXЂј…3U68Q[jziHZmjRJ=-Vџџџџџє%%#&&џџџџ#F><>>@@AAABBCECABE6QViU4FFHFIHFEHHHIJIJKKK>V\r=LPPPPLNRRRRTQPTTU^3Q[m5UdX[[\Z\\\^^^\^\[`=PdeHZ`accccdcQ_ddeeeohTBVmCWi``a`aa`\^nK^``kR@RZa4cg^^rvcqJZspzRTwo[RQZh0jd|zk)'3*dT5)dQkka%/'%&&*)'''%'&'))TRmdA0---/4PNhpK&00-*-2@><=<<<>>>4`fhALQXdoy}„”‘Ÿ‰ˆˆ—#ZmZ=eo‰yWz‹‹ztssqkts#Xge=Ejronottvttttpc&dkX0etsrrv}ro{psvtzv*Zgd;8;;;'UhnUN3@@@B)6nЂЈrЃажџхКоPm\[TNE@=<655432000/02//B__r`gE&3000/0----**///-03)IZf‰СˆPzA34IPXr_ZXXpjhH@/#zџџџџџя&%%!ёџџџ#!@%AœБšГ–ЄЏ™–{dŒ^-Aa\^Є­ДЃ™‘”vi`^okr‰kˆPVoh3FBP@;8;<<;=<<<=>=>BIQZsJ0@@<<>>A@@AAACAABCFLVjp2FEFHEHHEIFKJKKLKLNKRejQL[PNPPPQPQPRURTV`Q=PdsRRX[kXZX[^^_^^^nK%`PPVmUUnacdced`[`occcocpW>WnUHvk`aaa`oLnt3>qweUNRWp6dz^dovm€3t‰mn|mƒwPRcgPj|jdP-;%'2rK%`Ne}d%&''%'')%%&'&&&''\QZzB*/-/-CLapK'0-*)-28==;6@[W\‹t^ZTICAEFC>=AECKgeVIB@><@=<<<<<>>@Ii\aK6IPX`htƒ}ƒn„‡ˆˆ–oX^X6v€x„zxzƒxsoqpzjft0d^X8^‹‚tsp|svsssvwxw„^8ZfX2wƒvwtqtvrc|sts}…d4i\c-^ˆrsrrsomopjmoozzI6d[V8jsjijijhggifffehok)`eXPBncacaaa`_^```^`^fAQm[VBUZ\ZXWWXWWUTUVWT^=Ph[U>LLLLLKJKJJLLJKJJJH8ZzkWNHHEFCBCA@@=>=6;8<8A@AIPWkn^I[\k`JAQЌF''&!![FtE=J^X\^\W=›№џџAЂЌЈŸКšA8`Ёqa`/cВЅ™™ЈЌ‘“€e^UmŠЈQ@->CLRWjJIT)*N“ЖЈ­ ЂЄВ‘–Š|o[{W6TXq*yЊХЌ”‰‚rZ_P`[`x|ˆŠ—06U\rNHBA<88;88;===><<>>AFPcmQ3A@>>>>@B@>BB@>AABHJU\m@FIIHEFHFHIJIJKLKKLJPXjU@P6BF=PPNNPRTUUVUQLNXjT8`XXXZ\[\^i^^\hfdaUAV[W*t^h^rr|pVwzz…vt|‚e=Vfc@}z€p}}ƒiz€zq{|iegQctL5X=NECL%>@<#HPWkN''&!&!!'!#TNZpf%'&*''&*3&'')'')&'WRdoI)*)--LK`g^%02/--2;CJUZf\WQX;RKKKIIJLQRQVVWXVWjeXXWVVgVTR`TWWWXeVVWUPKJIJJHFFFFHHECBBBFEHETHFFHCFIHFEHFHHHFIJWџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџНQPNKJJKJJKJIEFIIHHHFFFIHEHFHHFHIICFFFHEEFEH^X\^\^\[\\\ZZZZ[\\[Z\^\\^^^^\[\\XVKB>=>=;3AaZ_d_^[TIAAFEC>=CE4=ceTH>><<;<<;<<<>@0Ig[`IBEINT\wwˆtˆ‡‘Ÿi3dfZ3wox‘ˆtfss|`[|mƒp3Zfd;`ysqrptttssssvwtƒEBd[W-yrtwvqrq_ssssr{^;Z[W3c…sssrq{qpnppnoz5E[jT;mzkijkjighhheehhn[!aXVPV_ccca```_acca`^^n;ReZT>Wf\ZX\[XXWWRUWVUQ8RidQ=NNKJLLNKJKKJKLJWJF<^riR;ECCBEA@@>====;<;<*Lm^XPHABAA/гыЛЏЋdЧщјъŒ^^ZUW^FB@;886542020322!&Igjt[e>0000/---/-/--0/-/IZfŠЅmdW2FCCA@BINEg‚hK[mkVLC%-)>>0%!*6I^W\\\h=ДЋзџШi—™‹ŸЁДœ›Л‰iJ*jravaaБЃ™˜–ƒvX^`ˆ‹L&UIII;[UefUP3Cˆš•ЋŸЂЁ‘ШЗ“Š…m[zp/PXfPŸЙšЁˆ|sgP\dzq’{ˆ}›v#PXnUFB<68;88;<=<>=;===>CLWje3>@@A>@=AABAAABBABEJQesQ;HHFFFFHFFUFIILKJWILUjX@W*џ6WKPP\QR^^RR^`N>`eg=edh`iwptqzwvv|wtth>Tjp@f^zctpIBAc`LVJIHHHKVkk<#%''XNWha#!!!!!KLTzg#'*)&&*')'*)&')')VQdg\)))--QIThi00-**3;<==80E^[no^^XPIBBECA<=AC4Nhj^C==;;<<=<<=<=@ALhjeI0@BEJNVQk€›™Ѓˆ’P4XfX6yˆ€zyposspokhNjrN=Z\X<8885534223324/\^qi`F-2202-//**/0--/-/EcfАncQ&BBBCA>@BINU^_JZZ^neJ>CТП•ˆdˆyxmqirnfcmPB^qmR%yАЄЊ–˜rtT\`ŠH*LdVTTJRXjh-VjМ—ˆЙЁЁЂЂЪЊЄ…xjZtzK3QZ^5^Й“ˆ|nc\L_ktz}|yˆƒ2@V[j;=65668<;;<;==<=<=>CIU[pJA@=>@@>>@@AACCAABFHPZkf<<><;2Q^[‚`^ZRHAACC@;=BC0[cdRB<;<;<<<=<=@>A/PdeTF@>A@@CHP\je’„=CZ[V@}mroa|t_zmZimwH=<><=<<;=>AA5gnkTK@=;6СРИЖихлѕК^Юš\q^J[_fQI>=8;5444232003)Ihiida0--300//0*-/0/*//CVd„’i_P&)ACEEC>==AFLUqy\XXqf<2<вШЌ|c`\[ZZ[\^[\edg_dszzzwP4=VWZ`=ЙэџџfnЂЈœŽЉ œ› pU\XHPZiQ3>IIHIR[mK-##!!#!#'&'FQZpI#''%%%##&%%%!!#PFPnv[&!'!'ZPZkZ#PVTXt&5[TZf;#'aT^ЮH))-)'*)0))'')&')#ANVmk#'&&'*/8HTdkA20*)**6>JPWW[V_K=CUIJINKKNTRUVUWUVXZdZVWRU`VWaUCUcW[^XR^NJIIFFUFHFFHFFHFFHHHHHIFHFHUFFEZHEFIHIHHIHœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџФPNPLNKJIJIIIIIIHIHFHHFFFEIIFFHFEFHFHEHHFFFL`[[\^\X\\\\[ZZZZ[\^^[^^^[\_^\\[[ZTIB==KJ82HU[^__^XPVBBCEA;<@A4PccPA<888<<==@>=@A4\m[^FA>@A==>C>Zqt›„‡'TZnVEXagntrasvsr^Pˆz=Ee\V5qsrr_rsvwvxwts|€'WgeHBƒvxvssvxwtwtt0W^\T6zqssrrrqnqqqqqnwa&X\X6[kiigikjihfghffdw=>BIPXqznT88a}P;EJP^\XZZ[^\\\[ZXZe[WZ[vtm^CJT5Ћƒџџ5™ЊˆД’ЇЏЈ‘ƒqe`a_<>X^aa‹У“ЋtccJEPVZPFrд”[PTXd3g‡œ–œИ ЈŸ™ƒwgT[o—F*QZgЄ”šte\F\_jqwwwpdZ)PXkm-54444444B323024546BNVik364202#%*-#/#///;JT\qH!%)'''')&)&&'%%CPdsc'#%!!#!!#'BPXt\!!!#!&UPZie!%\PWtn#3TUmn;^`jzA!'dUi^N)*))'')-&'*'')'*#@NWde*-''**/&ZQie3!0-))'4@JQaX[dTNANKKKK^ZKP_RUTWXVXVXZXUVWRUUTTTUVHZ[^nURPNHHEHEHHHFTFHECCFHHEIFFFEEHHTHEEHHFEIJKJIџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџФQNNNKJJJIIHJJVJIIIFFECCEHHFHEEFCEEECFFEHEILW\^^[ZZ[gZXXX[W[[\\^\^^\i_^\[ZZWcRF>=>>>8!ZUXh`^^XPFAPEC=;<@@3QhjK>88;<<>>AB@@@C)QiiP4A>@><88>=<<<<<=>>ABABB2TmnWJ'UхЋпъяЌајsW[^[VE{w[RLA;6663434333%KkhmVU/0-02000-*--////2/RssT[K8=>BCFHHEA>;>AFXRaU4PWk\P^\\^^\Z\ZX[Zg\\[ZX\ZXXXZ[[_^`tW0МЄџПHˆЋ‰ЁŸœЗ’tWect'CX^kU)ЈЂЃ‚z^L#4NU\QXtДšˆ0VPUiXLy‰€ЙЈ‡›œЄ —‚aZegrЄj!AWfLIЛ›qcKZ[ah|€xyrXcv8JRcXZXTLBA`LKJLKLQUTVTVWWXWWWHcWXVTVVUUgUWf^^ZUURPIIIHFHIHHEEF3CFEFEEEFCFFEFFEFFFEBEFFHJJIџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџШQLPLLXJJIHIJIJJIIIIHFBCEFEBFHFHECBBBEEHFFJPWZ^\[XX\ZZZZZ[ZZ^\[^^^_`^\\ZX[\XWPF>=<<=86[UX[^^^WPE0CEB<8<=@3B3ACB2\XhP3AAA=<866;@2CmfW“)UfiAC|;aZ|ctr\V{{{2W\eH@‚prtrqv€xwvwwrpzt)Z^X4cˆvttsswtxvvwƒqt0X\X8\€nzrsqpoppoonom‚[CefU8prhjtiggjkhiieegfmfZWPRpccdacddocaaaa_js;Re[TQh\XX[ZWXUVXcUTRRZ-TeeRJKPPLLPPPNLLLKKKJI)`prjJ@==<<;==@>ANACABA@8anmT8/Р<pџщђўеЋмСA8i^ZAToi`XQJB884534443#2c\\X`>20//-00/--//**-**N^rsiI#4;@BCTHIEA><<<'-*UaaW\Z[^[^\\ZZZXX[Z\X[[\X\Z[ZXXZ[\[N^^_^kЫџџwVЉ› ЊЗŸ­}™В‡tidek“w#>[_aQ8•Ђ•x>2NV[PJzПЄ`^IPRZ\/‚›”ВЅ™ЊЈ—„™€oZVhq™Љ34Ue^Š‹yk_JZ[ch„vwˆWQ‡f2RZzN/-*))%%%#''&%&')/6EPWiJ'&)&'&'#&)&&%&&%BLZji#'%&%#&!!!!!##'>>=<5'VVX^^^[WLB@ACA<5;<<3\ZfJ=;;==@BBCБBAEF3^dcN3AAB<<;6688*3Po;V5V[cBU–w^r…‚„•ŠJI{”„/VfeFXŽ‚ƒˆŽ‹’‰Ž€Œˆ’_2cfX=|™„ˆ…‡‡’ˆŽ‡‹^6cfWAvge€…‰‰€|„‚‚„€z@BejU8|‡tss{ww|…}xwrvvsr4ajWNRkviypxpjogZpnpfjj3V[XPQocjgoegcfo^c\[_aV0e\dPJRIZ[^__d^Xa\WPQZC-hcqXH<<;;;F<<)PpqWWXWX[^^[[[W[ZZZf\ZZZZZX[^h^Z[XWX[\\^^NoŸџџџBf Џ™ЁУЂœ˜•™„yhTfc‰Бq!I\^`=\ГšEEPV[\P‚ЭЌ^IV!a8RVjK@ЄЂ‹™˜—Š•Ž…||VdhpˆЌ|PWfAf‘tj\UW\aiˆssWЂWm…8F[Xjj-'&&%#%%%#%%&!%''#@LVqa&%#&#%%%&&%%&&%&*>LWek-&!'!%#!!!!!!%##5HRnrA'!#!!6ITit-%!6JTdx<5UUdj=#^NXoR'!!!!!'^PXcZ!%%QLXni%&*)')))*')''<*-)*%ZT\pC)'**/[PhfJ00-**3><>H5;688;3fdfI=<<<<<886;88'3ho;`ja>0\pPTd[[\nosrtkne2`fdBPsfggn^x`ih^qh^mrRAa[V3oeZf[hoo`jj^_ihrRAXfW5TpXTW\ZF[\\^^m[Zr>TdiP2cXXTTUXU*)'8;'&6688mcxT2%22242332!223NknWJ%!'j\[00//-0---//----#CfrˆvZN;0056=BTJJHHA>=)Py‚[VVXZWZ[^^^\ZXZ[[Z\[Z[\Z\[\\\\Z\WXWUXWX[XH8a‘ъkЄ™…‘‹ЈœzЅ‡w\ctrŠŸИdHZn_FdV0Z`[PLvœЙZ;<6RЉ™2APX^*yЁЊЈ—”•Ђ˜ƒ{rZcgp}—В*Ue[3…€h\BTZciopk[–gkL>KTjB#&#%#!!!!###!!#&Lan^--)))''*-&6)-**)*)aTkqI!)**))EPhaK#02-*-3;HPVXZ[UN[;WWKNJLLLRVXViVWWWXWUVXWWTUTTVRTUWWWXZV_NIIFFFEFFFCCEEHEEEFHHFFIHHHIEHHFCFFHIJJHHœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЗPPNLKJIFJIHIFHIFHFFFFHFFEEHFFIFFEEEFEHEFEIRX^\\[ZZZ[Z\[X\\[X[[\\\i^^^\\[[XXTXC>;<;;4>_W[‚w_[RKBAAA>85568CdeiI/==>@CECEA@BCC/e\hKCCBB@@==<<><66%!8V\oI0%0%%)_fkK#)&#Kad^4'#/!!'Lcn_;'#''2*6'-5/555-*#TZaK20*3&44-855/4)85FPheT82/E&)'&!&<Jc[zK'%53462#/!40/-20IormP%22*02--0--*/*-/*0-fpgRF#-/)*-******/*--3ErfX;‰џЙHqzTgTQKE<86556Ij\eUI&000000000-/--/-)PoppZ`'-/238@EIJVIFB>-%v‘hXWTUXXUZ[[ZZ[^[Z[^\[\Z[ZX\\\\\Z[[[ZXVVXWXXXF=6Џeq”ЇЈš›з˜šviQfr КПRVf^nEI^Z^JsИƒo>5<^ЌQ3PWZa>“Ђ—•–•ЂxUafpzƒЈZTXjCd{eZVU^o|zheNvwZ#8EQXkV#!#!!!%!!#!#!!!%4TTiqC'%'#&#%#%%#&!!!#!CRmh^'!!!!##!BPck^%&#%#%#%%&''&&&'2ZPdsU)))'')))/'')'&''!WQXrI'&%'!%&%%%#&%%%&[QifR#%&%#!#!!!#%!%%&^Nakf!##!!!#!###UPWmf!#'6VRjm>#)'*-)*)))*)-**-)FR\vW****-PPXqX000--I;FPR[[\VPR)QKJjJIJ=RTXXVUiZWWdVUXVTUVVVTVTRTdeX[V^KJFEIFHFHFCHFHFFRHEEHTIFEFFFFIHECFHEFIHHHœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЗPNLLIJIFFHJJFHHHHF2^HFECHFEFHFCECEHFEEFFFJdZ^_^\Z[XZ[[[\[[ZZ^[\^_\[[^^ZXZZTTKA=<=JF3@[V[ad^Z^J@A@>653468E_faIA>@@AEEFCC@CQE=>B^R;62#Eif`E%856;;J<;8<;;88;%88/NcdQ2;;8;==@@=>=<>>@A2PieRC><<<>=@BCAAC@AB>>5^[fI@>@BUCVFEFCWCCEFBC4PdiTFBBEH[_ZCBBH^XFEB>*Kfi_I><@><;=8;66526643&ZdfVI<8322202/-/E2/---#ZpqeJ*-/--***)-))''--BiikP=#-**)**'')**'))')WqfW<3џџzCQd_WUPLH<8658%ejZX`0!0200002-0////-/Xknhd@/-/04;>QFFIJUE3;{Ї^[WWWXWWXWXWWX[__[^Z\\[[\Z[[[[\ZZ\ZXZXWWXZZX[ZZJLo‡ЃŽ—™Ї‡ŸЁšЂ–cdRRcŠŽЂЂ­!)X\tf44K_\TnЃ“jBH/ZЈ›‚ˆf0@TXg'‡ Ё’’Ÿ“Š}txR_Xq{€ЂPTeZE‰`HRT\dgedc`kc%&/@NVsm!!!!!!#!!CRdj[&%%#%####!#%%##-LLWig%&#&#&%'&&')))')#KKWd`<-)3*)*#t#**)))))CNXk^/***)*--*)*)3)''PQXp\-''''&''''')&&%&XQhg[%#%#%%!##%#!%!#&UNWXg&%##!!!!#Ё!&!IKWXk'#!#5[TjwB!***))-##!0!0-*-[R[wN-*')*NNXic!22-&3=BNTJatAPU<V_JKJJLNPTVXTWX[ZXeVVWWVcUTVTRVVRWZfVWQLJHIH[IIHTHFTHX3HHCBCHIHBEFEFEEEFFcFEFIIJ•џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЖ%PLZKJIIIIHKIFIJIIFIdFFTFFFEFECEFFFTHECCFFJUX^^\\Z[Z\\\[\Z[[\[^\^^[^\^[[[ZWc^IA=>=<82B`VXi_^ZQI>><;85354;Ifni;@A@>CFFECCABEFJakg><;<8;;;<%\ZiP0668;;<>AA>>=>=@@=3heiI><;<>@>AEBCCB@ABBA'QccQE0A@@CEEECBECB>@<<0Nc[^F*<<<;;<8545300423)ajjRA%323//20/--*/**--eijjB-*-/*-)))'''')))#Jq^mW&&))')**)&))')'&'')deZ^Iщнr[{_^IiPVE>86;FpmWRV)40420000/0-//--!Cjcx^VE---//28AEFHHHHLRiNHWVZZVVVVVVWiXZ_j^^\Z\ZX[Z^^^\[Z\\ZZXZWXZ\XeXZZ\PFIhЂŸˆ‡БœА‚oULdm{‹Ѓ”Йœ';UWdT0KTFh™|ZA;cЊР‹ysVЈŽ‘ƒЙ||si`^fq|‚”Ђ26T[n)oZ;TV\^``eazg#!!%8V`fy))!!!!!!!!!#&@PXih&&%%%%#%'&%%%##%'JLUnw)''&&'')&)&'')'&*=I_dk@<))**™!-<*)**)NLadk&%**))-)))***''')!XPhc^*))'&&&)%)&#%'&&#NPWhf###%#%%!!#%%##=NVhm)&!!!#!%%б!!!6V_ce@/&!!!&)5[Rei5/!5%<@C*/-*cPZwP*)))-!RLWmi'22/*-0=AK^Hg™QUW>CKLKJWKKR_VcWWZWXXjVWWiWWVTUVUTVRRefVVRNKFHIFHHHEHIH5FCBCCQFBEEHCCFECCEHEFFHHFIJФџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЗQLKJJJHIIHIHIHJIFEJHFHIIFFFFCEECFFHFFECEHKVX\\\^[\\\ZZ\X^g[[^^^[[\_^^[[\ZXXTJ><<><;2EPWZ\^^dPH><8644444)F`[eHB@@@EHFEECBEHEJWj`<8;><6346Iae_E6566684664555454Hf[hC6556586858564454%@aZgL=44568888;8868666AaehN=4686;;<=>>===>=>/If\fI=;;<<=@@ABEBB@BABA2aXXPCAA@ABCEECPBA@=>==2[idQC<8;<;8666643000342feZZ=32/00200-//-***-#/ejr^@!--*/--**))))*))*^jhWI))*))))*'')'))''ApeXQ0PщйUHTahVPKJF'<)Zi^d\E&4333030/002/*/!'Q^{rWV//*-*-45@BEFFF;X‘^XVVWXZXVUXXWWWVWW[__^\\^\\\[^[\ZZZ\\[\\XZ[[\WZ[[Z[\^^HwЄЅЂe ™ŸŒo_\co}‰‘ЄГПj*PUiqP4JAЏ›V[C4NЗЏЃ›wt^=KRi\'’šŸš…ПˆnzdB_Zvq•‰ vPXnEWWQUWeXNctnL&#2E^\tI%%#####!#!####&&%%%##!!#%&%!!3TTXpA4/'2&%&%##&)'/[TZsL&'6&eyvŒA!-XPZw`%---)*!>NWia!!00--08BJRKyЈaVK@AVN_JIKNPRUXWWXXXXWXZeVFVTRT`RVTUTWZZU_PXFIFFFEEFIIHIJICCBFEFITHECFHECEFIHHIIHE0МџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџНQPPLJJIHIHFIJIIFIFHIHFFFTEEEEFEEFFFFFHHFHPaZ^^[^[\\[[[\\[\\[^^^[[^i^^[\\\ZX^IA<=<<;0F^VZ\h\cPE=85434456;JiZd4BA>AEHHFECFEECJW[_IEIHIFEAA<<;<436CHNcecB%666565556545444'LkfdB636685866666644660adaJ)544668868;8868862^egL<4658;<<=J=>=K>>@/JjjUF>;;;;;>>A@BPCBBBBB)cdjNA>>>@@BACEABN@@>==&RedP-;6;88886663332324Bg[aK)!2002000-/0-)--*!BatoQ#**=**)6**''*''-e^pVE-*02000//000020/Jj\WX>4yхЧZFKi[QNNLH/d\\UW=554242-02/0/0//6Jda{\`'!*----/24<>BCHJVv^[[WUWXXZVWVXXXVUWW[\\\Z[^[\\\ZZ\[\ZZZ\\^[Z[^^Z[[\\\\\\QLdpМ ””‹^B[_A–›‘БЧaHPWji<‡Ž{PE)B ЂЁЄŽ€vZ^T3NVjKUZn>2002-2=@JRHgQTXBALPPKJJLPUUWXXXWWXUdXZVVTTUTQTVXXUZWVUTNNJEIHFHFHHEHIHJFF3FIHCHEIHEFEFEEFHFFIFFIœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџДQPNNKKJIIHFIIIJJIIIIIHHFFFFFEECEFXFFEEFFFLa^^^^\Z\\[ZXZ[[\^[[^^\^^^[\^\[Z[ZTH><>==E!%R^X[\\[XPE854443246*JjZ^6BB@AEHFFEBBFF4KgmU5HIHFFECECA=8456išTZda/33455655854434r3%Lis^2%3555465465U3443#0ciiJ833354448684545!Bde`I%44444;8;;;;;<;<;/Lke^C'6688;<<<<=>=@>>==5dXWL0;;<><>>@>>>=<=;<)0kehP>6555856545433432&Eh[_J'2/02202/200000/2HsrvN#0000**)''&&'%358>5hm\RF5444CC665B6B44454&Zm[VK=;6Йяг‚&^^XRP`LEKpfXQC;654223220/0/--0dow`VE/*-/-//24I@@EIRZg[[XXWWWWWZZXXZZXVWXjXX\\[\\\[ZX[\Z\\\[\\^\[g_i\\\[^^^\^^PQ0ЁŠЄœУˆˆiEAar”ЂrВРjALTZk8­FJC*P•В”ЁЅ–oe^e5KQX\0šЂЁ™ЇzhPN_kw€–ˆsЁF'QWvERR^ACVgmc%&&%%##''%&&%&#%#%&###!%eTVpF'##%#%#%%!#%##!&[TXnF%4-%&&JJZRRXX;e­‰ДЏЙœ”z}’^I-!ANWjf--*)-*%;JTZmA02/-3IAKQVcwULCAW`NJJINPRVXWWZ[VWVTVUWXjVVVRUaWXVkWUVRNKIFHHIHFHIHHIHUITFCIIHEHHICEEEECHIFHIFJIœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџАBPPNLKJJIIFFHUJHHHFIIFECHHIIEHHCECBCHEHHHKaZ^^\X[[Z\^\\^\^^\[\^\\^i^\^[\ZZX^F><=<;8!%IRVX\^\VNA633243446-KihQ6CA>AEFECCBBHFCNX[THFJIHHHEHFA=8468'&Pid[/02268;F64434233Xd[P@54656445445555434AcieF&34465566668;646;Fe[eF;4545868;8;;;;;88*_cXQA8688;<===>>===>==>6hefJ@<==>>@@>>@>=><<<CIRcXZ^ZWXWWVVVZZXWXZ[XX[ZEZZZ[[ZZZZZZ\^[\\\\[\[ZZ^[^[[^ir^\\[^\Bp’ЁŠЁtwi\IdwšЉЦj%AAEPVf\8^05#3Ч˘‡ Ђ‹|ka`€W0PVeZWFXi>6ŸВШБ„q}xqkjmU`-AXWin-%*))*-6HUe}32//0*2R@FQU^cHNCAKPNJJJJQRWVTVZjWXXWVVVTURWVUVRVTUVVUVUQLJIHIHFHFHEHFFFF[IFHIHEFHFHEEFCBEFIHHEHIœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџИCPPLJIKKJIHFFFHHJHHFFFHFFHIJIIFHEHFFHFHFFNaW[\^XX^\[^\^^^^^\^\\\^^^^^^[\ZWWQF==<<;66TRV[^\[WL@43333465;/KWcQFCA@CFFFEBACHE2PhmR4FJIIHHHJZB@;8544/Pcd[0444;H<;55420433&Zid[04565556666634454E^cdF6365665668888856;EheeF8456588<;68<;886<*`cjN@66;88;<<=<=<>><=<=If[fI==<>>>>>=@>@<>=86*HfeUH;6885L56;866;6656'NaX\E6543223334443\434'[pjgE%2333*)&)26<>BAAIIAjncK/66;;;;;;8;66855460gZcPC8888;ZџЪЗ2mwUQP/ffZTJ*;6464224220/002_^rnc02//)***-0025NWnn%)&%&&&)))*)))*'RANgid)--*))*)*--***)--FPXpK%-)*--**----**'))XTegI))))'''&&&&&'&)*4HTmnC#&)&%%%&%&&#!&##[Rcg^&%&&%%%&!%#%!&'fUcg@UUXd}XКХТъШЧ“џAs[TXnCфбЏЮщk^kUL[V>V-!=LVZf>!'*)-&%ZTXw30/0-2P@IPWX_xWPE>UNJIJKKPTVXWVXZZWXXVVXUVVTRRUT_RQU`U`_RNIHIFHIJIHIHFFFEFHHEEHHFIERCEFCHFHFHHHHHœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџД#RPNNKJIHJIIHFEHIHIIIHEFEFFIIKIeFHFHFHFFI8PW[\^[^[[\[^^[^\\\^g^Z[\g\^i^\\XZWPF=<>>;6'JTV[^^\WLA4233045;;0PagP5B@@CFHFCBBFEE0PcmR3FIIIHHIJIFB>;533'ZddP)A@=8866845200433_dZ[>6465865644435433FdX^B&458688656658648)Ife^C;6586668888<;65682QZaN=66668;<<;;=/Ka[^F>;;;<==;><<<<8<86*IgeTF)66866666;;6;8865)_hXPA54443423323322334!^ij`3#3234-)&4;>@BN@CvPQkhV\=88EE666E886555438Jr[VK<54555РћРЄ\>\[`L=h\d^E#55644432322320Wjt`XK0-*-**-*-026=KV\^\^Z[XWXWWWXWXXWXZZZXZWZXXXX[ZXZZ\\[^ZZXZ\\^\ZZg\\\^^^[[[\^g[Z^WnœЁ‘sP^^iŸЊV*LhXg>5KVfm3)H‘Њ—œЄ–”š–y\`PdB2RXk%ˆЇ—€tiFJ\ck…‹‰@2Qeq;FIPei'%!%>Pinh##!!##!##!#!#4H_np='&%!!##!##%%#%#&';HUfp/'&&''&&')*)))))'>J`ek!!--)*)*)**-)*'**^PctX/**--)*)-*))-*'-WRdp\')))*)')''%'&&%-#HTZiR'''&%#%%&&&#&%&hQVg_&&''')#Й%'=H=Wh5zpgqzЊџџџџџџщџKL8XfJџџџЭВvZPXVPPH^3--8eUdpB!****-%IdXqE/00/0PAIPV\\^WPZ>UZLJJIJPUXrZZWVUHrWVVXVURRRPNQRNPPRRPQPLKHHHFHIHUJJHHZIHCCIHCFFICHHEHFHFCHFHIIFœџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџАCPPLIJIHFHJEFFFHIIIIFHFEEFFHHJHHHFHHFIHHIQVXZ[\\[g^\^^\^^ZeZXXWWXWe\\\[ZZ[WPE>=><<64222235;>2PhaNCC>>CFFFCBBCFE5NZiQ-IFFIFFIJECB=6234)`iiP8`tE866634B3/3424=PdhP/65566655654453446Heq\A8565868866456645%JfdcC&4668;8;6;66886562cdgK-466868;;;8<;<886;)Xgd^B;558;88868658556;-Ncj^E85668666;8;8;45454323022232434%exig0!2333325F@AAA@>>hRfm_F3222022032322032Nk[^I!/-///2ТвјўFpW4Re[WPB65654453344402!*d^t\e'!/*--//--//0&Cde^^\[^[XXZXVWWWVZdXZ[XZ[Z\[WWX[ZWZ[X[^p[X\\[Z\\X[XZX^h\\\^^\\\Z\\\A}}›vfHTnЁ­V*NV[Ps^HPXjU8“ЌГ˜˜™™ Єy[_Lc‹NVjAZЄ—{pe[XZQg‹znˆ|ƒa)PcrP5KNk;&-&*=Kajs)###!!!####!!!!#2FReoC'#%!#%&###!%#%%&4Fd[xE#&&'''&)*'*))'))%;IT[vB%*)-*)*-*--)**-ANVdk%--**-**)-***)'**PPWh^!**)'*))'''')''&)QRWpU&&&#%&%&%%&#&'&_PVhaALN)_Loђ>-Z[&sИ”yАЪџџџџџџšV@LvHX^[лџџџ__HUQKKJCA4-/&UUinE)*)*-RRdhH/00/!<@ENUe[ZVPE*^NN^KJLLTUXVVkW`VWkkgVTRPPNNLLNLPPLNNNKXKIIIHIHFJHHJFFFHIIHEHCXEFEHTFTHHEEFHJIIŸџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЌ#RPNNKIKJFFUHFEHFIHHHFECFFEFHIFFFFFFFHIIHJTXZ[[g\\\[\^\^\dWUQQPPPPRPUVVWVXZV\E>=<>84!8LTXZ[\fVK>302034;==2PcjN3A>ACFEFEB@BEB5^eiQHFHHHEFIIHBE>6344*`ZhCC}oF;686445204224)aekN/;658554644534344'Ifh\25586566468588546&Kai\26668888888666;666BgjfI=65865Q;686868;888)Zcc\A53546654444443444!ZdrRA;;66888865;6686883eZaX=5434324222000222#4gpiR>22002435<@@>865!dgfR@5232220/025444433'di[RA//-*--2ццЂCBg_2VjeRNC;6554654455430&IdpiWI-**-**----/3=Zdh\^[\h^Z[\XWVVWXWWW[XXXZX[ZZWXXXZXZXZZ[Z[[\^[[Z[WVX[m[[\\^\\^ZZ\\[^U‡ŸrfPckЊa0Pa[^L€ПHLVje4˜›Љ——›Ћ–Ž’€V_^W€В=U[[){ztn^IVZPg€€xy‹x‡k*KTdh0[[;'!B%'6FU[nA&!!!!!!!!#!####%AQ[tU#!#%##!!#!#%#%%%0C^[jI'&&'%%'*')***))*6HTdqE--)---/-****-*!@LUdj'-**)/**-***)**)*PPakg&*)))*')''*)'''*UPXk`)''&&'&&#&&&&'&ZPc[^8Jxn–wk‘…zz„’џZ%ef2™хџЌјџщџџњџь}pnJg3Zk[боиѓrk[RNKFFC>5**!UU[`R**)/*WQXoI2000#;AENUZ\\XQH*ZNPJJKINTeRf\m[fLLgPggXNNNKLKNLLNPNLKLKIJIHJIIIIHHHIEHCCFFHFHFCECTEFFFHHHFHJIHIЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЃQNLNJIIHJIIJHFHHFHFFEEHIIFFIHHFFHHHFJIIIKTXXZ[[[ZdZZdZXVQPNNLKKKZcW_/4C555544402223024)`ZdN>645654656665656584gZVJ;43433030220202335FqavP&43303356;<;<8666;EigeP-!33200-03356688552fjX_>0/--*--/oџЏhN6@)g[WQ^L@;585655554333)^nq\`0-0-**--**-/#If^^^L\\\\Z^\[XXXX[WXXZZXZXXXXXZVXZ[XX[eW[[[Z[[Z\XWWWXZ[X\^^[[\\\\Z[^\NQ‘fdt[#PWfPKfЌУBJNWk8pЅ’’˜˜в…{ˆqV^_X‚T#QZe!jЂ‚j[BWVNfn|p}skyo5JTds6EF%!8##!C^[{H'%!#!!!!#%!!##%!'>PZvg%%%#!#!&!!#%#%%&!A\ipK&&&''&)')**)*'*-5QPXiI#--)-)*-/*-*--/#=J`io>#*W---***-)6))**TLUck%-')*)))*))'%'''!TNWt^)')&&''&'&&')'8Bd\Z%ВЁ…›ДыџџџѓТ“oŒМџP[[4jЇ^ џыџћјџЛ|^Uv=U[ZЗБАˆj;UN8FEB@;3//^UiiT)B-*0QQciJ-20//6@0ZRV\[VRT%%[KNJIIIKg`IW@>=)#8)*>PRUJKJPJKPQPLLKLJIHIHFHIIIIFHFFFECCEFFHFFFFFFFEEFFFFHFIIЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЋBLZLKIHIIIIIIHFFHEFEEFHIIHHTFFFCEHHJHHIFJcTTUTRRRRQPPPNNLLJNNNJKIKJIJKJKLP^XE>=<<3[hpLB@@AEFFCBABCCC6^ZhNHFFFEEHHCACC@@/2X;TXhAUqP0T;43242220/2#-figK*6554454545433243;Lak`@6685686888684555-ZcjN/;;6888;8668685558Fhe_F<;;885F5;;86688568#ZXjX*22343432402002024/ddjN'5556664546565644&EheeI&23320020000/0202IjkkI#322204656588<=<8;8p^cW;333///2033556;866CheVW;0/--**)-0›џЙƒ[2Bk[VTVQL/86;;3444532&EhqpWH/0--0----/03Bd\^^^[^\^\\\\^[[Z[XX[[X[X[ZZWXZWXX[ZZVZXXXZ[[[[[[WZXXZ[[[\[^^^\\^\\Z\\^PhƒLdxR5Pa\^JsВ­Ž3F;5-/^RXg[)'--)[PXi^-00/05RCL_X\\dAI>TT[JcXWQA;!!#/0##8=L[LNP^R[LXJ_FIJJHHHIFHFHIEFRFFEBEHCEEEFFHEFIFTHFFF­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџІQPLJJJIIHHHHHIHHIIFFFEIFFFFEHHHFFHIIIFFEJ`PLJIFFHEBA0-3TKJKLJJJJJJJHJJKIKKLI><6E8B-2=NVZ^_hX^H;335438==>3\ZaKA>>AEFFCBAACCB6RXjN6HHFEEEFHBABB\`Pd>UZcAWr/5X<54540A22246B^WfJ;455554444333434!*Nch[*6548656866565565)ZcaJ>68566665688685658FeddF<6<88666888558664;0_XfK'200443030300/2/330eZaL*5544545634434434JieeF#///2---///-/-//2!LosmH%22222386555;<;<8*JkgWJ320202348f[UU/-**-<---0џПЛŠUdZRRkkRK/8;<6684432&Z\{gQ=20/*-/--00-&Pn_`^\\\\\\\\[[[Z\XWZX[WWXZZZZZZXXXZZZXXXXXZ[Z[X[[XZeZXXX\Z[[\Z^\Z\\\^\^^HyvP)8Paf^B^ЏЈpa6CLRdkЈŽ’‡eC\^hqЋЏ*K`ik//-)*''****)-)''NPaie=;/EIgo™dZ\>џџџџџџџџџџџq|‘‰џџ•ZgX'Рgaміџјњјџ№ €kcN8WeXЌЏ_kh5HFA@A@;80*cRdpV*-/)*!QQXiJ*///04\CJTXk[jTJ<VKL@>=>52/*/)-)#VjtQ&#P@P^NJ^JWHIJJVJIIIHIHHFFEEHHCFFECEFFFFIFHFCFIFIЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЌ/PNKJIJIHHFHIHHIHHHHEIFEFCBEFFFFHFFFIHEEFJ_IECAAA@A%55NJJ^ITHIIIRHRW@5202//'';XVX\^^ZQE834636;=<>4QigKB>@BCEEBA@BBCBF^ZgNFETHECCEFRFCBK“ic4_ZXAcX=[B545442222326CfZhH)4546454433434335=_ccP/8886568585555446-QdjL>86656688886;4655%IVdg4;;8668866656664445-dWhJ&0003223202220222#BcXfJ%4344545455343233#JjefA2/*---)**)/*)**/-#N\paC//*0/!K;6458;;W8Lmp`F>42253!6>@Thk}Šp{ELgiTF<4/*)****-0B јЫWjWQUZZUeJ>;;8;86434Ag^rUI&20-------//Uhia_^[XZ^\^_^\\^Z\XXXZXWWWX[ZZZ[ZWWXXXXZZ[ZWXZZ[X[[ZXWXWZWZ[[[Z^\[^[\[\^[[^ŒA8PW\[QmЈ•UIT**WKPW\K5Є•›‹ˆƒ’n`A\adzv™RPVh/^rZQKK>TaWXVVTN8C0BLVei-!#6IWfx&&#%!!#%#%##%!!%%'3F^dm@##%%%%&#%#%%&&%&&6IUdn-')'&)')**)')))-*!LPXih%//---*/--*-*----%FR[iF-*//*--*-**--)-/;K`egA**--*-***))**)*!@NV[d'*KN{‡В`iI8ŽџёJ^6#џџџў§џџўњџџђiЗњџЮ[[ZŸ`ВџыџџџџёЦA`h|@U\ZЗЛХkXWPICA>A@>60/\RWg\-0)*-VQciK--0003TALRW^Z[`K<&#/#&))*!fъџџџџџџџџџџєBRNJKJLJJJJJIUHHIHIHIFEFCEFEEFEECEEFEEHFHFIHH­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџšPLKKIIHEJHIIFEIHHEHFHFHFHEEHFEEFEIFHIFFFJaIBBB/'=as{TI50CBBALL>>><<50*&/*)&&=***-***-*)**-*--Nore00/***-/C855666565'ZekTB644445;=H_nx;!2!!#3XU[q@'#!##!!#%###%#%0CcdiF!&##%&&##'%#&'&%%8H^Zo@2)'&&)***))))-**>Ladd-///-/--**-/*-**-#FRZpJ/*--//--)--*=-/#'UTeiE-0-*---**-*---#*NcjWEmkЧЏИјгˆpœяџяџџZ^EџўџџўџџўњџЙМДЬ§џеW[ZДЄџџўјьђџг‰|_j€@Vffџџщ‘paIWAL@>=<;0-_QWg_%-//-NPWgW0!00-/8BJQVf^\UJB!0223!#44330ЮџџтоЧЈЋ“ЬМˆДъџџжA>[NLLJIJHKHFFHFCEEHEEFEEFREFFFCEEFFFETHFIIH­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ *PNKJHJIFJIHHIFCHFEFCCEFHFFFFEBBCTUFHFFFIKaHCE!=‹вџџџџѓмзччЫ>!#!2/-%X)&&&<_XX^`iZPE8688448<<>ANBN@@>>@K@4RZ`JBPBB@@AAA@>@>EFEE8dZf>PjXB644333433244%Eg[hF64546545542244204/PiaK*665666554465443%3_\aI*65;6558565644554)LgiP0556465655544434435AecUI!!44332223332322%En[_E3!4##66%544334##^kZ[/3//#00!0!/20!!0-#%Ppo^2!0!56%%5&65!`[oR0!#4688=-@C/>ANLC=&dZcN*33!333!3!hXRJ)-*)2'%%);832ZfyeJ#32!32Jk^`a`a_^^[^^`^^\^^\[\\\ZeXXXXWXZZWVWXVXXZXWZWWXZZXZZXXXXXX[Z[\ZZ[Z\[\^\[[X^mNNj^_Qf“[E8C[^mf`@PZe/mŽ™Žˆ}icVQCXp_`|p#KRca4JHCECCECHF@B>;;848-#AJ^V[\xWNE===@BCEECQC!ВџџЪиЫчйјлзщџџЄЇŸrУэџб8NNXIJJJIEHEHFBCEEFEHFHHCFFFFFFECEHHFFFHHI­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ)ALJIIIJIHHIHFFCHFFFFFHFFHFFHFHFEEIHHFFHIJ_6#rсџџцЭБПЏД€€ДауџџщŠ%886!6&55%5!-*A`XZ^^^[QE;55&&'6#0\[jJ>'))))---;'3ci`H#'/>))!))'--'<%Cdd`5'&)&;'8'''#!6%#!Ee[hE%68<<)=)8';8;8AedgK'!&8;;))88));'5!Aw|jI>'#);;**<<&***;%Xcd\-#';<&*-<*<=<));6!AcceI58>*;;<<@*;<;<;Fie_E&;>=->@CA/>>>><=<=>>><==@A<6ano_@@@@AA@AA@@ABA8!#cgkP&'>AABBBC2F4;063)eXqP2->ABBBECFCBCCE>PghTI%A)F6F6FEFHFC;#f^oWH#@BCCABEBEN&%ee^````__^^^`_\\\\h^Z\[[[[WXWWWZXWVVVXZVZ[XXXXWXXXWZZXXWXXX[[[Z\\\\\\\\ZZZ\^\f0_jHgnŒ}fJTC\|`[jjP@WjK5Јˆ€ng`XQNNPUEVXh;<@>>=<<653336APXyZ%)*#&%0@Pdz\&!%#!#%%%%&%#%'#->NXt^'#&'#%&%%%'%%&&'!CQciT-)))**)))**/---/;JUem22--//-*--***)*--CPXh`-/-/*=-**/*/2/--!TTZkK/0//!-254/y•*X[\џзџџџџџџџёС™йќџџL_Pџџџџџџџ§џЙп˜zЙчџџџZgjp‹чЫџџіуџЙч‰qxoˆ^F\j820HFFHIIIFHHJHU-LVWP&@CIJVLare%FN_X!2!EHQUZ\XWPIHTJL[QVWW}#PџџЏŒLeJyX'*!/эЂБЮџџz'LXIHI5FIHFFFTHFEHIFFHHCFFIFHFEHRCHIIFHHI­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ‘!NKKJIIIHEJHHHEFFFFFFIEFEHFFHFHIHEFHFFHIIKTiмџцЧВГЈЅТЫєўџџџяЛŸЦѕђz2BFIHFHIFEP>658F\VZ^_^ZRE=)=BEFE@8@aij='2CIHFHFFHEB;A^njJ-BHHIHHHHFIFEC<%CdZi;2BFHIIFIFFIIJHE=HfZfH)>CHHIIJJIIFJHP)#3cdgL03CEHFIIFHIHIJV;B_\cK/AEHIIIJJLIJLLKE'PhiQEBEHJKLNLJJLLLJIP8B^d`I&CILLJKLKLLLLKWF=&Ige`I&FWZLPPNN[PPNNZ=!hiZRHFWZNPPPNPZZPP[^B#0dioV'mhnPIIPRcRRRRdTTTUU[E3^jXNHHZaR^dTU_^^^T`E_XWR86^R^RTeU__V_cA&EjohR6IP^TRRR^Tc^3Li[\Pa_^__^_i^^\Z\\\^\\[Z[XXWXX[ZXXWWXXXWWZWWWVXXXWXXZZW[WWXWX[[Z[[\XZ[ZZXX^^^jTT[L„РX[BBZ…‚^TU_P>Tjewhz`XaPLIHJJKJ=^F2NgjL-<;;;6886865344224@NWcq5*%%#&=Ncma'%&%!##%##%#&%%&&Ж§јШМЛПнохѕљџџџѓД`FgkzЖџтL%5Pcefaa`TRLB;@HTX[[^^XPIECJ\UT^LI#)RicBPPRfWf`e__cLF2TjqL5H\_fVUUTr`_diFRE^ea>;LQU`g`__eV`iThH*Kgfa=IJPd`fV```V`fedF>5^[a@NxU___`Vh__VVVeC-EeZg><[RTfaaaWfWgXdph2-ZcZQ2[Q`acWXddccXcXr_*HeZg@LRVchhagaahkkcpeENX\WNPQjXdiZhhZjeihmI-#`XdUPRcdmidimddZieeoK#0VooVTXWm[n\f\[f\fejqP#-i^jCQU[off[efff\fghqK-Ed[WPPVde\\ffkf\^f[kZA!ihcQ2BW[j\f\^\m^moE%Ldr\BBVke\kjei[de'^dZNcdP\\\ZZ[ZZZZ[[\[\^ZZZ[ZZXWXXXWWWXZXUXXUZWWZXZZXX[XXZ[XXXXWWZZX[ZXZ[XVZ^^\gZ@`oЗИmKT<[€k^TNNPZKPhr8TVUQLJIFBCCBCCEFBBLWkP*;86555454433330--ZVp^)-*-))*)*-*)**)/5FUZrH-*----/*-*----*@PXd`&#//--/-///-/>///RTiZQ-ЋПдЗ‹eQC…џџ[^QџџџџџџџџџРЇД˜зџђџC^^џџџџџџўћџђЄД‡ѓўџџџ\^[™џўџџџћџќЊЇбЂƒ{\_HWZRCTf^^\_P^^^_PQIKEJUhTTZH)8h^aj`!ыџџџџџџџџџўєйл–Ђ|œдџз)PKKKJFFIIEFEUUEHHFFFFHHIFHHHIFHFFHIHHF­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЃNLKJHIFFFCFEFECEEHEEFFFCFFFFEIIHHFIFFFH'„лэнаПЙбмзСИБǘЅЂT/Rh`nšлў•)5Un^_i``^gI@AJU[Z^^_[QK8IRg^__\Rg-TdXFrZ[p_^\\^\e>x>6U[cA>8X^^^^\[\\\\iPTFe[X5WX\^_^^\\\[g^\`H'KkgdBQTV\^\\\^[^\\^cK'HofZ5Cn^\\\^\[[\^_^p;&8o[WCT^\^^^^^\[^^_`_a)2PXdR6t_^^_^^_a`^^PRkZ4-Ka\W8gva^^^^L[[^\\^^ZL&NcnW>Z\^^^^^[[^P`^^^T0\d[E>_dQ\^\[^[N^^^^_C';Wjo8\w`\P^c^^_ccQQP`V!cX0cZPVŸˆf_\^[[ZXXVWXXZ[[Z\^\\XX[WWZZWVWWXXWUVZXdVWZZZWZeZ[[XXdXXZXXf[XXWXXWXZ^^\[X8hИ‰QQ=QXtpZRKHHFUHKRmU8JJFCAE>@>=<<=>>@@K_cj-5554634424545@*##3IUjw8!J'%&&'8IUdn-''%%%&&&%&%%%%&&)%UVds'%)&)')'&)'%&'&%*0@NWk^#**)*)'*-*----)--4F^iiI///-//---0-**/-@PW[e>/--/-/0/--3002IPdX-3a—ыџџџђхЛqе–ЃџџџK^^џџџџџџ§џџЮЩ™Єзџјџ>\^џџџџџџџџџяДŸЖхє№џџP[kyќсџ§џњљџЧ€›…}•fAef836‰<KfdUN<&ЏЌFJXkLЈ№ўџW3EPV[^_kT­џџџџџџ!ЙџыдA-WAсџѕџђВX|МЅЊИноЪвЖ‰‹pИџЪ-IJIJHFCIHFEHIHFHCCFFHEHEFHIHFFFFHFJHHЋџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЄPLKKIKJFIHFHHFFEECFFHFFEHHFFFIFFFFFFFH5'eуыеРКЩЦЂ}hI*В’2Ua}„sРњ›&^`NHPL`g!#8NV\Vgd^ZRPQ82c\2Q^g/UmX@aeRVA>BRcZ<JfjZHwzUPFCCXLIICIQ^2*Kh\ZUc[aVAFCNPKJJUP`<=pgeE_hXJXRQQVWW^WdŒ=‘ŠojNPNVRNXPRNZkF%NX[J_‡w[R[PZXPVXQ^Ika6ddXIЄoVdeLRNXLffWi‚a30ip`BŽˆjUVWgfgfhffh^{q&4Zh[=eЃoXfeiXhzRjR\q“H#Lg[V[ojm|jhhgjk[rš^*5edWE`—qRi\m|j€pn•z'/_^iHЄ›|gffgwaUvЗ>Ng[`wа–f^ZX[ZXXXVWZXXZZ[[[Z\[XXeZXWWWXZWXWXUZZXVWXZWVWXXXXWWWWV[WZXZZ[\ZXZ[[\gXV[\zЇZKUPRf`RNHCA@BCCIPhf5BCA>>=<;;;68;;<;>ITXmC6434654434655/#CTev@!#%E'&&&&!HRdt>#&%%&&&&''&&'%%''4TUdt>!-&)''''')'')'&*/=LVhc*))*))-*<--*----#C^ZaK!0///0/00/0---)/AZcnk@00//002202!&FXg[>6yЁŒ‘‚r“ƒzˆ“z’КЪQ5PceW_gЈЂw–ƒˆ…‘š”|ХЂ[3UZXLzЃ“qp…€z”’}‘|€Њ’JC[pjLw˜‚yˆ€y}zˆŠЄЄUPZm[[q™”ŠzŽ‡q“}‘•ˆ­ШEPPWZW^xšЋ‚|™…Є”„Œ•„ЄО^L=fZUWRŸЪˆ‘‰’Ђrœ–ДaNKWnn<€mЉ‹onx‹|j”–t^\kXfCPXXXXX[[[XZXX[XWXZXZZXZXXZXXVWXXZXVXUXXXXWWZZXXXXWX[XXXWZZ[[Z\^[Z\\^^\XXX[`c_XRPNPKJECB><<>>BFPXr;*>><;;;654585865<5^cnF855666466888I#-B\ZrF%&K&&%''0ERcmB!&&&&&%&&%&'&&&&)!EdXp@)&))&'')'''''C)-;WUim&-*****-*/*<'---/!C^ZjL0/--0-/-*0//-->ехзгЛЅˆya^WT€ХђхидЬл№џя™rxv‚ƒzn­ђm-JУЛЮъчВЄŒUXUŒД[Q[Hw|Nџіщлџѓ=Ue[^cЛјЯзЧШахаРзЛ>=VfZVE™ипИхЯАУЏЩТТМЅ‚WPWjZXKЃ ЬздРОЙ­ЩЏ­ОЬj;>gjWP;xϘЙУиЈЏТКККБЦˆ‚>W\[ZPŒЗЙВЅЄ­ЉЄИ™ЮЯн™U@V[ZHKŒАз­œЈБ•ЋЄзШТЈ}UVXeTcTЧЏЖАРЂŸ’ЈЅЊ”ЋŒДzQPh\XVIhБЄАˆ‡–“…—ŠЮъОaPQZeVX^Г“™”ŒЁЖ—ЃЌЏл–qCW[XE\iЁˆ‰‡‰Š‘™…ˆ…Л‘XC[`_H[d‹ˆ}ˆ„{„os™Д`UQX[ZV^r‰™zˆ|„y‡ˆ€sƒ™ˆ8N^djVW\i€pynnzˆzz{‡Œ;ILfZXRWf™r€€po}op‘”5INX`^@ZN{‡vsxgƒFBt\[^^^XWWWZXZZXZW[ZXXXZXWZkZ[ZZWdWWVWXWWXXZWWVZWWWVWXZXXXZXWX[[f[[XZ[Z\^^\^\\ZZ[[^\RNKNKVHCB<=<<68=@FPapK><;<686546588886=EQWoK&5;;;8<<=>I5&0@NXpZ&)F&&%#%/APXnH)''%&'&&&%'&%&''3B^dhF')''&))''''&)''-8J`ek)/-***-/-*)**-*-*EQXqW#//-///-//0/00/@<`Uj`F'/'%#EZўџC!Z^Бџўџџџў§њџъАЭ=›џџџ@^^јџџўџјјыЩ‘‰айџјџ'^_Рџ§ўџўџџјЄ‡ˆсџ§ѕџџ>\\ЅџџџљјяџОŽА‚‹„}/Zf@5'xJUXW3;kfp/LWk[/#'ajA##\sasvv^qeeXeri)@@`[ZRVeiR8Pjtr}oXpan[zzrPANR[eTP0fp_Xsc_n`Upaoka5KNh\WQ=Hr_m^jhhtgjm\qQ'LRd[V=8Kgyji\^j^i^Vme3AAW[ZP=C`deeccdXeddda\!-AkahA@;[`Ta`_a`dTadcF)PmgWP6C_UdPRR`UeVed`B2PXeVP>V^^aR`cTP`Ue\4/NWZV@><\NQ^^Q^^^\43Ng„hC=2V^^^^P\eAVp[[[Z[JXXXZZ[ZZXW[ZXXXWXWZZZ[XXXWWXWXWVWXWWWVWXZWVVXZWWXX[ZZZZX[[ZZ\Z[^\^[Z\ZVZWXXa>HHX0FB><8;86668>>@AABNH2%8KXqe![XiU)''''&&&'&'&&'&*0B\XoH*'')')&'&))'))--5HVnmA0--**-))**)--/*/!CQXc^%/--/00//0-000//2*LVeXA*=AF>\aVRUUacUIPX5&5NWecP2>\QF``PT`PP^Z@'BNaiVK8LW\^NHLPPP\^\P)-;U[XP;8V^\\^^^PPNLX@%/L`[c>8=TLLP^\N[JL_^E&3Q[jT;/PXZP\\K^\[\N[T-/LkZVLF8`[\[\ZLKXZ\ZR4QddTJ6@BV@;5445568<@IRjc4=;6634556;=<<>@ABLWh[&AACFIJURV3)%!%4^amj&H0&&&''->hWge'&''')'')'''''''A[c`U))''))'*)*-'-)//4RUdgA----*--/-/-**--APchc&0//t#//0000/!%LTeZ'JE{ЏхъџџџџыАТ№џџ\\^rџњџўћћџњџЂЄvзўђџ;^^хџџђјўхщУŠ‹Ёйёўяџ*[^˜џџ§ќќўфКх– ЭџєђџџC[f‚џљјўќіЧВЏ˜˜‚„„)VeVL84KRUTTATERCQQP##Iecd5ECFFIeXT6CCC=#!5>JQVXJkZ^C5%&&јлј§V@E6<ЧфЙ;џџј=>5NUL%)#HeZVK/0JRUTRTTRL2*KWjaJ/3ITTTUUTTTTQH>))LWegJ4EKQTTURRRRRQI--KWZeJ2CI[QRRRQQRPPJ/'&I_daNAA5NRRTQRPPQPH'&&I`eaK-ACNPPPPQPPQQL2''BRnjQ0@AHPPTRQRPPNPNC&=NXe_HA2ENPRQ^QPPPPL@#6@[WdR5@0ILNPPPNLPN^E)4%If\hNA>AIVLNWLKLWVTC6#)JnmvN2AAR[VLWWLV\[R>54'ZemWJ@@ARU[_\\^^W_R<%%>[ZnTFAAE[Zge^XZPNI>5!*XcwTJAACLE@>CFE5%&\^jf5<0)6E<@B;)oZXUXZXZ[X[Z[ZZ[[[Z[XXXWXXZXZXXZUXVWZWXWXXVVUVXXXXWXWWWWXWZXXWXZWXZ[[Z\\^^\XZ[XVVVVdI'8HRjd5@=664488=@ABBCFE)NVZ^)BEHJQQ^Q<0'%'%i'2HVZk!!!'=-'&&&)#`Xj\'-)****6-*))**/%F^XmB/---*----=-**//0>Nadd-0000/02!#%*B0CT/ae[мџџџџџџџџзССзмиџџ‰^^Pџџџџџџџъл‘PmОотџ8^hЄџџы§ъсЧУp›ЇПсџђџBZg^џљјўісжТДЁЋЙгїзјџ<[f}џјлџыжЄœ…Ž„qmwz)W[V#!#-2''/)#IUcc2@>8!02'I_aQ3;<8335P/IQXZW^XRE#%)'4яДђЫ#CE—џаџ'€мo}™ЗŒŠQw˜qšЊЧŒЄЧЉ ЙџŽKHIHIIIFECFFCEHEFFFFBFHFFEEFFFZHFI­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ PLLKKIJIFHHHHHHEEFEEFEFFFCFFIIFFII5'ЄђлЧх z‘€”щЮЖЯажлнпмЧдгдаЮЧКЈџџ’PV|tЦч!520223;JU\^_^^ZP4/=<-AFA&6'5*IVjVI-<@FKLNLNNKIE=54VFEFFEFCC>54%@RjjP08;655NcjUF<=>@BEFFIECHC>644/ZVh\A88;>@A@>>@>@=620%Hf\gK<556<>==<<;;>63//&IeqtL&445&8<;;><654#/0)Xem`32!344#5&%&&%450`[eUC;##*>BCC<654-NWeTF&6)J”Ї|ggfzogZFT^qVQRdht{_pz\cUiZVWVWZZWXX[[Z[XZXXXXXdXXXXXXXXdWXXWWWXVUWXWWVXXWXXWUWWWXWXXXXXXVWZVZ[f[^g[WWXWWXVXgH6=A@@A<856568<*AFQVm4>=6568>ABFIILLPW8KUip8BIN^eo\>0*&&'-a!!0FUdm_XhW-*)))))))**)--0/4CQXgF/-)**--*//0---*0=NWka@#!3!%%-ACI;8<<*IemeIBBUCHEFFC>856;I_deE;8)-IJKK;JFB>&J`[eHFa\\!3!200*%;J`mf0//02!32!!!3000%FTdiI!32444444%5643238If[fF865556%666%553324A\ZmP-54658;;;;8';=6555###%#!##'885&-\[f_H40)%%/23%<;;565-XXmTE!33j ‘LPQ_iRL*T\hJWozf‹kmq‰•po^fZVWWWZXZ[\Z[X[ZZZZX[WXWXXVXXXWXXXWVWUWVVWWVVXWWWXXWUVVVWUWZWVWXZXWXXZXZXZZVWVXWVUUVN'8=@EB;666;==BBC6PVqKB<85;>CK_PPQUW`^''&&&&#0QgZk=%##%#)*P*'''')*8KWqm)*)*)))')&'))))''%KUZTF)3JLPE=;4;IŠœхпV\PџјџџјџЩљЗ™™Јšщїў…Z\HъЙГРМ›Уns}Tp\‡wšЧ35[^[УП€У­x‡•zh{Štу@6Zf30щЈСГЙВУЅЂ›™ˆЉz‡ЅXA\\/U­ЈЉ“О‡ЄЏizˆsi/XZHВЮЅЇ­ЙˆВsŒgЈšЁ!;\UhRF-00-0=JTg`A!23235=X3IPX_aЧcV['%%ђжСщ-a^@ЉџИџџyО™Џ™ЏЋŽ€™ˆ–zz‚ЙvC‹ХРЏЇШџ-HFIFTFEFIHEF–6FCFEFBEFFFEEFFFIFIIЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ”NKKJIFIFHHFIIFHHEEFEEEECEEHHFH[HIKьЧжбК…wzWМхЭЯжзжимес№џйввзЮйШЏ§џџœI|cƒф”&!#!!FR[^`a_XP4BBA;>AB@<8685)F_ddC658E^PPPIIIFB/)-J`e_'3eyz&)''')'''&&#I`da-!'*''*)*)*)***)-!CTihE--/---/-02000/2&I`kiF23202003/2/00023/`diN&34345556656665444*KWeeE86655556655666545>_ZdP2220-0-/--/****-EhefE*)**'*)))))-'))*IipjF***''*'&0**%%%&&\dfgA%!!!#&ZЦJV85=>B\ef_HK62C'/2224685665'Nc[TF22%Z€3<35PQP2UmmHzdgQsƒz{˜…fEXWWXWWXWX[X[ZWZZ\XX[Z[ZXZWXWXWWWX[ZWWZWWVWXUWVWXWVXXZZXXVVVVVWXXXXVXXVWXXjZVVVZXWVUW`_2=PEE=88;>EHKNJ8PaaNEC=;>CKPVXZZ\n[TN<^Xh2JPRcf>#'&&#'%!!#E^ZxA&%%%&&%)0T&')'))&6KVia<&'')*'')'')'')''%=NZdZ#-**))&)*')-)*/-/!CQdoI0-/*/-0///0/0/0-LVdWcPQT@HBW[Pz•д›меџХW\^џмђуѕјЃбП’–ŸЖЧо‚V[NБŸ˜ˆ„qЄgn}Uhox}…ЊK>[k3RЈŸ‚Џ™„Ђ„Œ}_|n|ЙQ5Z\CЧЁОšЌ„ЂЈ™ ‘X‡„Œ[BXn*TЋ|š˜œ—{‘y™‚oxŠ'VdXЄЄЂАa›|š‹nŸЁВ‘24445;F56;„‘`amHc%'<ќРмО5Vs_тУИџџxАˆДœОЌЈ‰|ŒЗˆ‡`fЙаŒ0аЛВ—Рџ{IJFEFHFIIFF6I6FECBBQEEEHEHHEIHHHHЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџRJKJIJHFFHFFHHFHFHEEFCEFIHEHFHIHI@ЛщамуУ|vŠУХЯмъизЬезЯЯ§лвЮЭЫЫШЙиџџы=trƒвц%!##!W_f_``^XN4BB@<;;6468%H^c^353KUUTQPPKKFECB0Jane55LV‚!!&''%&&&&)'!Tidd<*)'))'''))*)*))*2BcdhC!-*-*-*---*-//-/#F`\oC#-0//-/0/0/-/00/2-_dk^34434466455546345*LaedB64443444445554435)Zdm_*30/0/--0--*-*---3FUeiF)*---)'))')'')))IjqwI'''*''')B/&#&%%&\Xge@&!!!&#ƒA&6PNCRZ\_H=530/03034466664NXe_C#022“c*/)Pd\3`^nFXvhr„ˆ„˜zgKXXXXXZZWZZZZ[Z[Z[[[ZX[ZVXXXdVUWVXWZWXXWVWXXVVWVVZXZXZXXWXUXcVXVVWXZXWWWWXXWXXVWXWUWXZz\->EE[@==EHRVX[^kariUL*RUh3KTpa>###!!!#%#BRZmB'#%''''-2K*&'))**5J_Zj-%)')*))**))*))**-;Ncm_%%*)--&Ž*'**))-*-!CQX`K!0--/0/0/00002&;BLViJL38W‰p‹ОЮџніјјџџХV[\з№осЮяЖŠЁh`ij}‘˜Ž^ceZ&Ђœ”ƒ‹^fJdiorgƒe5e[;^ЃЈ…Ѓ“p}…ˆydU}‘k8Z[IРЄЈЄЛŸ™q”ˆ‘‚q{yVHZ[;VЮ‘‘w”Њ–…Ј˜Ѓ‡s|t{3WXWЉ’–АКwŒŒЛŒЊЖ|=W_XdE!0--*0@Kda`@33545;ZЃ4\4-2^jf&—ўнУЧ`Xo{ПqЯџџЁУvЊsƒˆЏПz„ƒkЅОЏnœоЏОсыЙJIJHHFFHFFEEFHECCEECFEEEFFEIHHHFI­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ†NKKJHJHFFIFHHHFEEEHIFFFFHFHFFHHII-)лмШЧтДygˆЮгажзжоодежЭУхгЯЭЩЧУВГџџдWa“бџ#!!%!QU[^^`^XNCCA><>NB><65545;H_cfB&f\[XXaRQPKIJF4LWeV#****)*-)----*))%;XXdi*--**--%-*-****-/3E\WfV#//00//00258;@EJJJPUZLJ–Щ‘МјЅЌ–жГЭлХојЭW\^ЧнЦЙЪ­ЈrWopwzU‚˜V[X4•pŠ–ˆ…znhQKQfkqŽU4X[>FŸ‹Žˆ‰Ї‚‰|gqrdx–Z>ZfA!аВЁЏˆˆ‡š…wdˆcAXi3TЈvЅœ­wŽvˆЄ|„h3WXX—Ђ‰ЂŸtŒr•y„Ќ‡ˆ!055658@HQ^„Дm`hCеіТмуЌZoˆˆ{џџааzŸdv…xŒŒ…„ƒ‹ЊЇСV™ЬСхЭїмACA>'*Ffa^E/ABBBA@>843558IUdmC;'Ppnm^^fVURPQZJ5KUd_8KNN[_V\PA@84!&%F_da<&'&'&')'')&')'*)!Bc[oE)**)))*--****/*B^[hB!-/-----'-/0///-0*^Xha02202020422222030#JVjg353333200200023032%!!!##)0HL;0e\o^<&##%'-0232588886-ah\fE0233##tRKLRˆ^&Vnv6^f@e•‹—ЄcT\\XXWXXWXZX\\^XZ\ZXZWZXXXZXXWWXZWVVUWVXWWWWXVWXXXXTVUUVVWVVUVVVVUXVVVXUUVVcXWVWWWVUWZ`dX-0FCF_LRWcˆvsˆ#>UgRFFBFIR^whghsdakPH8RihPNk<&!%'/>`cmE!%&))))/4H''****)5FUdkA!**'))-*)***--)--8Kgii=#*--)---*--**--/4A[Wi^%0/053!%;>CIK6%4d;8W[FCђйџšУџЊ|jАЃ•›ЈАиЌVk[ЏВЅ–yzfsKjRo|[‹”„!X\Z2’Œ™‡ƒŒ{wUc\L^^emŒc4ZjB3Љ—‡xˆ…„t{wscoXq„g>ZjXט™™В™Њ—Зi|\qA}c=XZ3JŸ€™|ББ–•Є‹™ˆ…n‡|4XWdДЃ—ВnЂЈ­ЂšyЄ‚ !A2VUt’Зscr^…wъфеоэџxp•ŠzсџџџЃАЄЄš}m ŠghPШзт!UРСЬЮЯъі=IFFFHHIFHHFEEEHHHEFFFCBFFIFEIHKJЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџd)NLLKIIFIHFFEFFHFEFEFFFHFFCCEFECFIyцсЪвЬ“s…}€ИоцжевадддоеЧвлЯЮзЦСТЙїќЛЊКЉСџВ)&'XeZ_`aiXLBA>BAAB>>;54342'HhedC*fzsdd`P^^^d`RJ*J_Z`;NPLPQPZNf\faP@=%H_ic@')&'''&&))'''))'!Bc[oE'**)***-*-)*/**2A^dnC2--**)**-*0-**-*/&Xch^0///0000/00000200!I`jgB#00000//0/2202/2!)Xci[&00**-0)**/--*-*)FefoF**))''&))'')))))Ec`sH)*3';''*)A&#R%%&6\cgq@&##%!#%&&#*ZekR*%!!!%033688<<6KXffF%220323rcLTzQ&_^p/ˆzvjs‹yxЅva\ZXZX[[ZZZ[\^[XX[\X[\ZZWVXWWWXWXVWVVWXVWVWXXWZWVWXUUWWUVWWXVUWVVVXVXWVVWUTTXVWXVXWWWZc…Œ^F/ENV^H^w™ƒ}0@TgR6CEINX`eijkvz`VKC6QZcNF6%!!%)#>[c_Q#&'***/BA)''***)4RUimA!)))*))-)*-**)-)/8KVZa-#---*-*/-*-*//20!A\WgN#'<@@BEI>80346%>ZHI>QxrNJ_t‚џђйм№џОK™™=БЦџџ|œЉЋЁ™ЖЂiŠЦОеERпУвђзамё>JIFEFFHIHHHFFEFECHEFCFHFHHIEHHKIЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџb&PLLIIHHFFFIFIFEFEFFEFFFFEFEEEECC8zтгсеЭŒsŠ‰vИзсгаЯаджжжгЭЪЮЭОЪЯТТЪщЮЊˆАбЯжўл#))%%RU[^`_^ZPB@=<<@BPA>’ˆzedeeqptZXRP8KVZf0/)&##'0448;;<;&JWffH!232224g\8NrP!Ugm-je•ƒ…œР‘}‡Ђ[P\ZZ\\Z\[Z[\[\Z[XZ[WX[ZZXXXZZXWWVWXVWXWXWVVVWcVVVWVVWWUWVUUUVTUXVVWVVUVWWVVUVVUTXXXWdIK ‡k'6/P\Œpr…‘–8=UaQFFILR\oskxmkf[RHB5aZjX!#!!#&)#>`aeR&'*-*--I2)'))**-#FUigC-)))*)*))*)*')*-;KgZa>0-**/---*--/-//0BjZjPWIIVJI3;ZJq}Ђ›ДЈЧТZf;џ—№‘›Гn’ŽxМŠˆŸXfe…”Ї™ˆ„|rf`^`ej`d}ƒ&VZf%s›z…t`Š[drNL^dZmc@Z[A=ˆˆzЃ…—…JxXwgt€z)d[JЩˆ˜››Жœ“‚Œ…am‘rv`FXi-LЂ–s˜™ˆ—ƒ}…w{„'UXcГ’Рœ™Ѓ„ЏnЌŽ\ёˆЌ*XUddH4/0/-BNVa[>202466>X5HPKvnЙKCJŸ—џљыэнъєC„Ёv4jџџыЏ™Šj„š™€‘ihЉЯœЙ–џіјџнвіё>JIHTHHHFCFIHIFEFFFHFFEEHEHFUIJJKЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџb&dNLLJJFFFFIIHEFEFFFIFHFEEFFIHHEHJ#‹оимгЯy–™q‘лмЮЬЭЮаджмбЩЙШцМбШУЗЩШВЌ{Бмхф§ђ')#%R_[^_a_XNB><<;ACB>=@ABA@=853455'FUmT0Q•nghkmxzhcPLZV8LVj`4NRTTQQRPNPLJ;45FCIVj`IP<;%*)''**))))#>\ZoE)))**)-)*-*)*)*0AadhC-*'))*'**-/-**/-%`Xi_)/-/////--00-//*23%HUem3!0-0-0/0-*//-0-//%Wcni&/-*)-**/***/*-*-Cd[jE**))'))')&&'&)'*BapfI)*''')'')/)%%!%&IapoB'###!!!!#WZmfF400/**23386;;K`efH&322223%c_IALPso}ЖДЅ Ѓ‚e^CџŒйz—jx[vk[tz‰V\exЊŽ|ˆw‹se^\cekezj'W[\*‘wЂ„”Zƒqga@TX_rrd=Z[H4™ЅЋ_‡sŠ}ЄZ„Žjoh‘{-[\LмŸЈœŸЏ›œ’€‘sQ{RFX[65ША‘ЏЄ–•—ЈЈЉ’ЃЈЏ˜UdWА‘š­šЉš›‹Ђ‘dЯ[—-gaX^C/0/-BP`Wd/203468@^IJ^X^Cf`^Š2љіђх№ъе€Њx™ИЙУџџДШntt‘oŠtЏп—щ…iчефџџсЩул;FJHHHHIHHEEHFHEFHHFEFRFIFFEHUIII­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџl*PNKKKIIFFFFFECFFFEFFHFFFFEHFJJIH<%”иРХЯД‰m˜ ^XбвШЫШШЬобгнДИЙмЖШгТВЭпКmДищч§ў*)'%3HT[^aa_ZLA<;;=BCA@<@BBB><554455)F_dm5Wy\Tk|trkVddxrn@>VZg4RWZWWTWWQQQKHJHE3IVea;^^^^P=8%!%-))))#@adrF*)**-))**--)*)-!>\XmE)))))*)***-)**--'KcmP&/*-*-/*0///----//IffhC#20/-/0///////0/0)Wcei&#*-))**-*-**---*ETfpH'''*'''')'))''))Ais|L))'3&))'*B)'%%&)H`gjE'#%!#!!!###!!3\XmaH&433=&&/334;;;J_[iH!0002225EWH4[r%Rgh%‰‡ИЗŸzЇœ`Q[^\\\[^Z\\[^^^^^\[\[XZZXXXeWXZZVWWVXUWZVXUIeUVVRTVUTUWWUWUUWXXWWXWWTUWUVUUUTVUVWZVWZCm‚ˆЋšŽС@8Ђƒ‚t™C6Va^4HKR^etkjjha[PKC>BPWfZ###%)#AahhH&&)*-)0I0'**-))*#FeigC)'***)-*-**)*-*-6KVXdE-*-///02#6;AEIWX2TXd-d[thxzzmh’Г­ŸбВЮтk\^=џЃР…y^PXWs_‡z‰‡V[Z!xЦvŽŒƒ“sgQIWEwq„ƒrW[Z™“‰Ѓro`aX^^ePg‡˜^)[eB6ЈЅ”}ˆwr­ŽgvcƒЏn[yEйšЊЊЄ–›ЉУДŒ‡\d=je%HъЭ‹ЏŽš™›ЁдъђЦXeXЂšŒ  ›ЖХ yЏ’œ=XTX^F/--/CLfVd@203586>\Z>hZ_md^\mјїђѓ№циГ^_…xџџ—фЯЮК^t€‡ЖЉвЖ럘ЛжзьџеосязLIHIFFHFHFFFEHCHHEFBEBCHFEFBHFFIJЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџj2NLLJIIJHIHHHFEHHEFHFEEEHFFHHHHIIK#ˆЮОТжПy’šJМдЯЮТДТзЯтлЪЧЦлХХУВГѓњЇŠƒМфѓяџџ))&&3TTZ^``iZNA<88=BCC@<;4^de8AABBA@<656428)IUie52kqjz‚„Ž{mhkktp^AL_df6Pj\\\X[ZXVR\LLJH3;`ej4ZQPcfPKIXC<&30%&>adiH''*')-'*'*&)*)*2@`ZnC*)*)****-*-****-6Wgdd<#--/*/-*--/00-/0/#F`ooC40/0/-///*-/*////'^ad`U^HJWR\q5rƒ”™Џ‘Ž‡›RN[\\^^^[^^\\^\\\\[Z\[f\[XWXZXVXWWUVVWUVWVWWXŒJVaWVVUUVUUVVWWVVWVUWXXVVUTVVVUTVVUVXXHZ[\qџіС›Ђh­‰‘В‘ЏЬўџсX[ZЃЂ™ЁБЂ  œƒ8Š™Љ=^addH#20/0X\aW[@004;;/eZLTXJa^Z{ђјф№фђДЌБ…aјџџяЮзЬїЈБ‘ЈШфџЧќџџ—Љцлхћам№јВLJIHHIFHFHFFEFFEECCEBCCECFFCFHJJI­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџa%NNJJIIIIHFEFFFECEEEEFHFHFHFFFHIJK!ЯЧПЯЛАˆ˜‹`0ЂъТЪОЅœЦзщаоЦУЧЙЇОЗлџџЊf’Язяј§эB*)&4Z^Z^^`^ZPB<88;)ERheH@ABB@>8555846%HTm`/Ais}r‡wdnknzie^A;UWW4a[^^_^\[^[TRRPLKCI`[a3K_QUgWiVe^ZVF@)6-\dfI)))))--)*'))))-0=`hqF!-*')')-)*/-**)**6K`ia'/*-**/*----/-----#F_[hE-/-P/---*-0----/Kadd&#--*-----**-=---BdfqJ)*)*)')'))''*)')#@e_mZ-*)')''&)=)''%&&!E_\tH#%!#!!#%!%!!&4Ha^hI;4234/%*02046<8C^ZhL%3203/028JgI;L*QXn2q­‘‘ЈŽЄz‹_P\^^[[\\^^\^^\\^^^X[Z\ZWWXXWZWWVWUUXWUWWWWXIJ„WUUVWVUVWUWVTUTUXVTTUVVVVUVUUVUVVVTWZVXE‡ЏŒЄ‰Ї–T`fŒв€[›3>T`P8JPXc{\ktce^TH>6#/[cj^&!'#&&#%&'/@\ijV#''&---4N0***)*--4FhdUR/***---**)*---/#8V`cTI%*APRIL@)%'3\pЙV[^ЂвЏОЖ‹š”ЄИ˜_л”гъџ{\tJЮЗ™Ј‡fqNix‡šЃŽОбV\fŽё›ъЈЄ„xUdo™ŸИДЧцБW\[ясЫЮ Є‰–o” ЉВШвзџn[k4EџэЦ€€ƒИРыгјхУўщџ‡[^=џщ№ЄЌšŸОђјўљэс p“i@ZZdџЯПЏАЂЁЃЅЊЂЧсљџџX[WЛЖЊœ Ђ–Ђ‹­nˆЂ”>gVd_F0--*EPaWiA3043;=*[J=TV^^^[Wz<40-`cga###%&&%&&&-@\dpJ%)''*--4L-))**)-*#T`iUR-/**)*--/---*/0LfXT^iZPPP6%0HK_™іђџX^^зјћџџъд™ЛАЮ‹нждыёz^mfџъзпЏР‡sK\‚™ОоЪхђLh^КџЭѓПЏnm…дЙвыбџл[^LџџЬзЈ™“’‰КЩЧфяищџ‚Z\!6џоа|ЂЮоџхяђчџяџˆ^n8џјхОВДЧѕџяњџщд|j–j@ZZzџгРЇГАЄЄЉЃСсјіџџ[\dЈЋ‹ŸЂ˜КЇОœŸHР&XVi_R0//0VPccP>!224;<@THLV[[Z^XXz'yџђчььБ„РТ)[RџџџџџљєУ№џџџџџџџџџџфчспниту„JJJFIFFIEFFHXECAEEEFCFEFFEFCFFHHF­џџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџa)PLNJHIIHFHFEEFEHCEHFFFFFEFEIIJIIH*PИОКТЧоЧЪЊЂˆЊАДЊЙЙКЩЯУЭЧЖсјзцџџџџš8фёђєџС/))'';JQW^``^VZB<8;>BPB=<*CRX`IABBBL;6566;86#Eg[a4Vjek_moqrqrrcjfqT2V[g-TZ`_PP`ve^[^^WVP;6Uea>HHKLQRRTVWVV`eUdP/QWjN*30/-*))))****'%=cXfI*)))))*)---*)**-I_ia/#-*-0--////------A^ZrF#/---/--/**-P****%Jpkt)/-*-0*)-****-)-*>`ZrW*)')')))'')*')'-/=c^q\*))''))*)2/)''&*!@cfiK&&##!!!!!!!#%'F5EVhjL3302/'%<2L258;%>P[n\/30/0//0%HP4@*iX`a'#&&)'&&%&#>`XW^&*''-//3H*))*))-*%H`dUR-////--/--/00'NaZV[PH2*2nrphАЩџёџџџ;^^џџџџџўџГŽ{ЊОуйлъџ›^m2џџўлЩЧŠvHe’ЇВїчфџ[xiнџуяКЂwsƒ…ЇоЬтіоџй^r^џџща­’‚œ—фџѓђіьѓџf^g#PџмЫЂ–СолѕћћџјњѕџŒ^^3џїуЊ “фђ№џњўэОtw­W;Z\ЁџьСВЇЄЇЈœЄЪяџќџџZ\dЌЩЂЃЙАБЈЄЁЇ€ПРЈ=^Vd_F00>0QPcq[=2324;=0e8LWjX\ZXXq)§џхтёЫœЌš08ЈџџџџЮџџџџџџџџџџџЉЇѕмгоѓвђщД=/JIIFFIEFFFECCCCFCEFEEFFFEFEEFFFHJЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџYCLKJJIHHHFFCFFHFFFFFFFHFFFEFHHHFK=EВЖПЩдЫЧЭОЃЏ}‚ЄЌДА—ЇЖЄЊУЮщщџџџџџџЖhzЯьяјџ%**)-;<>BCB>K=0^mWKBCBA=888555;68H^da8W_enrrvr‚vŽŽzzwU=Vea6Teo`achthdddm`^VN=_jkLJLLPQQPQUWTTURTin*PWjNA>QQ=6530/-/**)*#=_cj\***)-**'***)-**-#HUif/!-/-0/-----0*--/-A\[pJ/-0/-)-0/-2>----%Ja^p*!-----**-*--****2=`ZrX/-))**)'')*))))*/*\nxf&*)'***'**0/&)))'#>\\sN)&&%!#%#%%#&-45Cd\wP=403/'!)35334665-Xkj^A40000/0%Hq;K…64Xh\=hs…Єvƒ€ŠšC___^[\^\\\^__^Z[\[ZfZXZVXZZXWWZVWXVXWWVVWXWWWWVRTUWWWWVUVXWVTWXWZ[ZVXXVWWXZWWWZkX[^PEŸ™ЌАООX[\5VhУДŠƒQVgP=T^sznkT66663446)CTdg8V_hq‰ˆrsfxxxojeW3`Zh>PVPceijnjhhem`jR3TZcAJLP^UQQPRTTRUUETPPXqPFHEHRWPB@>;8332/=NchW!-*'*)-*--****---C^mo0!-*---*-)/--/--)*2A\jkJ%//*---/--*-//0--IVnnB--*--***--*'**/!=_Zm_#***))))))))))'))-)_frh)#*))**)*-/=*)-)*!=[fP*&&'&%%%##&%%)2550\[tP>400*%!)>34533348edgZ#!!&**)'&&!Aec`W'/*--/23A-**--*/-&J_cTT//0/!BLmzeTr4EcZ)gџџџѕџеПАеОя№џљџџџP^^џџ§ьњЂЂЄvОсмсщчџ|^_0џћљбсtx_Ž™лмѓяїџN^^џыехЉ‘|ДЯЮ№элћџоZ\Eџън˘ЂsУдтяящыыыџz^^IџУЖБЃШмџяђіџєѓђџšn^AџуЧЇЈП№јѕџљџыŸmvЪRB[[ џЮМŒ™ЅЅ™ВБсџџџџл\[VЂЅЂЄ‘Ѓ“ЈО­œ‚ЌЏš-aUZdC#0002F^WV^'22268=2^6\WZ[\WWzX##&^ј§эђўЯ˜ЇЋЃ@qџјџџџџџџџџџџџёРовзосѓцгЛƒKIIIHFHHFHFFEBCFBACBCECEEEEEBHIHHHЌџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџl8TNKJHIHIIIFFFHFFHHEHFFEHFHHHHHFHII4v•РЧаЮсдхщуЪЄ–щџџџџхХЁШмџџџџџўџї Џяьъуџё))/228IQX^^_icKA<=>@BBB=<8556444;;E^[h/Xdko…sppqtvspni[)`fh8R[crhmon^^hidR_fP/RZqPNPQTVE@QRRRRUUWWf8PXkQK__KJKLKIFCECA><<0NWka-)*)'*))*)-**)/*CRdgA0*//*--------/-/-0@QerJ!/---****-*=-/00/#HTZoE!/----**)**'*-*-0<^Ze`**)**))****'6***&&K[no0#-*))*))*/E*)-*--;N[p^)*))*'''&&&&&&*224>_[x^'#--)#&EA34455335)FUeoH%0000*05I[hŠxTfh-Ÿj{zz|”z‡rmVP_`_^^\\\^`_\Z[X[ZZ[ZZXXVXXXWXWjXXVWWVVXZVWWUWaTRTUUWXWWVUVXWXVVXWXXdXZXXZZ[[XZZ[^^KXЮТ–ЊД€#[[K%Аˆ3ДГ…RVVQCoxmk\4'/''%!%@tZ`a!#!!'')''&/AcX`W)/**/2052**)-*--/6JUcUU>CJ_`\W4'Bš2Z^ŒџјячљныЂтъџџјћџџџQ^^ќџјудЂЌ}™ОЯпяўщџy^^#&џэщдМ—iXhšЄЩзпфџџN\_џљцУ™šs‡ЗЧгыхщђџи\[EџїШЈ“Џ“ОоолъээјјџV[miџВЅЂЈЯјяѓ§їѕѕџђџˆ^^PџхЋ­–йыћєјјщЧЂsŒыH2ZfДџОЈРЉЧ‘ЏВщёџєџтZ\WЋПЄЅЈОЈВЦ•ˆ—ЈЋŸ@XWZgF#2030[RWfN>2045;<@o0PXZZZ[IqF'#%вџьѕѓяХp– Epџєьћџџџџџџџўџƒ™вцЦЩысънтЯJ8JIJHIHHHFFFBBECCCFBCCBCCBCCEFHHEHFАџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ[->LJIHHIFIHIHFFHFIFFFFFCFFEFFIHIIIH-QˆОвжЯдлђэёэуР›ћџџџџџџџџџџџџўџљђы™Азпъхџ‘!)*2208E^X^`a_ZNBA@>@BBB===2PXjLCAAA<546;E545;C^eh6fy{otrq\swgvqot‘r*U[iAhsy|nprznkgec_ZR3^dhPNQQXeneWRCTTCTVWg3PWiR/HHJLNPQQQNPJJEEP&Lgk`'20//-)*-)-*--)*)!B^inB***--*-/*----0--!=PjmX#00/--*--/--/*-//#FTeoF4-0-///*-**-**)/-'LWsj*%*-**))')-*)*-)*-IcnoA))***-**-P*)**-*#^evd>!))**)**'&''&-034*KZvd=#&'##B@4323423568ER[hK'200//0#IIcjh‚!QZn2y^…yx„x€t0‘[`__^^^^^^^^[WVXXZXXeXXXWWWXZXXZVXUWWcVUXXVVVVVVUVVUWXXWVUcVWVVVWXZWVXXWXWZWZXXZ\[^[8jУДЏГЫ\5^[;8Пи&‘œЂVaUPPTTNC-#-*'%#!&CgZ_d#%#!))*)&!EfXV\80*-023A0*))*---0'K_VTP%KPf_UFF/6|аўџџL6Zqџћџџџџъ•аољїџџџџџL^[љџі§ЩДЃ‚Џнщіє§ёџ‚^^!Pџ§хоЈ€hdКОыхѕьїџ\\\§џъж”ƒ”ПРЬсяхщыџыZ^IџјТА ЌХзєџћћялэџZ\gzџ›ЃЂУиќ§єє§§ѕћђџz[hrџуЈОЇчъџўџџлД›y‚ї@8[ZМџпЂИЊ­З’уъљђџџ§^fW ШСЈЇЇ‘ЈЄГƒtРП@NVZdB40200XQWfN&20348;@^/PVe\\XWvC%%&'LхіџэњџЮ‹ЇCАџ№ѕњўўџџїџўќџ|“ЄчыэпмзуŒ4JHHIIFHHFFEBECCEFBECCFEQFFEEFEFFIFНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџG&PLKJIJHHHJIFFFEFEECFFHHFFHFFFHHHII=6}ЏХжбисђхсчјсЅЈџџџџџџџџџјјјџџўџѓЃКфђђіџ))/@0#8HPV^`a_[P4CB@@BAB><;866685656C^[hPTXZo^\[ZVWUVVVg3NWzT;IFIJLQ^`aXWUNQ[\%JVZ\3=865420/----****!@QmoF-**---/-*-//-/-*-;XXn[0-/**--///---/0-#CT[sE0-02/*/-***)***-!UWjo)#-)*'*'*))*)*)*-)#HghqC-)***-***F-*)*)-VZniB)---*/)*))&&**-/6KaohB%&!!)-//022326866AQdmZ&0/0//!!n@djgpNi^N™ˆ}mxts;vxqU`^^^j^^^^\IVWXWZZZXXZXWXXXXZZZWWVVUWVWVWXXVVUcXVUVVXXVVWWXWWWVXX[WWZZXXZXXZZZ[[Z\_5ŠаБЏДщ8N\f&[њъvQ— `WUPJH@<#2/)'%!!##QdWRZ%!%**'&E^hUV'/--032A2))--)-*#;V_VFcfocNE5/F‡Сєџџџџџ5Z\іџџџџџўъ•отўўџјџџџJ[^џџїхзЏ‘—ŸЄзфсцщчџU[^cџ№ЯЬЂtUaƒРЧњмёхёџ[g^џјъЮЄ‰™ЅЗущцыьъјџж\\E§фОЂ“БР№чущьџќјџџ\^\џВЂЖняќџѕђѓђђё№џ[\gtџнЏТЯнџў§џџу™–qЙџB%jZУыЛАЌ˜ѓ’Уџџџџџџ‘ZgXдЛЃЂЃЧДЁЧКŸЋ”САPA`XigE#02/0e^ZWN*32345;C^5QW[ZX[Z„!/'%%'ЯяхуьыьВŽЂ’щэхљќўя№џџџџ§џiŠИчљуя№хыЬ&KKIJIEHIIHEFCFFEFCECCEHFCECRCFFEEHFНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџY6PNKKKJUHIHIFFFEFFFHCEFFHHFEEHHHHIHI0ZЂУТЯя№эьтпазвЙВџџџџџ§яяцяяяэмаЪЪЙлс№џ•''/=/*4PPVZ^``eP3EB@@CCA=;=<>J=86530/-->PZrF**/-/-----//*---/'LhnaA20---*---//0-/-/3ER[tV00-00-***-*)/--0I`[m0#**))**)**'**-*)-3F`hvI*-))**)--H2*))--%IgnkH--//---**%#'%&)'!HV\pE&#%''&))*046685@PWnc03220/)Fkn!;Wh\@qЙŽ‘qApВЙ=`^_^^__^gXVWXWXZZZWZXVWVWWXXWXVXWVVXWUVVWVVVVVVUUWVUWWTVVWWXVWXZX[WWXZWXVZXZXZZ[__HЫХлЧКЏ^^XЁсЯГ8‹P`WUc-85/*)''#!XeaQW%)**)3F_XU^!/-*000H0*****/)NVaE`pRNW‰ЁЬЪсўџџџџџџџ<[[џџџџџџтщЗџџўџџџџџџZ[ZџџўъмЋЄтєўџџџџџa)\\џџ§аЉ}zЮїђџџџџџџX\ZџџлЖЈŒПжыџџџѕџџџџЫZ\B8џџѓТРя№џџџџџџџџџџ`/g[БџзУчїџџџџџџџџџџџq*X[&šџќмфџџџџџџџџгЬЮєџE@[WсџжзсйЉ№фьџџџџџџБZnW2езггЫЭуУЗџЈПЛГлC\hXcB#20//WRZvN&42445APahP4BN<88L5688888APXh<[vfhnztvtwwsq`rn*UXhEUf\Pcfk_`orqcomzq&PciQNQTXX[\\a`_\^^\\f3PVc_8KLLN[QQPRCVWZZdhK=UZf8JTECBEHHFEB><<63>PXpJ%-/*/*-/C*-0/---*/8Kaef#2/--/-**/--/-0-/A\emW/-///*//-***--**#I_fwA-*))****-*-**)-*BUh{K-*-*--*-%K4-**)-#Cf^[`00/0///6'!!!!-%&#B^k|H'!!!#!%##%-356566_WXa24452C^X’P!'6%>EHcWX\\ZXd!---!vЫй№ћїчжѓџџџџџџџџџџџџџљџхђђсщудбот6KIHHFCCHCFEHFIFFEFEEEEEFEECCCCEFHFFHМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџMNLKKK2ZcqL#----*-----*-=0-26Ifjk*0-/-0*//-///----=PejP/--*-------**-)-3F^fzE-))**)****-**-)-3@cgxP---**--**I52/0/-3Bgmo[433330/'#!)=PZvK!!!!!)2355656;BQ[kK/)!Z’Xzšah\R\qC€|t`5˜t|“ЃЃIf^a`^`a_fWWWWZVZZXWZZUVZXWXVXXXWWVVVUVWXUZWWWTVVVVUVVVUUVUVVWVWWVZXZZXZV[\\[^\___\c‚‹’Йn;[ZV6’|xzs*<;&ZaWP*>8*'!W[[WXW&RZZE2V^\)CekURWdQUddQ4`ZaPPVW^5'#!''%))%##0#*-LUh\B-@BE>A\WXK2@ELH-8CHRWZZ[XTmE<<;>@AЁВуѕяіблџџџџџџџџџџџџіђіјћћќъдОЮЖU%LLJJHHIHBCEFFEHFEHFEECCEECFCEFHEHEFFHНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџZ*PL5RreJFEHFHFFCFIIHHFFEFFHHEREEHHFHI;„уУХЯлщёє№оЮТЧП—Šйфпяѕџџџџ§ўџџџћхџЯ-&')&&%!UPW[__kgQH@)88;<)86%'LacP%)8!56'#68!#3A[XkN*#/%`„‚||*RZvRThX\_dfi}noppjkip-NceV@RRTWX\\_ceedamcpQ>Udf@[NLNNcTVVVZfg\\VKJTdg2ZPLJJKNNPRQTRNXKH'PWtP<32/-/--/-/-*--/-0&IVjg020/----/--/--/*E0=Zdsi&///*---*----**/-AaXsF*-)**--*-*---//-0=P\pa&//)----**5C33442!>Qkm^*443342<%!##;Ndtd!)/@2445568@PXm`*0)e˜m…oNZhPKzRszpЈЇ!Ug^^\`i^JWXWXWXXZeWXXWWXXXXWXWVWXWWVWUWVXVWZWVVTWTUWWWVWUWVTVXWXWX\\\[\\\z_\^^_^nWX[XRZ`gQB<<=>>=>>====N4#;aWUPA)>@>@A@AB@ABCPT=!%^WWPC=@ECEEECEFFFFIF'-PW`L)-;-/-4#0''!_ZVB#'23</B2I>VdV>*;PQRPPQPATFFAPaccRPvLPPPRQQRTRERRP'JhnPKfcRF5X^eH)/dcfK4Lmzna6=JRZZ[XhRQIJILcPQP­јЛй№џџџјўєчъєѓѕѕѕяъмщщцяъЦЦх­^3JLJIHIIECCEHECHHEHHEBFEEECFCBFEHEEHEFНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџSCA\…vPHEIFFHFFFFFHFFFFEEFFFFFEHIIHIII/ЖцГЧвлтхяђхЦЧЮХ‘еџџџџџўўўўўџјђсџјR%)<;863/-CLVZ[`j\Q6>&%-0@A/)!Laq\0-@>@ABBAAC>�[XcP'F6IJ6<==8;26nhz%PX[RQVWXZa`di{ihjkkxz4Pa[`5R`RRVWX\`cccawdoW0aXaPJJ^WddWaWWXXde[fI&F^XUN>QXeZ\[ddeZejeZUJJ=`Z`5LQW[\X[jZj\\f[o&J^WWT0&Pa[Z\\^n^^^^ffIJX^XB@`e\h^[\[\\ggmfn3#PdZT8;EKTVZ^`\UIHCFWPPP^HB!KVdU;FHc\^RP\Q`^E>CPXkRKXLfV```V`f_)}mj}2PijV8VXTX^_agfhWdfheg6@WeW2dVTTRRWZ^`aa__`jX0RZg5PRQQQQUX\[X\[`^tT3Tdk>NTRPPNLPTRRRT_RPZ4KVvUHEA<8;654644300--04ETen0F0--/*--//--//-/0;KXfo)0/-0/****-**-*-/@ZcqX-'-**)----//--/-0'JXmf2//--/---3C234853;KhgiE8654A-!!0EU^zF'!%&')-)'))'*'*6I_fpC'%&!aЄ›˜ƒ^g’VP\nBPgovxs&Jc3i^__XWVXXWWVXXWWVXWZXXWXUXXWWWWXWWXWWVUVWWWWWUVUWWWXUTaUUVWVUVWWWZ^^\g[^Z\ZZ[\^\FVkkt5#PcdTLKRiXpU3iVUN5QVWjXhZidZiZdoCCkX_L;QiWdidZXZiiZe[fL*/`aWP5QW[hh\f\\eZ[[^q;E4fZkQQUW^Nn^\Z\^^^__^PJeXV8UZ^ccd`E__QQPKa\QC0#**40*E5)f;_XXC<=>03&'T2;QWcU'B>PZVWU&#X&WjXW5C#cw“a8-I_X^Z[UV656џџъŸлнсьъптяъосяяущЯЖП§џЯTLKJHJIFFIIHEFBBCECCFCCEBEFCBFFHEEFTFHFEМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџU'qzW@KJFHHEFFFHEFFHFECEFFFHFCEECECEHJII>QзџЪЙЯзыѕќѓщЯЂџџўџџџџџџџїцяџџЙ|^ndkhgfZgIAAHNTi\_^gUKJNQX\g^i6H#J`eX8PRh[f\je\[VN\4\cdRARRZ\^\\[h^d}Šp|3PXkVAjUUX^dgiZXefed`gB;Vja6TaTPABTVZ^^`^^cpU#RZj5QUTVUUZg``P^^^`^V/RZhPQ`URPLPRUWXWVICT^6JUi`8JHHABA>==;<8E5432BQdrF-/-**--/-//-//008Kakh-20-//-///*-//)--2<^Urd%/*--*)-*-*-//---/6IVmpE/-//00//3C434644;Ig^qJ;544=!'>P[{W##%#%#%!#%%%##0B\Z|V#!!}Ј“„fƒrʁPXn^a“qŸ“v)JRgHJi^[ZZWXWZZZZWVVXWZZWWVXXWWVWVZWZXWWVVVWWWVVWTVUVTVVVUVUVVWWVUVWWWZZXXZZZXXZWZJ^PF^^U&3cdWT6A\\^e6IfURA6В`PLZ\PF^L^RRkJIhVU6)W\\K^LPKKLHIPJ^>53^VVI[UKIeK4H=JP_KKU5Q2UZW'PENKLƒEEHNLNgМ™•ЙˆЋДЧРГЬйџ&PgXA^ЌолџобтуВгјђаџџџ_PWcIgЧтџџх%fXW™ъџџџД<*K`Z^\jUT*Сџњўџџџџџџ№œџџџмЩРаЪлаоымлЬО—Жџџœ%'VRKIIJKJHHEIHXFCACECCFECFRHFEBQEFFEHHFFFHНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџl[{HAKKIFFFFFHIHFFFFHFEEFFHFEACFFFFFFHHIJ3IнџхЏЏСйыяђьелџџќ§џџџўѕё№џџіyЁОЂŒrjeVcc`;)5JNTX^`_^V=PR=agRHfTUKUfwWz^JCJCBCKJ^QUVhWWXXi‰vrc`c^`&QXh8QzXVTPQRUWZho``_d<=_Zf4PPNLJUIFBC@)<;<888CQdsJ!00-/--/*--*-///08F`mrB00//--/0-**/*/-#ŠyIoj5K`dWEZ_ZC`ˆ%PeTA[zm^\eNUigggi_‚L`WQX{€ZiZhhmghih€rZIIgXVI p‹{pw˜‹znŸwko‹ЗŒQ@`XWHмŠ}‘Оœ˜—–”•Š‚Џчg6PaVTK„хЋКšВЌВДКОВТбъЫA&RhZE\џсСЬЮЪУЯ№ЖьъџяЇ3`XX@z^ЖлЙусъДџлмџёойL%QZ\VIЖщћїј№эџЧџчнџэџџ)^ZZ5ŽџџџјЌђџОмџџжџвџы)8_X[N™Мђџјњьмџї§љџџџџ6dZWCdьџџџџџџџџџџмџџџљKeXc8ЦтѕџџџџџџџџџџџџJ%RWV=Œџтџџџџџџџџџџџџџџ&QWX>UЪјџџс6^XXмџџџџƒ#E3LU\\ZjFC3ъџџџџџџџџџџџџ™ŒъџџјзлЈЙК›ЙЙОџџџћx6;KXVTLKHIIIJHFEEE3CFEECFFEEFEEFE2EEEEFFHHHEHЛџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ|A@A>Q^ma*'!!!4TTkv>#4T`koEџА”РŽЙВpЏsQZiPgštIed[>aРA\ZWWXXZZWXW[XWXZXVXVWZWZXXXZXXZ[WXWWWXWZWWXZWWWZWXcVTVUaVVUUWWUUXZUVVVXXWX[XAЫŸ^фќXKPcXU6zˆ‘Чвš85QaVEr|›Вˆ˜€œ• ˆšПЖ33PjURHoЋЊЅ‡Žšš—™™˜“Єн[#KVcU=‹yЂ–ЅЈЈДЄ|ŽzyЋХ_*QWWU`ГЁŸ…ƒ›Ј ŸЁ”ƒzОо4ICIP2A;3NoQLUZWHaKV3A0)33^c‡J_WV)cP0-2)#C)‡JQaXC-%X‹FQccEA2[ЉInXVVWЖŽВCCZWZ^^[UT6&0H=N\X’Шџџџџџџџџџџи_)'B\IVUQL^KLKIFIFFHECHHICCECEEECECEECCEEEFFIEBHМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ^BLNKIIHIHHHFHFHHFHHHHHEFFFHHFFHHCFHFCFI<^WI0ЪџџџџоЯИМРЩзаЯЬањџџџВsƒЃ ЬКЋЄЬУУГИЭоВ—ƒRPTX\_a_XTr^WШжЮЩфц“%NVdZJAЄтбъжЙЧедЧО[8Ls[U>pВаУмЙЛДбЧјCˆv‚L8Xkd2ZZX\Z[Z^adfddddoU'e\i;UXWVUQQTX^_aa`co^PWmRPgXdWUTTU[n^`ovxn'LViRLIPJPR>PEAXPKK_V`A=6JNLFNHCFH`L`4BPWhR>48XZJN^JNILN_Um6BPcXP84JsqH^cV4X5`^8>ALWg^ZkVQN>>33WZZZLN^NLL\NHTJAHPœПХВ”gC3>*@f[XTTRLJKXNLIJJJHIHHHHHEFCERFEEFEECREBEFEHEFEНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ\LVNKKIIKKIFHFHIHEFHHHHFEHHHHHHFFHEFHHHHJKTUZ[0)жџџџџџџџџџџџџьУsk•ЧтЯтЭЩЖЪКОблЧУЂŽ{UQTZ\^aiXBgWC…ИЛДЩЧŽ8KRZXU6…Њ‚€pmz}{‚ƒ68KVZV83}vgvhc_zz…ƒ™tzI-UfeCh\[ZWVZ[___dddc`h2QZvFVWWTPPPPV[^a`cepz-LXmU8W[ZVRRUVUZ^^`cfv5=TZW2its`\^^^^medg|if\T[i@@=844540333204B\[vP%0---/20/**-/0/*/4C^[sH//->-/--------000;JXpo-0--//-/-/J5000/-/8Jk^o@#'KP[wo%;LWtX0Д”ЙіЃ’›™ЄЉЉБP%T\nXBdc[KPšЄВ@jXWXXXWZZWZZZXWXWZXZ[XXWXW[XZXX[ZXVWXZWXXWWVXWZWXWXWUTUWVUTVVWWW[WWXUVUUTW^^an^=*NqXcP>R\Pj63PaXTNAW\_`P^^P\\^\^P!JhWUPLPX\^^LL^PPP^\\Z-5\WWRL;CZJ\\PNJP^P^\W'4\WWQN5F^JLLL[ZI[[J[V5^VVPL>PWHL\^CLZJJK\`6gdWP<8CXZXWK[HK[L[Z<#NgdVNK5V\IZKHWXZKKZNC^ZXQLL@UVWKXXZXWZ[X>Fi\XQK50NXZ\^ZUfNHHFFKTQRRUURRUXVFEAE<&56/4@NTX[^``XQP853[qWs^B8IRZhP2;Ujc;yqeVefpcaaPgxedqPinBH^dd^NWTRQPNPPPRT`;LWfi6HHIFC@A><52434345>NWja3//-/00/-/-*-/-/2>[XtN0-0-//--//--/-*/0%HVhqE-0---///N4//---/4EUgqT&&6Jcok#2RT[m%ЭџЄДГЏЅЈЗЙ ™•ВTWVUTUUUWTTJ##!NgWTP5;PTUUVXWWXKKKU32cXVR503TIH>>=AB_BJU-C^WVP;85TIJ=>>85;5IC!F^aTP=-;CH@6;6666<54H`[hP*;0R545-8/'#*PXZU5'&65*&%%0eXXQ'*3jZXANhXW3UVVUTUV^E'=KUZgK54NQTUU>UHH6tm‡Š_5VfjBW[\[VQUUfh^__Rdrd)QWmRAd[XVTUVZ[\_owssq6@`da8a[i_[VVURTWXN`aqR4_[d3jhhi‚{gdd`otcPfwx!PXkU8qaata[[ZTQPTTPPVmKKV[a4NP`NLK[FB=886566&>Lajk-50020000/-----*/2_dgqn\^\XTV`QNQU_P-Teh6RnRPPQPKKTCB>K<><>JW\e084542322/--/**--#;\Wek)!--*--0/--/*-///0!@P[s[///--/0#6843200-%6Lckt)!!*AQZ{`6IU[`Љ­ГЄЃ­Ё ‘ВœъЄQdhkQB*IœгjQPANfˆFVXZXVWXX[XeZWXZZVX\[WdZWXXXXVZdVVUXUWVhVVXZXWXXVUVVVVUVUVXXVVTUdWXWXWLIPQd83>KTi\W;d^^H56QPgZW-wXKKЃV^Q!_XXAejk`wmnTfj•лжђџџјРX[XџџяхзџџџџъџтзщящџЙXZK0идГаИђѕєџџџџџџџџџЙ*WZVBЮРЄЂИЫјђџџџџџџџџџД/iZXFЈ€„–нсјџџџџџџџџџџ#XeZ6—ЗЖЂЛъџџџџџџџџџџџџ[\XМнћљџџџџџџџџџџџџџЯ\^Lђъџџџџџџџџџџџџџџџ\>[f3CџџџџџџџџџџџџџџџџЊ[[Kџџџџџџџџџтєџџџџџџd/Z[>WсЄГЋгќџџџџ№љОнВТUiX—аЭыфЧХеХеЯоЯеЭhЄI^cUK5532!ALiWaC%30446>P)[U\\\cPLP>EFHFJHJQQRTUaTTQTUVVTTRT_URTUVFCUWiWUTPNIJFIFIIFHHCFFFFEEEEEFECHHFEEHFEBFFEEEFМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ&;HZh^LKKIHIJIHHFFFHFFHFFFHHHFFEFHFHHIFJKQUUUWVUVUWTUVUUWUTWUUUURURUTRRRPPPP^PHB>8634=IPUZ^`^ZNFA>ABAA===>CQcaL@;<<@@A#A>>#-R<_ecChaVWcWX_wpmfjnr|a#R[sHW^^[VUUWVVX^wt_^m2PWeX=o^^^ZZWXZ^i`fii„V=Veh;Z^_^\ZfZXVWZ[`arW0TZk2^znyjijkrT\^^^Rr–C@VkX0q{gfnP^^[^fU>RTWUN0Q[sECVUEUgRPPKJICFBEE2Ifmp4)%664542000-----/6J_jmB2//*-/0//0//-/-*-3`/aW\^\WPKB@FEHFFILQRPQUTU`QT_/WVUTTQQRQhvkUUW[WVePZKIIHITEFFFHFFHFEEEFFFFCHIHBBFECEFEFEFCМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ&\^ULKKKIIHIIIHHFFHFFFHFFFFFFFBEHHHHIIIIPUTUXXWUVUUVTUTRRPRURRRQRUTRQQRQPPPLF-8544/3;>ACEPckN#8888<<;>==><2Nv8R[[m`ygf``i_\`gm„…o€‹%P[kIV^_^XVQRTRV[\^_koBLV^n-X\^hZWVTRUVK_cemZ%RdiFX^k`kjh^ZVWUXXZ[p'QhiHIpmoyZigga\K[`dfyf)Q[j4iqgfjiegraPZXWWWUN4NXoWCfn^XWVWTTPPLJJJFE*QZrNEEBAA=;865442//00!BPZqL#/0222A3345C44564F)ERfzJ/---/0/34---*)*''`РЄЏЮОВъ…[\\=6щŠЛ•Ž‡ 2V[\A'ЮŸЮ§щхљЁзџJ{џTzјџH[ZZW{ŸWm_ŒГЙУЪХжлъпуъџ=[WƒщАŸ­УвфссссслЩВмџ\f[/vЄ„ЅГУозхыссщооъцџF\X4jzЂГдЮочмнсфхцхџ§[\XŒЁЄВЯуыоЙђящъъъјџ[^\=6Хмцтчщщъыыјьььэќџ6\\aљмљы№ђѓѓєћѓёђђџѓџN^^–џўјљћќ§§ќњјыђњџџ5_^iџљџљіџ№еЮЯйуы№єџџI^[}аЂйЦэџџђіъŽЫЁ•ЇXXXДГЈМЇЧЗмВнŽРЖЮРЏPWXnJ#4423^RWgZ/4433362g8_[\ZZVNJLA^^NKHJLRQWTTXWUWXWF[JUTTVHXXWcVVUXVZXV@KIIVHIIFEEHFFEHFEEEHHCEECCECFFFCCEHHFFFМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ:Z[A@PKKJJKIIJIFHHHHHFFEHHFFHEEHFFHCEEECEHN_UWVWVVVXWURVTTRRRTRTUTRTT`RRQRQPPNF;5543-/8CNUW\^`fQFC>@AA><=ACBLWh\2;86<;<==<=)`‚#Ud[APohŠcNZ\^afj{p\\z2PWkXE^`_XUUQQRVXW^p`^P3T[‚2Xi_^KZXVVVTW^^``c'PXeTH^```_^[fHUUTUX^r2NVeV@‰zjjjgqcL^p_oh|s)R[jCW`gxykwvgvchVUUUQL4KVfZ=t`\[ZZdVTUPPNKJFE)PdjT8HXECAA>=H68302/0!ANXs`2-02204456686886<#!%;KVnv>!Œ4PU[^E”…˜x‰—ПЊJXJ&LW\_L3F06vЏ™zZmjXw[[[XXXZZWZ[XWZZf[XZXWWVVZVXVVUUTVVXVWW[[[[WXWVVVVVWWVWVWUVUUVWXXE2ЂеЖВЪйЈH\\K&ˆвЏwЁˆЁn!dZX&gЩЌтњыџџЃ™™P‚џ\KИЏWZXi{“Зџџџџџќћћ§џјєяџџ\\X&ƒ}^kwЂВОбЪфлемчп§џNZWЄВЏЈЫЪуыяпыцяогйщъZ[WˆŸЁЭСсмумщЧпбнчнщј[fZ5oiŠЊЦЪглнгофхђщхџЭ\\F!š ЗЧУл§чђпхъъыъјџ-^Z*CпѓђђђѓьыъъыэїјњџџP^\Šџэъяёђѓѕђщѓџѕњьыџ\_^вџѓџћџ§ќ§ўќџїѓящџL`[‘џїџџяйЮбМШсџўѕџџџ^h[{УЃХлџќџ§пмАЌ“ЏЏXXVЈГГЬДДДТЃДд™­ВтА”QW[eI'3422hTXgN-43/23;C_3TjZg[UPIAPHJcLILPRUVWVXdUZXXXVoeXVXkk[XZVVUZkXZaPXIJIJHHFFFEFE^HEFBCEEHEFCECAECEFEEEFHFEМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ&8ANLNKJJIIIHFEFFHFFHHFHFEEHCEHIEFFHFFEFEFK^TXVZXWX\XVVWVUTTUUTUVUVUTVURQRRPQPF<4643*%6B^UZ\aq^PEB@@A@=8>AB3LUha3;8;;<<===='w™-PXdVPc[haBXWZ^ezj}„hy<=ckWEnk^XWVTTQQTUX^^pT3Q[[2jpa\Z^ZVUUWZ\i_`q'NXsU=m`adm\\fZUTTVW^}=;V[X-ommokPVdpaJeo`dPeoH;ajp€qo\hf`^WWVTQLHJVfd-m\_[ZZZeUTQPNLNJJ5Kcoa>;8653344UVKPNN=RRTVWXZZ[WZ^^[\\[ZX[^ZWiXZX\kWej<;=<<<=#z“@VZV^—{e_[[[^^`pejjgkB=WfZA@@><66544)JT[xF222234244;;68;566P>;LVrr&#2ВœPV\^8ƒˆŒ™ˆPa\PhgPW\hf4™О™ˆ‡qy^i|fPpXWVZZWXX[ZXZX\\[WUXWWXWWXWUVUWWVVUURUUe^^XWUVWXXWXWWWWWXUWWW>sЄЃ—еИТ•О^#\^iFЦЮЊЫytСpZXZ;CУРЇЯжэјјХ\^AWPT”XXecџъјцы§єіїјјјџџћјџџ#/[ZHc‹kc”ˆбПРйОЧЙЮМоРџ\\XHРЌ­ЙУЭХсммЧтЙзуЬўx[gI%Г гЪглмтсссощп№џ^fW3‹ŒЏЮЫдзммпячђщхсџH%^Z>A><;@AC2JehfE=<;=<==6;@3i‰/N`dW<|ˆidaj_^L\^`dfh{V>V\j4yj^[[fWTPPPUc[^\V/Q[\VZxrc`_jj_^WUWVW\t48`nX8^zdda_\^ZXWUTUWWN2^Zi4^ion\_zqqr|rPIXXa<;VkZ={ony||dR^Qs^WTPLJ5RenHW^^\X[^ZXWVRUUUQPI;TZtLFHFEBECCEBA><6558;ER[zK%55333343448588665<<>=ABT@>@>=8868@KUkqB##3HT[yF#v ИF#PVmJ_­дВo!NW\`Vƒџ*-Pd^hQJЊЏŽdrmZhL}s^WXXWZWZ[ZZ[[[[ZWUWWWWVXZZWVVVUWcVVUVRUXgm[XXXeVVXZZXXWWUXJHN€ЂГ€­ЩсСq^^jQˆлИЇХЙWД/WefL'’ТХЌ№пџџџџ|ENi^Iiw4Z[Z›щзбуояђќїїіѓјџїцџцL[X;hxhŒЩКЬЭДКеЪЫнБйнџ;[d/ZР“ЋЅйЬЯззутхЭСЬЧўF*f\JB­ЅœхЯтмђъуъсгсщчџe[ZA4ˆВддЯпмпщжыхччхыџH\\4aИДцаеЪхѓьлщыъђхтЮ[^Zзёэяъїыъмђыъыыоџіп^_PїџящщђѓђщђєёёяытяŒ^_3џќѕјљљќўўўќљіёєяу^^PџџѕўъоаГТлцяєџјџэЖ[^JКЁ­яѕџїџябЏЦœЏ‹'f\XнТ}МЌ›В––СМ ЂоБ–ДA=WZQA53344'^VifK)43223'[JKVXZZWULH<dILLLNQ`VWVVZ[ZX^XI^^g\\Z[XXXWWUV[JZVWfNXHHHFIFIHFFFEBCFEFCFEFCCECCBEBBCEFFHHEFНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ-PLNKJJIIIHIFHFFFFEFHHFCBEEFHFFCFECFTEEI^>;@BB2IQXd6*;<;=>=<AUdW4x€iVaa^[Z^__`aqZ&U\n;Z^^^\XVTRNQTPRX\r'PWnU=^^^^`aqkiZUVcX\k<8Ted2\`dvpn`\[[ZTWVU`\-QZr;ijnpqop|ˆz…U^XZWpQ3Tfn2qghjzgRTaoeaNIUTQL/PdkHVv_^^^\m[ZVXWWQQQK/QZiP*HFCFFFFEC@>;88;8;BPXrP*<<885884546666886;@LWiR3;8;<K>;8666>A>=<>BCBIRXnH=<;<;<<><;=<;;;;8I;;<<8>IRiiF<68;;<>><><<88688=APZtdB5420/0-<***))')'&-=VUerC&!zˆЂПAQWhPgЈKf[Q<\ЄыЭoPVgi_Ajt‹rnnjF‘fzPQ}L\ZZZ\^\\^__^ZXXXXUVWWXWWUTVVUTWVUTVWW[^^^[[[\WZ[Z\Z[>m^“ЏЄБЅХЪ!3^c|A*ЗУЋЈВ™›‘#X\ZI%˜ЬЁЂ­лџпШјџЬЁт^LaT6aZZ%RШпщпфџџџџјў§нжУеЯџE'f[@8“ˆ„Ё­ИЄУУзиЧЏОбЧнЂ\\W#y‘ŠССмеахамиЯЮЬидщZZX*pЧЙЦЯжчцъяыусуыйэѕJ[X&WЖЙллмотсеххцтоѕц\^XЃЙдагищ№ѓффчічхяўc\\Aџѓъѓђщмїчъьіэьќсџm_^0џіхєџіѓєѓяуыъщъдђU%_^LџќјќўўўџўўќљѕћђђЇ_^FџџђљьТЛЮЦјяѓѕџыїо…*\^LМ‹Вјщ№ѓџоОХЛЋЂs™v=\Z64УРаЈЊЂбПйЙАБВоЃ—^Fk[Q066645BQhdTI;8E2#6AJPV[^aoUIB<>=>><@CCAF^WhI-;<;<<<><4as„Z3_dh)ahVga^_\Z\`[X[ckX)R[jUXo`^^XWVTQNNPRUVn==VfZTW[^_^___XTRURTUUP0R[sCV^`dddpdc^ZVEAVWe%PceI\ƒoq™r}jgd|ck_mUTP#Pcj>ZxU_dvTf|iso_[ZW_8KVfk4RE^vk^[X[\XUVXVQd/NWf`;CACEECBP@>=;8888=>HU\s5@N>>@K<8;<;;<>@<>>>E^ZqP@<><;;<;<<<<88;868/JV\qJ)403332/2/*-/-*))-8CPWrh#'##!!'6%ЄЁЂ—ЏЈ#4VZ_LERjR@`ЮШsII6`\h^^HT‡m‚zL}V{iLzP„fP^ZZ\[\\\p`^[ZXWXWZXWWXXVTVURUVWUUUXXXg[\g\\Z[Z^\[PHзЫPЈЄ™ОнŽ>5_evC0йЦ’ЄЏ’™P4fg^/LУжАБОЮџзАгџџхЙz2V>RiXZœаХџџптџђ§тноГВТлещKfZ5WˆГСКулжЖУЧтШЬхтџE5gZE>‡ЮЉЭЯЦОЪсГРсейЬщ№ \ZW–ЧПпжтлваэусссцзыДZZX‡Сззп№щтыыффхуслх\ZZЯдеЯзмёцхфччѕщсъь86^h&Nџѕэјщдхщщчыяяєђлџ=5^_wџџўіјі§ѕђёяьщєћЮс&B_^ˆџџџџќўўџў§ќџ§џъљ|^^/џџ№ялЦУХлч§ѕћџьлеj^^N/ЏxКцјјўјСЧсСŽЅСfIfX/JКЈ‹ŒœВЯ›х“ВВЮЖСГ‚VL\d`08644#RRcXQF#43056s0PWZ\ZWRNQ)-^NNJIKQVVZ[\^`^\_pi\XWWXdVUUUVXXZXjZUXTLHJJIJHHEEHFHEFFEEBFHEECCFCCFFBFCFFEFCHHНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ-NLLKIIFIFFFFFCFEFHFFFHHEFFFFEFCEFFCCCCCE4dQVZWZZXWXZ[^[ZZZXX\[XXXXZZZXWVXXVV\H>;;82#6@HPVX^_iXJA==@@><@BCA2QcfJ=8<<<<===6Xw„^*RXd2zxgc`a_ZVXeVWfi`ZQXfV>p_[\^^XVRPPQQQT^=8Uo[6Xg\^mtjZXVVTTPPRP/PZnFF\_a`eea``^[WWWQa=CRez>BBABA@>>888<<=@@>=>CPXjT6A@AA<<=8<;>;;<=;;=HPXwP#658LPE524020/-*-->JVeoF!-6'))&)=5=ЙšvtЇЈrCX[qK5IR\@‚ъйT[-5pИУ*3[^^^E`knrPЋC€J}^kЂq€VP\Z[\Z\^^_^[[XVZXVWVUWVUTVUVXUVVTTVVW\[^[\\[\^P=IfАŒЌ­я‰ЬЉъ!*`R‡e„ЩЙޘ ˜Јs&X[^\0ˆвЙААЗУуЭЛзјѓЯXI*T6ajXJAмЬОлїзДЬдгЯЖЄЧЗдёя[ZW&„АЄЫеЛлйба˜ЂЧъгеЯо^[i@L—ЈЧРРЭЦйОХИЧЩЫмџW'[[HХЙЧослцт№чяытщясѓ\[WИуоеъоптфхуутђъгџ\fEмаЪЧчбфчяхцн№ьђщьF[^„џџіэыёщцмоьјяъьпщJ^^™џяѓіјіѓѓѓ№яычфъЉь_^^Йџјњќќ§§ў§§ћџёёжоX-^^LџџэыБУЮжуљєѕёыяЧзd3^\=BТЂыџџќўмЙС˜УРˆЅH=fX2jЮмЈЗжЧЁс“Д™еЯŸЊ‘J\\kL)P655ZPXWcE852244!t-PX\[XXRKE>UNLJJKQVWX[^_p^^^j^\XWXWXXVTWWXXWWVZVVRJIIJFFHHHHFHFCFFCFFEFFEFFFEECCEFCBEEFEFEМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ*NLJJHIIHFEEEFFEEFFFFFHHFIHEFFECEEEHEECECFQRWXZZZXZ[ZZZZXZ[ZXZZ[WXZXZZ[XWXWUU^I>=864#6==>=<@HW`rj)Rdm4rqhgoRj^XTTRTVZ[6PXkX=k\[^_^\VTQPPLLTgN;=<=<=>@BPWjR4EFAEABA<8;8<>>>=@LALWjpJCBEB@@=@A@><<==><>EPWooF&'<;)8554342-0-*/08ERXma>2>**03A56&BЊqgЂХJ!UXdfJ/@Eh№нH@=%xЌЊЊ’'=X^^\CTƒdœyy^p€Bœ[tЄvoU^[[\Z\[^^\[ZXZdWWWWUVVVTVVWXXXVVVTVWg^^\^^_E\g)PЪХіщјэјЫлУ•СЃЉ{ŸV\ZX™ˆœУМВДМЌЛгЁЙДЅЄE\gaK'8F86^QcZ^C&43335}&Pc[[fXQJU@\LZNLLQVX[ZH^^\^Z^\ZZZXXWZXVWXUXZ[ZWVVPJIHHHIHJHEHHFEFEFEEEEEFHCHHFCCCEFCHHIFIFМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ*PLJKHFIFHFFFFEEEFEEFFEFFFECEFEEEEFFCECXE8\aWWXeXXXZZZXZ[Z[[[XZ[\ZZ[XZXWVVWWURJ0><84/4=F\a[^_jdKB@<@><>@BBB3NUsPA=;<><>>>HV^`ZPie>Idseed^\WTPRTTW^e4@W\Z>f^_^\^h[WRPJINTdN0RejBV^r^^ZZKm\XVQT^\^*LVeV0e^^`aadda`\^fXVTL=Tjn4_peccfacffdeec^VU=8Tem8X^eqrgdd_N_`a_\^^i'RXdTQVTVVZ\X^[XXXVFVTP#RejRHFEFPBA>@=<==>>@@@ALVkj=UHFFFCAA@K<=;<@<==0FT[mNFIHBBAABEPBCBBA@@@AKT\rPEE@AAA>;6<;40/02/0!@NVeyI///35656„Žg‚—ЋЂЯД-NUWi_!)sхМ[CP8ƒВ—ˆ››%4nh^^EKœДXŠŒL{yK“f˜ЗtЃв˜КП’ЂT*[^vE)ЛУЂЇšЗЙ™ЄЮУлџџьЖџ€X[[HCzŽŠБ„ПвЌЏВЫлДУУШЪвN\[2LЧ›иЧёсбЯъавЉИЈУШтzjXU'ŽАЊТУВОПУЧЯЧЮХиЭн[[Z{сгвзЧлщыьхьѕбђсЙЬ#FfZ/0щихмвотўсуеесчузсF\\xяЯемпЮхццщёђсРтУЂ\^\ќџыьыыыъъщыяњъфжоВ\^^њџђїјџѕђђя№ўѓычАЗШ_^Lџџћ§џџџџўћњџытузб3T\^­џџэЮОСЪпыѕјџџъРŸГ5L\\ˆлтѓьџџђДПИšАŸxŽE\[X–РЈб™ŽЃЊбЧЧРВзШЄ™0[[`K*5454dTdZ\B543236%'Qc[\[XPIUA\PPLcPRTVWX[\\[Z[[\^^ZZnVdVWVcVV[\\ZVaRJIIIHIHIFIHFFFEFFFHFFEEEEEECEFCEEEFHFHHEМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ0NKLL\HHFFFFEEEHFEEEFECFCEFFCCEEFFFFFEFEHH\WUVWZZZZXXZXXZ[[[[[\[ZZWZWZ\XWXXVWQKA==<6#3>=>@@CB3KVcQB;<>J<=@@HUfqp'Pc[HK{sge``iZXQRQUXgvP>_[i>tjj`j_[ZcTPKLNQQL5QZjTTk^[\\\^[[eTQPNLJF;Uec6d\^__aoe``_L[VUTN8TZj>gc``a`dUvpna_Q\ZiR2Ree0X^vedoacm^`a_^^p`c)PXjW5PQURTXZ[fZVUWhRUa0Pig`0IHFC@AA==>=AA>=>=%IUfvAHHHHBCBABA>=<>=<;@BE[XnUIHHABCBCEEEFXCECCCC3PWtWLUIg^FVNLT=643///-28IRZsc0/03355<ˆ}„Š›РgCPTdmCджK><0yДЛ€˜‡…О‰>f\_^4oЈ‹ˆО„nЂ€|z}™{NVZ\\\\\\ZZXXWWdWUWXVXXVVVVWVWVUVTZ^[\ZU)ЮХгšhЄ‹ДŸу‰3AT­‚!FЇxЪЏЃŸЖŠqX[^[)iщ ‰ЈЈЌЗЗšЙРЧЮх™ЛєЊZZ[Ek€Ћ –Ѕ—­ЏМРияЭхХУлЩ”[[W„ЗзмЙасЯЯьщњЪЧлйЯф=eXF6ŸЌЂОГЯКЪЧОРбсУРмИЂ[[Z­соозмптиуижщщэЯДЋZfXpџвымч№яспуяящєсмЧ\^Zšџълысђѓъ№цщулвнмŒg^HџџыыыыщныыыэѕщщђмЋ\\CџџѓіїѕъчђџјјцовТЦП^^<џџћўџџџџќћљћџмСХЭ^^^ўџщъЩЯЯЮьяџјќѓудЏЙ[^\ЯељєјџбЇЬВДЃŽ’” ZXXŠгУм­А›е­ВСцйОЗaŸ3ZeUJ&5645hRZX`@%42435&Š'QcX^\UPJTBLQP=J>UkZ[XpZ^[^^[^\\ZXZVZXVVTWWZ[W[VgPIHJIHHIFHFHFEFCcEHHEEBQEEECCCCACCCCFIFEEМџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ@LKJKIHIIHEEBFFFFFEHEHEEEFFFEEFEEFEFFECFHFPTcXZ[XX[XZZ[Z[ZX[[XZ\[ZWZ[X\f[ZWWW_L2;=<6/2;FNRX^^`fQC=<>>>>>BEC2I_k^E>;;<=@@AJTXXf3NWnWHwghhe__[ZVTTRW[hP3RXd8Z^_^^^^[XQPQPKKKL-NXjVTi[\h^jo^^XUTQKIWE8T[iVfcAPNQTVXVZeXUXZXVRRK@>>A>>==NFHR[oQ8FFFHFEECB@A==<<<>>-JV\kKECCECEECAXICCCFHHEEPVfmAHKVFECA>=6544200-/#@KVjqN*636468*Ÿ|ˆ‘}‰™d*HQWen%Œi3&&„В‹‹…t‚…Ђk!XЪ‡';Ызg ЂЂ™Џ•A\\m*i€ЄЂМЋЏЗЂЌЄ­ЛЄГЪощ­B\kZ=tzЗЄБчхЬАПЖсщЂъЉЮЮм2;[ZIЋечЫЬРййМапИЏлјРСЃ[XW@^–ЊЈЏЈЖЦЙКЏЏЌснЙаИL!\[KослзлЯѓсффћп№зЙДЊp[\WГѕжмнотфпЧуфсїдУ ‡f\LмыймяуэєщщщјъщмПЯc^^3џѕььыъъщћяэѕџсеХг^^2џџѓђѕџћђёёь№ехЬЏйŒ_^*џѕћўџўўў§ћўяхеХЇа_^NџџљхШЮЯШўѓїјџхяЛ™Ж^^ZЖСщѕыљмЧЪ•УЊ—Ёˆ*ZZW‰О“ДЏГУЈыбУТАоȘi|)[Z_I;6484!aVXXP>542455#RX[srVPKACNQQKNKRZ[XX^^^h[ZZ^\XXXZVWWXWVVWXVWZZaRJIIIFFFFHIHFFFEFHCCFECCAECCCECACECEEFHHHНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ*LJKKJIFFFFECFEFFHFFEHFHFFIEFEIEEEFFFCCEFEN_UW\f[XXXX\XXZ[\Z[[ZZ[[[\[\XZXZWWWUZ3><;6!3>=@@BCAAITde6=<<=<@ACKQUI`38`jX=m€trfdkiZVUQRUT`Q8^Zi=;>BEENcnfIEEEIEFCHQAB@>><<;=/HT[rP6FBEERFCAHJHICJUFCEIQXnV<3IIFCA@<85320020228EPWimC!5I565-‘rmnˆ’_)CF0L_Xf\5;33ŠА…z…€j•x‘ˆ{->odT`J'yМВ•‹yœW-UPRX[XWZ[Z[WVXWeXXWWWmVWWXZZWVWWVZ\_^XZaP%yзЇРСБh86|ф{<Ьтж‡ЁЯЏ’Ђ48Z^iK)Ž—”ОЉ­ЄЧ“™ШфУЊйџжЂ_\^Z@QsЋЗМааДХЙ–нхМТПЙДГ[\Z/UЩЫжЭйЮззЯлРЙзблЖЛWfXV%yŒЂЮЬБВЄЉРЙЙЦвЗ­ЈЌXf\2@ћывжыхцыьпъщёьгЄЂ`*e[IіћхЯыотсуфытоозИСn\ZEхйлёнЮжђццчтывЧЇз5;^^JџщыьыъсыяёјыхтЩАнJ8^[6џўѓієєђч№јѕтлаДСяd<^^Tџџџўўў§ў§љџъщЮТгО^^LџџуиЯЌШтџіџіџчЩ™ЗЋX^ZаыэѕъэъО•Ј‡Ђ’—Ђˆ“)[[ZŠЈЄnЏЙЛЖвйТРчЌ—o„3ZXgH;6;88#`qZa^=653246/‚'RX\€^XQIAPZkPKKPTdXZ[^^\^Z[ffXWX—^XVXWVVVVZZXZdVPLHIHFFIEFHFFEEFFEFCFCEEFECEFCEECCEERFFEHНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ2LKKJIIEHHFCHFEFFCFFFFHHIIFFFIFFEFHCFECEFEK^VWZZZZX[\[[\\[XZ[[[\ZXZ[[[\ZZZWVWU[E><;802;CLRW[^ahU3A>BCCC>F^kfI>=@@>@>CXecepP3UeZ;ovfdc_^^[VTQQPR`P-RZjHX_^_a`\[XhUQLKHIT)KV\Z8T[^^^\^^[XXVTPNLI3PXmFTk^\^``^^\\[ZXVWQ0=`eX0fcffghfUakkac^``j=>T[h4TXX[[^\\^cxt`^_[X^/Q[tE@QQPQ^RVXXZXHWWXRN0QWjRIHECBCEEBAA>>@>@AECJT[h;6IJIHIIEEBB@@@A=;><85522332324@IQXqN-346ЋЧ˜{K-LPsW3AWZkW43‡Ќ„‚‚ƒmnВŒ•k‰s%s–e`R/P’н˜šŒ‡d &LdTXeW>/zkX\PLLKJ[XZXWW[J[PF6NKTVe`ZW[eiT-ƒѕыŸ<52ЄјŠEРАЦв—‡ПД‘^-[^r\'‡ƒŽˆА™ЯИоВСВЄфŸЌцŸŒZf[Z3syoЉ›АЄЬЙыхЧКЫЫЦЯЦбW\XZ‰мОеЩЪхШМЮтЗЦЧТШЛО4CeZK'˜ŒЅР›ЏŸВД›УРУВЇœŒŽ[[XзхРеЧйЯамлЬЧйЙЈˆFBeX2џслоѕЭсътђђяйЯЯЏЩEH\Z)0іЮтпнбуфхщђсэОПЯЯ^\[ЈџєяяљяѕяёђўъялС–ђF^^’џўєїєђђђђ§џэдЪЊЮќ>\\‘џљўўџўўўџџџтеЧКе ^^@џёмсОКмъђіџђѕхГЙ’Ž)\\LТхїџњщЦˆЊ’ЗŸЅЁs„4[[KЈХ—УиОъЙЙЇЉлЄЉЖЂt3eX^C'668;AQX[fL*4322453x)^XZZ\TNI@WL\LJLPUX[ZX\^\gZZXXZUIXJZXWUUWVZXIXWWVPLHIFIIIHIEHIXCCHEFEFEFECEBFEECCEEECEFFEFНџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ6LLKKJIHEFFFFFFECEEFEFEEFEFFEEEFHFEEFECECEKUVXWX[ZX[Z\^[[XX[ZZZ^\ZZ\\ZZZZZZXXWQC>>;600;BKPVX^jnUF@<@>=>>BCB-BQXaK2@AAB@/3NTVdkR3^Zc-\__c``^_Z[WTQQ_e\6PXnVWomma`^^\XVPKIHFHC;U|dEV[^^^``\^^\VUQNLI3NcjU<[^_^^_^_^^[ZZXXTL=Tek/W^dqffcaak^^P^_anR3Teq>PVZXZ\[_^_aq^_^[X^2PZtX>dQ@@PATUTVXUXdWPN)LVta2FFFHECBAA>>>=<@PCBFQXrQJKKKJIFEFCVCAAA@>>BCLf\s83AAECABCCEFIHHIEEHEJT[sVJFEABCBA<<6544530348CPWjrH'4366 Ќvf“[0\VKf€0/RdZjWCЏ ‘„w…‚„‰ЇŽŠz•™Ђ8g˜ha_5#Ае™“”zrЄ-N_WZZUP%‚WeQPN/--#5&Щ­ЧбЙЫмЊЄсЫКЩЯСЂЄЏWZX0T№П­ПРБЄзЬДДЇТЙ™z{k/[[ZЦтьзщйзйжижбмЧ“ˆz}3VjX\џпмоссттзатнмЦ”ЄЈ[^[„јдщотуи№щщуљвСКЯИ^^\ћџјљіьээяёёќясМ™Жѓ^i\аџњіііџіѓђящяВЏРзџ^^[мџњўўџўўћџѕѓЯлВиs&^[)џэЪЌЦлјяєїѕэѕъЩyt2[ZAџтжїяЧЊ|ЏЄЂЌš•—p>ZeJ>ЮМЋГвЛМСаоУлеЙЧЗДrHWX\C;586)FQZWTJ5533362o5eX[ZWQKI>FKPNNKPTXZXX\gZ[^\W[WWUVWVWZWWWXWdZXWmVP^HIIIECHHFFCEEFHEHRFFCBFBECEHEEACFEFHIFJСџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ4NKJKIHHFHEEEEE3QFFHIEEHHFEFFFCFEHFFFECCFFKeWXWZXX[X[[[Z^ZZZZZX\Z\[XW[[[[XXXdWRE@<<838AIRVX\_hV8A<>A@@@BCA@A=>>>BBA4PWna8FIIIHHHFEBBAABPCPA@6RXvP0@ACABCCFHEJUHHHJWW5NV\k<8866643454=JT[s^3!468Дœ…K6Qh[ILЉPTd[m=PœЄ‡„ˆŒ‚™Ž‚’АЋ*<{HC8%@ЌХš€zv‹0L_XeZWP)VA ЖКјчЈУЈЙЉo“€NЄнЦбТKP\r^XUfkI%#4!—џъ!{ЪВџеЊџьzП–E^na@>@BBA<0NWcP4@@AACCJ^UTRTP0PXkTVoN^_``^jiZVRPNKKHKVkZC[^_^`_^h\VTTNNLLJ4QXeTE[^\\\\_\^mXWWRNW3;Tfi6UW[^ack^_`q^g[ZXR%PXnVEX[\`k\N^^_ka```kk&LWmTBRUW[^w^gXX\^^\[Wa42Rej=@ABBIU\m>>AECEHHJEFFHKZa8ITZjRJCABA@AA<86886L ™ˆЛ…‘—К‹ŒЧџЁ%„Чr@KA'WŒzvUTWZZWQ-thŒˆаˆ—ЈУЫм—ЙРМЧ%ЇЧЗШ|K^p‚xPH)'&6=aџџ™ЬоЙЦбЊ–ЫЩ|Š/;R€F6’Ќ™­КёђЈЫВБРВЖЈУїъ-8[f[*gУРЉЏДЖЄЊЙУКжЮАЈ­ЖКИKf[JРЃ–ѓлХТУЈЈвУгОжЯЂ˜IjXIЏЗБЄ„ГЃШДЗПЏД™ˆ}df*W\Z^гммббпжфъбиЋœ ‘mxg6dZLєъънтљэЯф№суоЧИЉИ\\EыяђсйщіъъяяъЮЂЁ‘а`-^\6џџѕјыщсіёћэњйЩВЏь”^\@џџјјііѕєђэђиЯВЙођЮ__Iџџ§ў§ќ§џџџћчЮЄЈОџH^^Бџ№Яллу§іїѓ§ъЮШЄ ЧJK^\gџџщсеЉГЗГŠ›Џ™•ВPC[Z!nЯЊВД›ПŸаРдлЪЮОБ›‡LP[aPA<;<=`RmWdF8E53448WX4`[XXZULX=cLPNNKPfWX\ZX^gZWZ\\[ZZVVVWWZWdXVWX[ZWeNKHHHIFFHHFTEFFEEEFFEEFECCCFFCFCCBCEHFIEEЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ3LKJIFFFFHHFEFFEEEFEFFFHFFFEBEEEEFCFFFFEFF<^TWZXXXXZ[[^^^Z[\Z[\XX[[[X\\ZZZ[XXVTI><;8305AHNTZ\j_iLA>=>>@>EP@<>K`kRE@@BCCFPUVTQPN6PWZTVpacdac`^i[XTQNKJ6ITfe==>>==>ABAFQZsTJJLJIIIEFIHEFEEHCB@AI^[zL2@@=AEBCBHZEEFJKKXH-PWtkK40@@-@@<<;;=>AnQ844”ъРc&;X^\^@LЦБ‡Во˜z—Ё{ОђЯЬ‹4_ыДL;C)3CˆЙЩE[VZ[VR*{Š‰‹ЈБЃСЬВЄ ЙЭОззЁлдЗЈƒCHJ`6%/@%'Шџџ2LЏЮЮИ‘ЖАšЮЮo*=`y˜C!}дЇœЈ ŒАИЖГЄЅЛУСДВж‰[[Z<3ЈЪЖБЮВДЯКЋЙКЧЪЬПЌЈС[ZZ)^жГЖЬЉЅЫЏВЪнЈЊ“ЊПwˆ#X[Z;RЗРДДДВВДЙШЊ}Ёh^ka4d[XДыеЫмСсЛаЯЬЭЂЋЄqh…LWZZ/џымоычццђуохЬЮЁЪU3\\<џџєђфлъщ№їмдГСЏ­х*E^^^џѕыэыыэ№яьщљЯЗЄОџ_<`^!#џџјјієєѓќїњОЧКЙРџŸ^^/џџ§џџџўўјёххУ“Ѓзџ^_^лѕЯЋОпѓѓїџєџчЗЁ—kˆ=^[[ЂџњђьЪЇ­šЧzЌЇЊЙŠ™8XZW%}ЗœВдИЙЄЪТЏвЧпШЌДœ@^XaNB<<;<%cVdXaC646445%\KPa[XnWTNW>JNNPKNPVZ\XZZ\hZZo[Z^ZWWUWWWVVX[WXZ\ZXRPLFHHCHFHIHFEHHFEEHHIFFECFBCCBCECCCCEHHHHЬџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ3KKIKHFHHHIFHHFFHHFFEEHFFEFFECEFFHFFFEEEFC;kRVXZXZXX[[\[^Z\\ZZ[[[ZZ[\[Z\Z[XXXWRL0<;83/4>FLRX^`jeNA<>@AN@BU@;-JTcdHAAACEIQWVQPPZ0[ViVB[adecr`^^^ZRQPNKHHQenBUf^_^ZXWVWWWW`QKH5LXoXAX[[^^^^^^^[XRUPPJ'NXjRBa\^^``^^k^^^[ZZi3KVZW2P_TUZ^s``a^P`adr|==TZhAnaXVTUXUVdVVVZZg^W/PZoXBnmWQNKKJLPPPTRQRP6KVkh;IFCCA@@>@;>===>@@@4NVka;KJJKJJHIIIHFIIFFFCB6PWrTFA@>AAAABAEFEFJIILKFKT\kR8RCP>NA>><>>=<=8664;AJRZm^C)%HЉoJTj^R-œіЏIIEdE*[iPa-RЗ“ЏИŽ”˜}Єщ’œЌЏКПТR&Џџ“;5R>5BŸ@IPfaVT2pˆŠ ЈЅŸЗЙšЄСЗЧЩХЭЧУЄšА '<>ЂџџИЪЅдтЉЅЗЂЄЬ^^ZнџўтпСЇ›ЄЄЁЌЉwˆЄ-ZZW’­КУвЙШЏЌаУСЗРМЏ›“![ZVNA>K>;&vTXWPA646433e@@AABB<<=I^hUHAAECFKa^\VRP_;KVeX6[ce``^^^[[jTRPNKI4P[nBT[\[ZWWTV[[\mVQNJE;`\d5UW^\^\[Zh^\VUTTQLHLXka3RX^__^^^\\g^[[ZW@2U[qALPRVj^^^^_i__mc`^R2QXiAPQRQUVVccVX[[ZZ[[k@>Vke8XmWRPLKJKLRR_TQRaL>@K<<==>>>=>=AALUeq5KJWIJIHI[FHEJJJFIIIEPT[j=C>>@>>A@BBAFHJKKLLK;RXkkNKFCEA@B>@>@@<=;6865;BPXZk_*)B48T[^C>ŽџЏRE8HƒКЏ&)_Œ`^6LТЋ‹šГŠвсЂ—œЌЃЏЋХ{%Qфџ’30BBU0EINRRP)d„‰’ˆЅЪђндЮДЂЙЛИЫл™У•ЇУ/<=Ёџџђ-pс˜СќЖОјЩ­0cZЌj'c™Ÿ˜ЂЇЙkЙ–БъЏКЖЏОЏУАA)\^h35ДЙ—ВВЏЅбЩЃЖЄЊЊУоЂ—Њƒ\ZX3Qчš›ВˆЮЦПЬОЙП™–`€‹8W[W<5Ъс№­ВЯъСЪОЦЈˆzrV|6Z\[/BгеЄСДГобЦВЫЇ‹qZs—šXeXЗџожтуттзплгоЈРЧZZXЈџЮсзхяъъљцгдСˆŠоо`^[џџџїыьэёёэєнЮХЏЦсђ_^\сџіјєђё№ь№ѓеЖБДЯѕџB`^ОџћўўўџўњєќоУЇВКџТ^^KџеДУСлѓџјџщсСš€š‹@\\LџџјоЬЅЌЄЖЄœЏ…Œ|0ZZXбИЏГ™ЌЮСЮУДЄВзЬЏŒ™#ZZUKA@=@>'dVdVN#;53444x3QWfZWWTKVEsPNNKKQVWX\oX[\X[WXXZWXWVVdVVdiWZXXXWaQNIHFFEIHHHHFFFFFCFFEFFFEECCEECCECCEFFEFHJЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ3PLJJIHFHFCHEEFFHFEECEBEEEFFEEEEFHFFEFFEEHI^VVZe[Z\[[\[[[ZZ^[XXXXXZ[Z\[\[\XWWX`ZB<<84#3AA@=BB><>FTZi6CEEC5LnpiXRQZ;JU[h8fana`j\Z[[ZWQRPLHFNZoVEX[XWVXU[ggXWRPNJ50T^j;QdkXZ\[X[[XWVTRPZ8K`fh6RW\\[X[[[ZXX[[^e^3RZiQLPQTXZ\\\^^L\\ak^a/PWjVAPPQR_UTRUj^[\^pi[==QetCWjZXfQNPPPQRRPRRaJ/QXnR-EBAA==<>==<<>==>=AFPWvQ>@AEABFKLLKKJFLV[oTLHTECBB@>@CA@5;!€ВЬљРзџПqILm[;sЉ‹”Ÿ­ЦГtšејщјЯГВЖРУrZ^iHŒзДЋжЗ——ИЖœУДУБРЙ—|”>CgmZоБЯоŸщКєџмђэеšЂ‰ƒr&XfZeаХЮЃТбЅаъаЯŠЄVfsnx*X[X‰ЫЯЦОЮалЖЮЖВ›Šr„Лr0X[>№єытжъеплтммКˆœХ™\\LщяцыэмъђщфъоС w—џ”\[CџѕщчнпээьъяжеЃЩЧђё^^Pџџіјєх№ящулЯЧœЬп№џc_PџџќўўџџўџќяЬЌЂПЫџ‰[^FџУЄвоџќўіџятЁ„{ŠЂv2gZEџџџэЙЇ|ЄЄЂЏЃ“Єtq/[XWИЈАИИЛлУаРлРбУОШГ)\X_IBABB>C\Wm`N@;544360RZ\ZXWTJPCNNNPPLRaZZZ[Z^\\Z[WZ[eXUUdXVVVWW[[ZZXURNIFEEFFHFHHFFEEFBFBEFECECCFEEFEACEBFFFEHIЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ*NLKKJHHHFHHFFFFHHTFEEEFEEEEEEEEEEEHECEEFFH^VXXXZZX[^[[[ZXZ[[XeZWXZ\[[ZZ[XXZXXUPE=<;B-08BJPU\__hU5@>>AAABA>=>FQcjLEEFFFPka^[RQPIHRZd=[`_j__^ZZ[XXRTPLI5LcoZA`UVZXX^\^[VTQRNLI0Ž\sTRWZWX^\[^[XXWVTP[I;Rer>PUVZXZWXZ\ZZ\\^gf/PWjV4PPTUUX[[XWWf^Paai4>Veh3QQPPQNNQTX\_^p_jgT2NXtVAWXW`RNPPNLP^RPPPL-LWtg==<<=<<;=@AKUna=JHIIJJJIIHIKPNIJNIF5NVfs@=@>@PEBBFHLLIIHE3PXfk2NoWkf0>Nh_K8–џД4E@6“КЈ™ЇЉЏ*^j^^53{ЋЅЇ Ѓ‘ЌТ›хДхРУЄЙТЂJeџџгN-A\VPKg^URL)LзЯЇЖЮc4WoЗjNŠЄ“ЉЗЃЇЙzьъ›ЛКГ™šЏЏ&A^^^…мЦЯООзКЙЌЏУЙЯ­ЉЂzx™qZ\^20УзА ЄЁџ™даЫЖГТfrhP>d[NЪн­ООУЮШсЦтМ€‰V`xˆUH[ZBПРЙЙОЦЈлХЯЈ­‚c}€ˆХ-I[Z0*ъъђъсчомйсиОЂŽˆЅЭ`'fZ;ѕхщыяїъъцпжЩЈŽЇЩџT#^[)џ№щлцщџсњъзЛВ“ШџЖ_^HџџїџіњќјђЬдЩЂЧгъџў_jPџџџўўўџћџџжВ­’дпџ53^g-ZђБЗЮцўїѕѓєяГЏ™„˜Ÿs>^\4џхыЯЧ­ЃЙЖƒ“’Ђ–=\[JиЁДаиЂЧЅРЮДРнВЪЮ3ZeUIBCAC2IQWdTK@885445!‚2U[\ZXXRKEP^P[NNPRXWXZW^\^\^m[WVWXWXWWVWXWZZXZZWVPJHFFFIHFHFEEFFIFEEECCEECEEEHEACCEBBECCEHHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ3NKJKIFHIHEFFEEEFEHECFECCBEEFHEEEEEFFREFFEFQWWWZXZ[^^[ZX\[XX\XZ[W[[fZ\[[k[XXWUU[E><84-08BIQU[^_nVH>>@A@>CC@=>3PWkNHHJIIBgma^XTPJ'NViHXh[[\^[\[[WXVRPLI2JUkd;URVVXnon[[XVQRPNK5PWkW>TWWW[g\[\XXXRTURK5QdmB>PTVXXe\XZ\\\h\\a/=Uja5[PRQQQFXXWXZ\^_axA=_[iCQPNNKJKLQjwro^P_^g/KV\Z;`WUQQPNKK<>=>;=<<<@>@>=/HTeiAIHHJHIHHIJKNNKKJKIF4HTZvPECCA@@A@AABCEIXKFBC3JdXe_;BBBA>EHEBB@@@@<8888*BQVXk`'0P\TEšџУ<=-3‡ХЏˆŸ™ОЂ4xv_^^*hЏЙœВЙЊŒЦЏЈ˜ЁЃЁCKЫјоˆ`<@AJVqR8IJI2Roa`^\XVP8PajUUf\\\\[[[Z[XVQPNLFIU[mA_WWZ^_^[VWXURRQ\K-KW\g2PQUVXX\^\\eUQUaV`/NXmT8PPPTV[[[\X^^^\\hN8Ujk6QPPLNPUyVdj\\jc`nT!RdnRPPNLKKJLQX^LI\``_m@=_\i0VUVTTPNNLNKIIIHLKJHR[tR5A>L=><==<<<@A@@@<=CPWnUJHFHFHFJIILNNKXJJIIE5NVjg=ECCABA>>>BBC^KJFCN@CNTjqLC@BAABCHCB@BB@<<;6<˜ЯсЖ—ЁЃ ЈКВ!`ƒ_PP3FИЋОЅРЬŒМœП‘Ж Ї™”‹ˆ}W%vЌоО‚d`^Z\[XXXA6=888U###->=436RpЧџџџ„48UZwQN[mrd=EГ3)J>—Ћm2VДЗtЅЂ•ВЃР{ВЉ“ГџЯЩИЬ|\^i[—УЯхГЛеЯплМАтДЏЄБ”ЈŠ‡fZe*'ЉнЈЊеО”дзмЧˆŒshWoƒd0iZZЙџпимГУДЂлШЏЁ}s‡•Œ'\[ZЂсадЌГЅУЏМš‚cj€{М•XWXуђтнсљмйжОлЗЊ Ÿ—РЗ[[XДјэызђѓцхмвХЉРДЃяў_\[пџччххщчџвКцДЄТДчџ<_^›џџјјѓјьєъдЫМЬгъыџWj^AџљўўўўџџщьЧЂКЯгџџQ^XЈсймщџџћџџыЧА{ŽtГ@N^[ДџяЙЌ­РВ•Оˆw‡•XE[[#iЭнШсЭСЗТУУЧтЧЊЗЋРBP[cR=KFIF6oTXWRF=<<5C484ƒ3`[^[[dhLB'FsPNPPPTZWf[[[hh[\^XWXdWWiXWWXXfLNCZWWVPNIFIIHEHHFFHFHTFEEEFEFFBFEECEFCQEBCECCFHHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ4NKKKJHFFFHHFECCEECCXFCECFEFCCECECECEEEFEEFLdVXZ[Z\\\XWZ^\[[^^[[Z\\XX\^ZZXXXXWXcH>=PBBB><>@IVi_3›=aNiac`v`ZXR5KWeX==<=<>=<@@A>B@>0IT[s=FCCCFIKKJKKNNPKLJIFCJR[wQFBECCBBBABAAEBCA><>CJQWeVICAU/AQBEPBBA@=><=858>JTWZgP6>ЋџУPH3A‰ъ—йЉЄМЅЯЂ›ЏЌ>!HŸcL^5)€йЙЈЖзЙŒГ“™Ћ™ЇŠ}€q|sE%RgƒЅ‘€xd_d_L^[^[[\Z\LPTLf^mŒУлђхЭo%H%@T\Ÿ}_\\ifH=0k\X™Б­€”ЅˆšХхРИ’„{tprЅ8UdZ<јвАЙйыззРоБДœЁŒœД_Bf[CйГЙвИЅŠКЊЈ|‚ztx‚•Ю^FZX0џщфппяълыбК—xЂЂЊњЏ\\JіъѕххчцјоуЙКД™‘ВџД^\HџџщхщъђўылРУЊЌОыџџ`_\вџџјўќўщозБЖЩЛйсјџ;_^›џќўўўќџџснЯАТмџџ^^XЦОЯт§їџљџќеЄЈ}‘–|И)[\qьџСИ“ЖЃ ЊДЄ˜ŠЂILeX„СВЉЁПчбЯУЋОщМгДЈЖ4KXWPQNL^JKvHZhRE==;66#84t*a\^[ZVPJ-ILLLPPQUd[XZZ[Zi^^^[XWXZWjVUXXZf^жm[WXVPNFFHFHHHHHEHEFHFHEEBFCCEEEFFCCBECECEHFEFFЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ3NKKJJI[FFHFFECHEEEEEEEEEHCFEEEECCBFFEEECFFI^Tc[Z\\\Z[[X[\[[[^\[XX[ZX\[[X[ZZZXWTK@<8;2#5>HNV[_akeNB@ABCABB>>>@I_dU4J;N>kmeea`^ZT;<=<>;><=>@AB@A@@H\XrN2AAAHIKLKKNP_LLJKIKI3Pdfg=@A4NUemP5C@BPCBCCEB@@=<;;;;6&>J_Wec4kњдN<<4‚БщЏЏЈ‰ЧЄЄЁšЊ•Вzc‘fP^E)oЙОЄХЇ—зz•Їm“coyvxs{2#-EFdŠzs•ˆp„ee€yte}ˆŒ”ŠЂГЏДЅzP-)Lt™œзЙ;T[ds^W^I/&2H4cпЙF2„‹”™ˆДМЏЂЂ”РŒŸЏХЖМИЏF\iiJBvwгіЊЛхмЧЭОИЄЁЙz”Ž{—z*[[[X\^\ZaNX>UZPPPNPgXZf\\X\^^^^[ZUWXXZWWVXWXLa^XUV`@LIFHIIHIHFFFEFEHEEEHEECEEEEFCCEBBCECFFHHHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ3NNLKIJFFFEEHEEFEFHFEFECCEFFCCEEFFEFCECCFF4;eEVW[XZZ\Z[ZZZ\[ZZXZ\XZZXZ[[[XZWXXWTLA<;E0/5>EPTZ^`c^PC@>CBBU@<@@@HRmg>JLPC\aefeek\T<;Tdg;Wg^^[ZWXZ[dXWURPJ6NVjW@PTVTVUUUTRRVVTR^Z/PXrP===<;=>@BAB>@AAACNTrh3A>CEHJIIKJNJKIJHIWJ3K`\rAIHEFFCBBBECAPACA>AA@FQ[kfJBABBABBBCE@<>=8;;84)4PiWeZ5ЁE5…­Д­ŸЯДЏ•ЁŸ‘ЌЄАѕ{4™ƒWUP/3‘ЏТЁАџz”ƒўО–‰‚p|nŒ“-F=iZ[@>HLPddx||ƒ‚sxyiQX65AILq‘ˆˆЂ™ХцЁ*=Qi€ƒP-%-P@8ЂлЌ!/zЄz“ŸЁ‡““Ё”ЊЃВ ŸЃ›пКЄР'3^^rJ=^€„ЌнЙпЩУнпХОЇВ›•“š&KeZWПщдЃŸ–ЧЙЂЈšŽz`k{oŸJHXXKЋЦЧЯУмьЙвЇЩ“‘‘ВЧx[ZJšоММЙЮРЦšš—}dQtnˆ “ZXWИутфъллсЭПГБ››š„ЖжE[Zsџящъ№цумУГЄ™ЖЈХяџI^^џглъыѓщфмбЦРСРхёџЄa_5џџіѕєящЯвЈМеЩнхщџџa`TџџњћўџїьпЭЂЙДхєўџm_\;ыЮщџўјџѕјчХЏЏ{Ž‹‹!^\6џёУЈˆЇЛ›Ÿš˜šЁ‰!\ZVРКЩимТихЮОехтлЙɘЂ_mW;VZWQPPRXjWLF@><856cNPh\^Z[`LFAJZNKLNRUXZZJZgZ[^\Nx^XWXZdWXXWXWVWWWdXVPJHHJIIHIHFCFHFEFFEFEEECEEEECCCBEECCFEEFFHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ3NLKKIFFFFFHFFFEFEFCFEEEEEECCECFFEFFFECFEEFIfRWXZZZZZXXZZ[^ZXZ[[^[[ZXZXXXZWWWXWUNB=<80-5=BLTW\`rqTE>BEFACA>@A@ERXcN6RZh>PQNKKJNPTRWXW[XXWP-PWnQLPP\PJKXKKLPVWWUVdL0UeeAQW[Ј[XVTRPQLIJHFCE4KUeo4><<@<<;=@>@AA@BCA@AF^Zq=AACFHFHUILJJJJJHJNKI;RXfaLJFIJIEBCBBAA@AA@>@=BLs[[T6B@@A>@@CAAA@><8558PДО‰Дz’–ЇИХŒ……Ÿ•‚}Ÿ&FNie}C<8NdH;>;XVQTTJ36)!-6^mcƒ‹‘‹™j‡ |ЄЏВ23J=\L)3K/Fчџe%Nˆ–ŸVСџ­ŸЃЄ “ЂЙƒ•ЇХЭгАJ%[\s^;jhŸ—yЯШйсРКЯЄЌЦ™Žpg‘g4[ZZ8<ВЊ™ЉwДšЅЅŒŸ–ŠƒƒПŠ!XdW;6ЧЖМОРЖдРЫЌЃk—}ЏШ4P\[B!олРМЏЛИЩАsafwn‰‘ЮK;ZXCъхдхуысЮРВ›œhŒzšоС\[ZдџчёъщуьнШЄЅДЁУлџџ^^\Яџћіџэ§цд№мЖПТМ№џџ#3`^IџђєћќїєтШИЧщиъџўџХ_^Aџџќў§љџћз՘ОПлўџџ>_[`џйяђџјјђјсЂœ™xŒ Жy=\[0#џэЋЉЄОЄ| С— q‹–ˆ*f[JГИнДЗДсъМЬЮсђлЯмб…&\[V8{^XTBQRZ\VPCBA=;65#n/Ad^\^Z_LPBKPLZLPTV[[Z\Z^[^[[^^^Z[WZUUWdVXVVZZZXZVNNIIIHJHHFFFFECFEFHFCHECFCCBCBCCEFEFCECRFHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ=LLNJJFEHFEEFFFEEEFEHHECEFEECCCECCEEECEEEEF<80#2;CJRc\_a`VHBBFFEC>ABBAE\ckBLPRJmyŠ…{dc^ZR6NVjQ8XZ[Z[[[^VTTVVVUP;JTehZLNPPQVVVZ\^i\[dP0PXm@P^QPKZNLLQUUVXWWWR2Pang=><<=>>>>@>ACBBBAENXrT*CAFEFHFFJJIIKJLLKJJFLgfnPKHFJJFEFCCBCABA>@<==5QZ[tLC>>@>A@CA@>=;685;EKZN<=TcZ\U**nџЭšЏУЄЃА›™ŸКŽЏš™šЇ­ДQiЈЇKBQ**vБ‡‰Ž’Œ o{{‰›Œ‡ #JQRVVRL8sЂšzh>0!NŠ” ЗУвЄW”€„‹Ѓ…щџwБЁЈ Р3=6›џџNH ™–\ЁЈ…ЬЖ ŸЂЃЄ‹сЦЈШ[!\^ac!myg”—–лВРМЄ•ЏЅˆ}s`jw{*[[fL!ЄОЄЄ™ЗšГЮ“šЋВZv‚ ‹Д\6XZHœчСЙЄР­ЮЧЏšЂА•—‰ЏцА^\\‡ЯЭмсОЮЇЙšv{efˆ‡–ЛмKZWWџоЯдждЮоИЈ•‰šРЌєz#ZZEўёчіоцячЮЩДŸСРЬнџЌ^\BџњъсыыъуйиДРД›ЛјџџR`^ОџѓџёъэмСЄаОбРхўљџA!k\AџџќџћїџцР“ЇЖЗсљџџV_[ъъќіљјўџыЖББ…x€’бQP[[jџг’™ŽЙЂ”ЬЂq|Г@\X3#ьщеЉвЧПмТадТб›ДКЧ€![XUAyQ^[UXUdjVK5EB;868/€0Re^n[HTLPZJd\KLLUWZ[Z[^op^[\ZX[XZWWVaVWWWVXZZXZZTPHJIFIHIHEFHEFEFEEFHFFEEECEFBBCEBECCEHEIEdЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ2LKJIIFHHCEEEEEFEFFFEEECFHEEBEEEFEECFEEFCCR;fUV[\[[[[\\ZZZZ[[[[[[Z\ZZZZX[XXXXWcUPF><83#V8BK^UX^kjcJBCFHEEB@A@C0PWj`@<JIHHIIFTCFFBCC@A=><0JhXfgJB@>>=@AA@==;88*F[VXIA!AUZ[m;^ёџеЃМЌ–Т”›™—™˜o™В™АЬЅДЏd#­Чv68P2/qy …˜Ј‘‰ŠŽЂ•ŽЄ'KRUXVT>)g’{‡ˆf6P“Ќ™ ЃЇyIR˜‹’Ј“цћˆТЂЁœоП'P@VџџЉ3/5<C—{оЂƒГХЃŸŒЁЅн•–УЅШ\^tq3XЯw›Š‚зЏЙЙД‹ГЂ“z}Zx‚<@[[ZcЄЂ˜ОЊЇЉРУœЅЇq„n{ЂЉWZZ20оТОВтЧОИДЈ•š›ŸЁЄУњ\*^[LСжОДЯОРП––„kyg‡‚ДўŸZZXРнзЯвогвХЋ…”™‹œгя=XX&џњщјѓѕлЯУЇОЙЧчтџA)^^'џџјыьїђъбКДВЊЬѕчџџ`^QяџђђэєыХГЁТЏгмъџџџN`^Оџџ§ќјёугЇЇРЭмџђџџa_^хыѓџџџљџўоСˆt‹­ƒВ2P[XЂх–”—ЗЁŸЂЦЭ„В‹ЈZC\X#)ахжЩЪЯТЧвоќШбЭУжЖUA^jI^wgP^[|JWXTLHFA><882Œ*Re^^[V^JAHLNQPLPTFW\\\^^_`^^[WeXWVVVTVWWUVI[WWecPPHEFIIHFFIFFEFEEFFEFEFFCFFECBPCCCCCEEEFHFHЬџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ=NLJIJFHHHEFECFECFHFRECCEEEECBHEFCFEEFFEFEC4\UV[[\[^[[XZXZXZ^[ZXX[ZXXXXXXeXWWXXVRI@=85#!8AJQUX^ajdKECFFCECCCEE4KWkV>QT\aedRadc^oz@=Uda5cpij``^[WWVWZXWUL4PXrR;IIPQQQQUUTTPPPQ\J4PZqPKIILNQRQRW[\ZZWXfN0UZr@\PKKLLNPRWi\^gZe-LUXg3PQPPPŠKLNNPQeVTV_P0QjsRPQPPQRURPNKNKLPPQfK=VgtAPTTUUZWUPNNPKHFBA@XLVth;>=;==<<>>@BBACB@@CBFRZvPE@AAA@EIHIIILNLLLJIU6JTjrPJJJIHKK\FEFCECCB>>=>BPc[nR3AA;<=@>==<;!-F^X\L_šHPkg[X‡ЬщѯЅмЂ€‹}‰•ЄМ‡•Ÿ…˜••ˆ&UщЧQ-6E;)nЗЏœš}˜“™ЅК—%KRUZXVN/f›ƒƒ‹•˜“Š€ˆ“ˆ……”š‘_=„’„”™m˜ŽЅ•ЏЗХ–N'5ЭџџVdKCP8PЁКђ–‡ЂЇ—Ђ˜БЬ‘—ЦД!F^ct>-Ж­z™…ЧЬšИпуЩ—ƒkQ{ }/Z\\BЧۘΏЋВ›гЂs’‰ˆЗnŠБX)d[XŒлЛПУРМЯДЁЅœˆ—ГЖС№K\X35щмПЄЋЙЖЉxgjr’Бч;/[WCмнЧлщнОСЈ‰‡ГЊТежZXW џђщцыобЩОВАŸЃЭчџџK_^qџхщыљщсєЩЈдУКзјыџЖ`_>џџёьъ№иЫХВЦЮзжіџџџQ_`џџ§ќћіўщЖЁЧКщуџћџаa^Nџ№ыєјџјџпЪХЂhti‘Ј*^^[жЫ“ЈГЃЏŽЉ‰Љ‡ŽšiЃINZX_щЩКЯбсгфъХзЮџхлаМ0Q\Z6dphc`rAdXeKICB>;=<*‚Uf\_XUPIA!XZNPNLPUWX^\[^^^^^^ZXZ\ZVWXVcWWWkZm^XXcQPIIIHIHFHFIHFEFCFCCCEHFFEECCBCCACCCECkFTHCЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ5LLKJIIFEHEECCCEFFFEEFEEEFFEEEEFEFFFCBCCBCEEPUWX[[^\\ZZeVXZ[\XZZZZZ[[ZXX[ZWWXXZZUK0<;60/8>ILTX^_aeLECHHFBBEHFECJVti8RU^`pggeca`a[P>TZh4TXX\^^^\ZVWXfZaRN8KVsV==<<<>@BBCB@BAEE5PVji;AAA@BEEETILXLNLKJKJIHPWfc;8HHIFKJFHHJUFFC@@A>@Fdd[jLC@><<<<<;=8-I^d^LFУџУ)Pr\[QxЯПЄДЄ œ­вБЊŒyŽ€ŽŒi’ƒq’‘h‹џъE)BC2XВГЖx–›ЋъА'KRUZ[WP/gА…Ž‚ЁŽ‘ƒŒ‹ƒƒr=K›ƒ„ ‘ЁЫ“РРЪф…53'Ёџџ­N`KXg_A*“бŸˆ ЄД“ЃјДЈАЅЭ}APdwC)yПИcŠ€ЩЌОЯщз–ˆrwdv”А/Z\[Z}ихЅРБ­ЈШŸƒˆˆzqš„дЋXZZ80ыРРузбЙЧЌЏА™“wОБо‹\\ZŽЬтХйРЧГЈЊ’{‰Œ“ЈВдпLeW&ZаЛУУЭ­ЂЄ”aqs}КЮо™ZXKпіххснслЭЇœЄ—Чыяџэ^_\вџфёыјсмхЙƒДЮжячџџ80k^Kџџ№ыччееЌУЧУчјђѕџй``>џџџќџђљгЁ™ДСђнџќџk`\'џђ№єјџўѓбЂЧ›kЄ“ЈГ^^[ёЫСЉЄМ…œŽ˜}”…О0ZXW•џзЯмозыйўМШиђЯЦБК^\Z/‚‹pfapKZXPLJIFN<;=Iv3a[_ˆ\VNF=)TN[LJKN`WW[^^_[_s\\^\ZZXVVUVXWUTVWZz\ZaRNJHHFEHFIEIHHHIHHEEECEFEECCACEEECECEEIIIEFЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ5NKIJIIFFEEEEEEEFEFFFFEECFECCEEEEEBEEFEEECCEKTVe[\\Z^[Z[[ZZZXZW[\[[XZ\ZZZeVWVX[ZTNA;863#6@IPRX\_kfP2CTHEBBFFIFFI_\jAU[\adgr‚eR_a^R0U[k>PTUW[Z\^\\^[fXRBP5KVjg=EFJNPR_TCTPPRT_QP-L`d_=KKKJLLPRaVZZWZZXc*PXeU>LZJJIHLPRTUWWUUgR0PXrEP^QQRRRQNLLLPPP_UcJKUkv>PQ^R_QTNPLJKKIJLNX;PXmi3QRRUUTRNLNLLIFECA@BPZtf3>>==<=@>B@AA@@ABCFCJQXqPECBACCBBCIIJJLLJLWJH5NU\wQ>=<<<=)>J^W^=@Єљб…66Qi\[_pЫЙŸˆƒ˜™Ё”‘Ž“‰БŠŠx‚—cy“z;-ЗџыJBC23E ЄЏЈОЊЌЈ&KTWZZWP)e•ƒ€s|nz…}|}}ŠpQT”ˆss™‚џџŸДvd­џџгI6s€nZX[eWP0ВЖ—ЖВЪЂ‹–˜ЄšЌ{%K^d`/s•БЏ[ЂЄŸЋдЌОХБЄŠc‘ЂrЅЛc%\g\%2пха™ЙˆЩО‡ОЄ}m„ˆ|ˆЮH0XXX€гзУгЛЖВЋГ|y• Ћех>\[BЧЧЏЙщЭКЏВЃ}Ї™ЄЛРг‹ZWWМоОЬЮРЭЃЃ{srЄЋИЮџ60XW%џћпщђзЫГЈ•ЏЅЏфђєџ‰^^EџўщъъцчтЩ ПВсщчъџџL`^ЏџџћётѓЭЉЁХГЪэџѕџџim_&џџџћџьъАЉЙАгј№џџџ<^^oџљєјјџэаЩгА‚š‡ВŠ2^\Eп­МŠ™œЏ­И|Ёœz…Иf[VщаЮЧыйлЫРззхщзнЏУТi^e’zyroh^KjaPKNIFA>;@W\>ch^^W`P\@HILNILRWWWZ^_^^^i[Z\^g[XndWUUWVXXj\[XVVQNLFIFHFHETHHFFFHEFREHEHHFEBBFEBBCCEFEFFIEFЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ4LKKIFFHEFEFHFFFFFEEEFFFEECEECCEEFEECEFFECBEJRVZ[[gZ\[Z[[ZZZX[WXZZ\^^\ZXW[XZWVXVVNB<883%4>HLRXZ_ahR6FIJIFCBHHJI5R[jBWZ`cccdedcdgai5RZrQ;QRWfn^oi^o^[WVT\IIT[qL6FJWJPTRRRRTTPQR[5KUZW;==@>@@AAAAB@CFIFFPVfa6FFEECBFFEIIIIHIIIHFEHPXgi@KLIJKKI6IIJHEEFC@AABEP`Zsd5>==>;<;>J^X\BQДџОj[AT6Bi[^N&yЈЖЗ nzˆ‡ymy„ƒ’pm [kz|{—r%сџмT>2k=Bi\\\WRJQATKLIKLRVX[W[Z^\^\W[g^[^ZWXVUVWXVW[X[XXVPLIFHHHFFEHIEHFHHEERFECFEFECEEBEFCEEFEFFHFHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ3KKJJFHFHFHFCCFCFCEEFFEFCEEEEEEFHEEBCCBBACCEJcUZ^\[[[[\\\Z[XZXXX\ZZ^^\^ZXXZ[VWWV`PC=<64%2NPLJIIKKNRXWZ[fZ_K6Tem>PPPPLKLKNPQVaTXV_=@>AB@AECECCFFIELWysPIHHTEFEtEFFEHHHJIHIHE>>;8/IRXZI;УџМXA>^r‹s/Fn\\\4X€Є…pšv‚ƒ„“€svДyˆ’qŠzЧџъ…''HI2*^е=I[c_dP>PAМЧ€Œxtrrq‚‚ƒ…a['eˆ…’Щя‚QQ!Jмџџё<…I5QJ|‡^IXg^dE8­ЉšЏЁЈџП|;Qgza2R{ЊЉx^qˆ–‹ТŸ­ˆxxtЙеи&E[fXhцзОРУиŒŽ„Ч“cr˜‘—ЉДУI2[ZWqзСЯТ”€БŸ€ŽЃ­›А™ЫЩ/;[XJЬмжЧ№ѓыГЇ‡|vœВДвЗхё[\V_цЯОвАЂ–ˆ_ji|zЌУЏ§­^\Iџџ№њлХЧМАƒКЏЧдёъўѓN^_ џ§щ§ђєжОРЗЬифыэјџЋ`_IџџычпжЬЭРХОчјјќїџџTa^ўџќџіѓойВГжњќєєџїc^^їџџџџџџјлЙЅ}}……zŸѓ#I^ZpсРЇЂˆЋЂЄš‡œ’ŠjЯy<[ZAёстпзњлџМѓёзЯЯтйзs3^gB<Ђ‚}xz8[VT=QRPHACB)‡6R[Z[\WRJPPIKPLJLTW[VX[[[^ZZXZ[\ZZf[ZVWWWUXWWX[XZVPJHHFIJEIHHHHFFFECCEEFBFEEHECCCEEEFCBEEEFFFЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџCKJJIHHFFFEECCFCCEECEFEFEEEFEFCFHCBCEABBCBECIgTXZ^[[\Z\X[XZXZX[\[Z[^[^\ZZXWX[XWXUQH-<65-08BJQW\^a`WJHIJIEEIJJLJ4LWnWRZxa^`cqrh‡gr->UjhAZLPd[[Z\[Z[^ZVURN/PXnRIHEEFKLNPUVVTVVTTP/NWmRN[LJFFFJNP`VefXVVQ*PXnTNRTPPNJIKNPRTUWV`P0QZiAA@A@ABCEFFFEEHFITWtV8IIHFF5EFCCCCCCHEHFEE8\X^sQNLJNNNJIJLKFEFHEBCEC4K^XefKA=;#>KTe^J6‹ёЊB>L\{{|RVs[[\/^˜jp‰gzp„ˆm€r…t€eЂde€—n‘ŠЗОeœџџšJ03PC0!L)ACFL^K>nn*‚ˆpkhwyfod^W!3X€j‚UK)0'/џџџБ…ЏМЉP#2@Vq_JZ^gdT3ЗЉ™ЌВŽџo&BPhЉe4Z„vЇЗffz­w{™ИЅТ{Œx˜жэоWKX\'-ШбвРООеЋ€ьœPŸЇš‰ИАВ[XZBсХавчцмВЇ}LI|•™ЊЇйБ[ZZ'JщРВЊКИЧАЂ™—œ˜ВЈвиџr\\HДъЯЗ䣘‹ke|„”ЂДзоџ2-[['џїсмъоПДЌЂДТЮууѕџГ^^PћџфццтхЭУЖЊаєщќђяџ5)`[CџщѕфьаБДЗДлџ№ђѕѕџэaaLџџљјџхоУПЮьјџєђџ`^=џџџћљџіЮЮЅ…“xdЬъ^gXЈнŽЄЉВ}Ђ––ЂŒЂ‡zДXNXXLывђлУЭВыэоЯУ‹лђлгP>\f@ZЂ‚ƒ{v6eiUPhePJCEA%/Tf^\[T^IPQJLNZLPgeZWeZZh\[\^Z[\[X[FVWUWXVdWXeZWXVLIFEIHJIHEEHFFEFEFBFRBCFEFBCECCEEEEFHFFFHEHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ>NJIJJITTHEECEEEEFEBCFEEEFEEFEEFFECCCBCCCEEEImTWX[[Z[\\Z[ZZZX[[[ZZZXX[Z[\[XZ[XXWWRH><<5008@HPU\_ajXKFHIJHFJJNPL8KUjZ;H\_deerhfjZg|E3Rem>LLQ`VUXXXZ[\f[hV[5NXtaPPQQRPR^RPPPJHHHECIT[tQJLPQQQTRPNPLKIEEAA@HQ[rN&>>@@>@>@AACFEFTHEF6NUfm=JKNLJUEBABABABECEFEFFITZmXALLLLNIJNLHEEEEEBACCEFK_XiUIA!)J^e_B=ЄјЃPLE^i_Zoqv0=j\\\8dz{}np БzƒiЏЃ…aŠ–nƒДˆ‰œ“Пї˜зoCPЫџ§‰W>F^[ULJF%6)#WКˆea^ZCTRACBP-LQTF>4/6@;/=pйџџј^>ŠЭ–“‹ЈCQv–‚5LŠˆК^€ŠLfЂЄЈoЉКГуџz[[mEБЮЧПебУЪЫ™ˆ“|PОЃЃиОЯA8ZZX#ћфОУКУk–Ѕˆ…qŠ”œ ЄЙ>4\XIЧсХамаИБ–‘š‘ЧПлеёџ>^[30мУ УЈ…‘…}{€ДОЗуўъK[Xzџй№оЫТЬ‰™В™пећёјџ5&^^'џђутслЧГСЙЃхьыќўџџT_^УџыясвЛАЖШдўяёєўіџyc`%џџјѕљъЭЊАЇЧьќѕѕќџ55`_)џџџњџџпЭУЅŒzekŸмд^\KМзЇ š}Џq–“mŠo’“Ѓ3\ZX’нщ№ШизяьђоЦь№чЭСлQ\ZrЉˆ…ˆzE[WR;WVPNHF43a\^\X`PHE%\J[PLLPXZZX[\Z[pZh^\hhZXZXvWWdWUV[WZWdXUPJFEHHFIHTIHFFFEEFEFFFFFFECCCCCCCCCFFFFFZFHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ=KKJJFEFFEFEFFFEEEECCEBEBCEECCEEFFFFBCBBBEEB;gUVXZ\[[\\^ZZXXXZZ[X[ZXXZZXXXXXWXXWVTK><;80/6@ENTX^kae;HJKKIHJNPR\J=UeiQT^zecccpeecq}W'QdrPKKNQPQRWWWZW[ZXU^<=U\h;HEEFFHKPTV_PTUUXd6CPXon6BA@>>>A@BCECBHEEEIHIR[oVNPNLLIHFBAB>@@CEBEHJI3NV\RPNPLLKKZKJHECECBBACHF8PUXk\&>ci^B'ЙџЛBCJ[rI\jrrmkc&Emi\\J>pŠ‡ps›БŽ}Ž‚„ƒЂfˆ››z’zГpв˜ЬЂE{ХлИ|VRNXZ`cPLI8#)@AH6'0%-2-383NCBEXJ=8FT™Зџџвtn|зП™­”›Є‘C8PZ‚}`NX^ocQЏСЏR@LqЂZBPvŠ’œЦqr “ЉУИъe€˜щџМимH^^^iыЮЛЌЩОœ•zŽАе›ЉДЌtZXZ/UХЧяŒАоƒjyˆЋ“Ј™‹™лЗ[[Z*2РСцьЯЧГ™z„ЉВЩЫзаљЯ\[XџзПШ–‘„per˜ЈдЈРј‡\ZLлщщеЭжЗЃ‡Б­ЧлбўёщџP^[’џјјсхщхЊДсосћяјёџј__IџџїїхЮСЏЮ­нјёѕїјєџ6m^џџї§хфВ™ЄЪмјєџџџџE_`џјџџџцдЬБ“ƒЁ‚\РђŽ\Z@!оРЇ“ŸЙ—‡И™ˆ—nƒ Џ\\ZВяёяУіЊлвбоммѕЖЮиЪ\ge—›ˆ‘ƒˆ[JZcTUnWTNJIFNy)hg[WXVKFP[N`NKLPWoy\XZK\ZZ^i\\\ZZ[WWUVWWUZ\[VXZURNIHIHFFHHFEHCAFECFFCEHFEFFECFEFECCCFFIFFIHJЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџELRZ\_afP;JKKKKKPPR_Q;TZm@BXaoes`d`_aaci0PVnTLJIKKNRTX[VXXWdV_NP\N=NJJJLNPPQ`VXVN0RZjCAUUURRPPPPLPTUVV^J;RdiNPTRPTQTQQKNLJJFFC4NX^s=LLNPRThQQ[PIECAAA@2IUfm>BA>BAA@BABEQECCHIJKHNV\m>KKZLJIHIEFBCAACAAHJIFHRV^[CPNKNLNLKLJFEFFEFCECEIIRXZjL/'P\E@ВџЈPEJ\h5=Z„”qosЂi-Bo`[^J<}Єx‰w“Ÿ•ŠЙноМz‘pzБ˜™Ј ОЏЮЅд‚5aˆЈЉ‰|c^\LZXgVXXWTURTQPTTTWVXZ\RC[kЃлПы˜VaVПзИсsО‰‡t™‹ЂЏ>*BZr|^[Z[\aP™R%EC–Я^%j…ŽŠŒЄз;ƒЬЉЈзщaЯлыЦР'!^\\)езМКЗ Џ•Š”m’’ДЗРїЦ%K\ZZ™О‘ЏИХЌ‘whˆvw^pГУОэ`3\\IГянхйПЗЌЄЁЋЙБРфхЯсџ-#\Z;ъохЭЛor}pˆ‡ЌАЗЁпы#4ZZ/ўјтйЯЃ­–СОпьнётџО_^NпџцьсжЭЧЈЗЯхцяяхяџg_^#џўєоб­ЋИРЭџьѓјјџџџW`QџџџёјиИРОКвтјїўўќљ``^ѕџјјђілЪИ’Ѓ‹ykgБДџ<5\W2KцРУЁЅšЄ“ЇЉwˆ–cr™ˆ-g[KђђеліфЯяусечоуымв‚^[Z!Ѕ’ˆ˜ЃAXeX<[wZTNJH;P^4c^\[XTPH)2gNNKKLRTW[XX[\^[^_^_\gZZXXZXUWWWZZk[ZVWPX6IIHFFHFFFIEBFEFBFEEECECHHFFFEFBCFEEFHEIHJЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ6KJJKIFFFFECEEFFEEEEBBCCECEACCBACCBCCFFFFRFCFQVTZ\ZZ[\^[[Z\eZXXZ[ZXZZ[^^[Z[XXWWVXVZB<882%6>BKQZ\`chT6WKPLKLPRUWd3QWmT=V^k``^_^PRone0LVnh>>AHPZwe3A@@A@PEABEFCEFJHKLHJ^XsW>LKKKKKIIHEBBBABBEFHFEKV\mXPLLLPNLNJHJI6IJIIKIINI8_Z[sL0_FFЉџЃEAE[nP45Ii€ts‡ˆ‘30st\\\0k‰ЈЙœЮЈЈœЯЧЗВœТЈŸ•™{‰ЋŽХЇЪПЫgQCd|‰Ššrr_^\`[\^^\\\^`egdef€ЋЅРЏop2!-3єџ‹ђОЃWРŠЊ|Ÿƒ€Дz5PZkr[Wdw^#/A>LГn%o{‡‘šЯџˆj—ОzГбƒ™ЁзХєж*!\^^0ЙШУЅеВЂЬЂЌzy‡‰…КМ’Єтc[[f0RЯЖКЂЋ‘{pnkX€—šД–ИЉ\Z[5џџ§ЬжЉАЈЄЃЈЂМЯхлИіџP[[TџдТДТ•‡€€o‘БТЊбРхи[XW…џбЧЛЁЈšЅАЗЙЯєопџџU^^3џњц№щЮЂЂРОО№ыџѓђџџC_\wџ§язЬЂРЏдяыёїџљјџпd`Bџџ§щщЩЊБУДмјџјѓќџЇa_LџџљјџфХРЃД’ˆk{ЌЫџR^W‚ЧЉД“‘‰‘iА‰Ёe’|4\[AџтейЩхщјяя№онзччц{&^\K/Њ‰šˆ…”&WZX=^q^UQNK3xPPZ^\fXTNFCKJJKKNTVWeZX[[^[^o^^Zg\WXZkWVZWVVX\\[XWPKHFIHFFFFFFHFRCFFCCFFBECCFHE3BEFBCCFEECFIIIЮџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ<64'4@BEPPCEFHJILLN;NU[m=KLNPPdPKIFECEABBBFHHH8QZmfQNPNNNNKKKKKLZPPPPPcQW6Z_Zng>WIЄџЈP@E\nVL2FJPPNNNCX^_o4NUniBQQV[P`_aˆqt_^R3ResQLKJHHLP@TaWVWWdVQ;=Ujh>\PJIFFHJJLUcZZ\jVJ;Rdk>^VVTPJJFJJLN^TWngLLNPNPPKIIIEFFBCCFII[FJUZkcANNNNLPPLLQQRQTVUTxRI*3L`XeZ3|џ)5<;=ELVCU\hje^^ИџˆŽЙЗ^pс™“‡Л……”џџџЙa/QTmq3#IV=tщБ!3q{…Ђ„ЌЅЂАџŸ8ŠspW*Œ–Рагџ‰C\sNrџгПЩУПЦЙЧ‰…ЉmUi™Йд}0-ZZW*^хЧВŸaoexdnˆ›ЖЩЌђд\Zf4мяўЯКŸБЂŠ˜ЊЉОбомжѓљF[Z4)џъВ­Ћ€n||’ЁЉГЈЏУјёBWX&'њЭСЏВ„’—ЃВПЬьйлхџК^[NьџумбКРВССл№ъяёєџџЋa_FџџцхША™ЛРтєђџћџљџџIamЋџ№№уЧ‹ЏЩспџіџіїпў@^`—џііўџгСœˆƒj‡ЯЧџД_\{И‘Д›„–•Ш‚o€‚Ž…›;^WXzъЮмжцймєтфуэєђЫОЩ^[Z/sЅz•‰3[WQ4zf^WTQL;’!Uk\[eUPJEQKLPLN@_H\\f\oq`^^_^i[\[Z[ZXZXUWWUZi_`haNIFHHFEHFFHFHEEECEFFEECBBEFHFHECCFEEECFHFHIHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ6NJKHHFFFFFCQBEEFEEEFFEFFCFCCBCCBEECCCCBCBCCE=@@AEIILNPPJ3JTXvP>PP\NLLNWJJJFFCFBFHUF3LV[fV@PUTTUTV`URRTWZXVnP*)5\WZfN>Ж540JhšTVPF3Rdƒswz‚™ŽМдQF‰ˆLQN%TЌУˆ›ŠЋЇ„ЉУ‹„’ЁЋz™Ј’™šЂВ™ВŽЇШАЮ“ў2<‰ˆAA8K`EQ=483&)'=Ecn_fZRQVWZ^P>–џœŠмƒЄЃmч‚ЄZЙ›™ˆ€œ—ЈжжU/IKR0-NB8_е–*I„‹ˆŒ’šЁ‘ЏоthˆcxIД[všіџыA[o_LіъЫлэоЦот•”ЬЛВЃ‚›Žсz[Z[A5ВўŽ}гLtВvsˆЋзВЪ№ћK^[Z–џШЭЙ‰ЂЁГВЧШЯбжнџЋ\[X›ѕвБЄ›zŽ‡‹™ВЙУвГвьТXZXœѕКУŽ“nnq„œСйвЫЧиџQ2h\AџўотОДЂ“Щжі№э№ђєџџ*_^-џлчУБ­ЧвњщђіјњџљџџcaRџџєџаЏЄУанъџјўђъјёR``ѓџџћџмй“““v…p‚ЄфоџP-`^s<ЧГ•™“Ž`МЧЗaˆ–„…Ј0\ZXЫъЮйвеРщн§тсмЩЮЙзб[gX™ЌšŽЅWKZXABˆfmF5^@RŠ!V\\ZXaPJC!XINKJJRa[^^Z[^^s^\`p`^\ZWZWVWTTWV[[^^^\TPHFFHEEHEHHFFEBECEFEEFFEECECCFFBCCEFCEHEFIHHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџAKKJIIHEFEEFFFCEHHECEEEEBCCECBBCCEBCCBBBECBEE;gFX[^\^\^[[Z\\ZXXZZ[[\\ZZZZZZZ\ZWXWWTL@;6B/-5>FPRW[jamP6P^PTVZ`aet^UjkkPTZqc_Q`a\\\Zf0PXja@NJIKK8JNPTVZZWT^P6QXvELNNLJIHH8NPTUVUWVP*QceTPoVUPP[KKJIKPTVWVQ*PXkW3UmZXWZZUURLJJKLNV6NWoZ@UZWXW[[[ZXTQPPNNJF3QZoh>>>@@@CHIJNN[XH8PXnW=QQNPPNLKJLLIIFE4FEHHF8RZgj@RajfeXWkWVVXXW[V\))0F4;VdXhBJ<83mX N[RJFNNovw{’ˆŸ“—ЏЙyŒЄWIR6*›ЁУ™ЉЈоЌЏтџЧД“Ј™ˆчаdМ­ЅЇЅyВЖЏТЦFP^ZR>6_‰€… АЉЃЃЊА™Є•vkCJVURRRVP8‚џ\аœšГяУdДjЯ™™˜Ѓ‰…РЭТJ)6@H-TщјN2!0}ŠЇ–‘ЊЂзZxŽ}Xfoiџš­ыџВ&^__)&аъзЧмџџџоМ•šX‹”ЦћЁЌ­—I[}L’•ЁŸПwЏ‘[z„xЙРИЂољЩ\[\4'нхЗЛ™СЂ€–ДРзЮгдмфџ4\Z;уЧУЈ“y™ŸЋдУЪбьЩхџVZZIђџйЇŠˆ|™БЧбЯСзлўџH^[zџмхЯХГСофыцыяђѕѕџџa^^ЛџяоДУЦУђчяџјјћџјџАoc@џ§ічВЅТЫйі№ўјїёњ§Бa^FџџќџсЮЧЁЄzƒ‚}›ЈцџJ^^Vаћ —ƒ‘„–{^Jc{qœŽ'^\>џяЬбЙЫлйвооойаЪЋУЂ^[J!А’’•Б4LZX8`€gcoH_>Rf'V\ZXW`NF>/HNNvKLRXZ^[\^h\^[\^^\\[XZXXXWVWVVZ\\Z\jRKHFHERHFEFEHFEFRFFBFFFHFFRFCBCECBCEEECHEEFJIЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ;JJKJHHFEFHEEEFFECBAFECEFECBCCCCBCBCBBBCCBBFE8fWZZ[\\[\^Z[\ZZZX[[[Z\[[Z[[[[ZZZWXWTTN2<85/%4>CKRW[^khQ6NRTUd[`peg€#QXmU8TUX\^o_^[[[\kWeg6QRUTQQNKJJLPPRTT\6KVoiAVV[X[[ZnVRPPKLLKK6JV[n;UiZZXeZWXUUTTQP_IH5LU[jBK[PPPRPQRLNJNKJLJWH;R[|U5HJLKIKJKJHFCEEBAABENWfc>>A@CFIKNNNK8LTZrCPQPQPPNNNNQNNLJJHKIIIHKa\gZAU[pZXVVWWVXZ^kn4'IL\TR5W\[gU)/|ЮP™gXQK5;@™|^™‰Œ–ВЏ˜ЁЂ6^Й…FPJ-LЈГЏ‘йъЁУ›Ћ™ЏЦ‹ЈtŸЁœЩ‡ЄŸђ™ДЉбо#!IPVVWUP4ar|ˆˆˆŠЅŒŠˆi€Џ^RZWRQT)3aђgHЪƒЈEОУ{ ЗЧ‚ˆ™šЫКœРДЇХh%AB2„џлV@6%/{‰”™ЄтлиJk_NCU“йАўџџ/`mc3АщЭОШЅЊВ—BEw€„nQh“мЛЂ)8X\[0^мЃБ—Т„ЙУzЏЙ•”ЙЏэЧёў6![\^‘тРдט›БДЊТОЦЯеужхиУ\^ZvсЮЈˆty‘–ЄЫъбофъьџыL[[&HџУЊ…‰mi‚ЂЏЙзбхм№џЭ^^JъџътЧЈЌЙУоџыјўєіђџвa^NџэелЇЧПЪ№ыђџњ§§ћјџ*c_PџџѕПЙЫЧвтџўџџќэпџV)`^-џџџцОв–˜Йjrr€УВщіџc^[ЇЗЉŠЖrpЧЂСƒjt”noАv=\kAђšРВђЮѕнЪоъчеђИес{&^\A4П­œzjЇ#f\W/c‡|im\TRjV6cfZZVRNH>AINNaNNRV\Z\K[\N^^\N^\\^[VXZeWWZX[[hZZXcPNFEEB3CECFEEEXFFFHEFFFEECECBBCEEACEQCFHHHIIIЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§AJJIJIHEFCHFEECECCBEFFEFEEBCCABEQBECBCCCCBACBHRW[^^X[^[[\ZZZX[Z[Z\Z[\[[[Z[[ZZZXXWWVPC<852#5^RRTW^^P^j_qdP8RZrCPcPLFEHKPPRURQWXe3Pafd@RR^PLKJIJKPPQUVVRL=U[h>QQTVRPLNKLNPPQNT^L;RXsFU[g^\\\[VQRPKKJKJIId[wTQaXXXXZWXTTRRPPKJIE;^[tVK•iЖПџџ!^`ˆL™ъйИВЙŒmˆeCfdv˜‹ЃkБО|VZfE‰МŒ–QŠh‚ГМАЖУЅУЩхШ[[\2ѕлЙХГДЈЈЂИлцоъъдыџ=*\f[ОбЈЂœŠ УДРЫгщнсїјџЁ\XXЛлД fm}ŒЊ­ТШщУѕџ5_^5џщИЙЇРЭеХъщхђїіѕџџH__/џяЯЧЏЫвоў§ўџћџ§њџџUa^ЧџёъД БЊмјћџјіџщлџLk^ƒџђџ№аЮЈ„Ÿsƒf ЖЩџџХP^KЮ‡—™šЌЙЛ™‹y_ƒŠе@Q^Z0џлсёЯнэмлімСгциОЧHB\Z0WИ–Ѓ˜–[[V5vppja\ZU\sFTRQPPNKIIJJNNQVeiR%QXmQP_VUPQRPQPPPPLLQQX4KVjXBj^\Z^\[ZTURNLIIKI4PV\d/UUXXZZXXTRQRPKLLKI;RWgrAKLPPTPT^NQ\PPPTTQQ=La[nPJKILKJJJIIIHEBBCFICFPXfa8FFC\CCEC@BCEIJLKLNZBiдЏђџ/T_eV…пЮОАЄŸzgWzk‡ŸЈŸ•ЂДBekZ!лж–’›‡zŒ–ЁКХЙЛлщзяі''[[ZЄџмД Ћ—š‘МЂШЪиШеугщХP[W)^оЏŽšŽœЇВПйф№ъфђјьџ-[Z0эЖ’“ŠŽЖяпіуфмїџP_Z…џыОЪЋЋАеняэџџџјўџџT_^ŒџпЪЅШгмхэџјјњ§§џџќd_PџџљРœГХУјџєјўёђсщџ`^^їџђђмвДЂ”ˆˆ“Аїњџs^^E2О•‚˜™ЫŒ‡—xrgq˜л#^[W‡џцЛнсфсмЮЪоЯќЩРхQ^Zˆ–˜•Иx'eWFE‰qmke`^N“Te[ZWWRJH#FKNNL=AV\[ZX^^__`^[\h[WZZZVVUWWXZ[^\^I[aPKIHFIHEHFIIHFFFFCCFBEEEEFEEECECCBCBBCEFEEEIHЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџBNJJIIHHFEEEECFFEBFEEECCBCBCCCCCCCBBBABBCBCAC4LXZ\\\[[\\X[ZZ[|X[[[Z[Z[ZWXWXZZXZXWWW^I@<65-08@FLRW^`qe=<_VZ^`dmqtc#R[oRNLPP_WWX\^[ZVR2PXfZCTRPLLHHJKPPTVZXcQ8Q[oUQTRPP\LIFFHJPRXofn*=WeW8VVUTTVUWVUPPLKNPL4ITdZ6c\^_^^KXZWUPNLJIICIR[nATWW[ZVeVUTQRNN`LPXIKU\nQKLN^QPQQPQRQTUVgRd\3R\vX@KJ5KIHIVUEHEFCFmICEKUXsT4EFFFFEFEFFEHHIJKPNN0PWkj8ЂТz8C@=ПѕГИЇЄЁПО’Й‚‹Џ˜vЌrŽЁЮ V‚П;LQVWZXR/Qˆ”oЉ”šŒЌ—Ѕ‘ƒziвKQ}џџp-pq`n^2’џ_˜йy‡•‡yўёџЫЯаjUџџ•&J>Џs\[ecUЙСбџ‡UqfAL’ЉŸмыJJdydjСЛСШ‰Єxej}ki–Ѓ€tСАЌ@6Z[[25а€–ƒ‹ŠPoВЏмЛЩмвжъ“\[X36сзЖЋkМГЉБЏгдЯащгињE\kBБиЃ’‘ЙЦбутђ№хтџеN[Z‡цЅ›{o“ЂАысямцмлџЋ_^IфџмЙЌРТСыџыяєїџїѕџсa^PфђЮДЧЯцсщэєіљћџ§џџy`_0џњоЄ˜ЫСпџўџјџэфКџШa^Qџџ§ўдРЄ‹t`WŽЭзџјџP^\dАЊЉЈ|Ј‹Є‰…}hcX{–­^[XУџожоџяыаЪояэдйщх\[ZЏЏЈ™”Џ\C\Z>I‡ƒo|da^PŒ-`e[ZdWQLF%RKNPPPTWX\p^^^`^[\Z\^\ZZ[WWVVWVWZXZ^q\dUPJJIJHTHFFFIFFEFFFFFHFECCECCCCECCEEBCEFEEIHJFЭџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџћALKJJJFFCEFEECFECBBCFECECCBEECFCBCEBCCCACBAAEF=s^^^[[[Z\XZf[XZXZZXZX\[ZXZZ[[ZZZdWWVUNB;86%#8=ENTX\`ahQIIIIJFIIKJIIEHJPNPQ<=RXtXHo^[[^\\WW[\\[\^_^^^N[#EdXgZ=E>5E\ЇџџUPVe\6-зџ­v-Ae`^T'rk{FTNE6>‘…{‡ ДЄЃ—ЄВЃАУŒrэОV6@=8 РШв‘…ЋšЖ™ЂЌЄ”„ ^™œТ˜3Š/KQVXeZT'>№a‚y‰ƒzp„‡mof}‡pРџџОKŽm^wK&f№Œ\rzЬ’Ž’ŸџЛРВ–5)нџќ==R_­hNKXfdEŸџџ2pƒhJR…“ЈДВ0'JU‰UkЦЧ­ŸЈ“ze[pt|‰šŒ—dЅ­KXZZB%ŸЩЦ–Ј‚ŒŒŽ•Ё–ВОЏДВЧьО@\fEАъЧЋЄ•ЗœЌБИОЧьКйиЭњЪ\\['FоБ™… ЋГЫЮиЮтщъщњџCZ[JолЇ™{“ŒЏОззмоъфсџ8^[/џэЙЧЛОЧВєщтяѓєѕѓўџ2^[5џъЪЋЫХ№чэђѕјћћ§њџџE^[‰џнЙšЄЧзљўјџіёџоЭџV)^^*џџџхзДЁˆˆr…‘Ьѕ§џџ`_^ОЪ‘ŽЈŠВz‡zwpZrР-\^PўхвѓРђцњсХјѕоїбъєЈ^ZXЙ——–ЂА'\[X2wŒxspga^_w#aZZXVVQHC-INNPP@RcZ[\LisjnX[^^\ZZZ\ZVVXXXZWZZ\^ZVTNHEHIFHFIFFFFFCHECFIFFFHEFCCFECBFFBECCCEFIHJHбџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџ§ELKJJHHHFFHFHECCEBCEECCCCACECEECBCBCCECBCBBCCCV\q@JLQ^RPQQRRV[[[VTWUL8RfhWPaLLIFIECHFFFTHFEFHEJT\jTJKKKKJNLPLJKIILPPQ^^3PV[f>[h^[^p^\\^_aehdV^ndV@2>[^pCZјЮџџџџ^>Wf\8BЧџУJP-ХxkmmcHhPt-VRH23s™‘™ЁЅ ™ЈЇЄГ—ЛВЅЭџЯC’сЮC5;4AmоЙ—‹–—…““ŸqИrŠ В˜ƒћГ}KTUWZXU#џџyiГЖВwHFpX›тџџџџ%Fzap{># яˆUkaе‹tŠsŽЂˆЄZ-!!Ьџџ‚‰#KBK€e[W[feVЩ–WЃnIFhdАЖ/*QdŠf`ЮОШЇ•Љ…qq€f­ЪЋОЇи“Т­XWdW%ˆЫš™„Ђ™Œ”АЋБЙПхнУРјt\^[iљЗЋ™ЁЂЇДВЧжУЦЬнЮЪХџU\[ZœЮР™ЙЙЗДОЬијх№ыї№џўFXZ^џАЂŒ—ŠŸжУЮдхчмзыоQ[[џШЙЄЙОЧжўыјљђєћђџџN_Zџо Шбъљэ№їџ§ўќћњџџa`\ьџЦЂЉАгтњіјџќњђЫмџJ^^ЋџћќОЧˆ…ŽˆknšГлј§џЙc^[ЙОʊŸЗwxypv“КQH^[4џЃъйгђяьтџфјЧеп§пk/^ZA<ЧЃ™ЁГ\fU'z€y„qhe``X4gfkXWVPH@AULNP[NUXXZ\\^^\[[[^h^Xf\ZXZXWWZWX\[^[ZhQLFCFFFEHFEFEHFHHFFEFEFBFIFREEBECCEFEFCCFF4HFJоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџAKLKVHFCFEECCECFBEEBBBCCCCCFCCBABBEECCBBBBEEEE8dZ^[\\ZZZZZ\[Z[[\[Z\\XZ[XW[\[[XiXWWWWQC>PZ^k;QQJJFFCBFEFHIHIHIFJ4RWgd5JJLKKNQQPPNNLLQPRUiP>RWo\<\^JVUPPTCXFa8!&LP–Тd>\^^#офџџџƒ-h\^=>КџrB5=6џџџJr`__EДB4@KF&QŽo”ЌБ˜ъМЄ–‹ЂЇŽЇЌЉ&бџЙ>!2@=СђВŽ‰‹‡m–^—ЖvišоЬC!KRWWXXVBјўџџџџџѕыќџџџџџџ–EЈЄТvzsa)Кџ‡U^cЉŒkv”Зˆ‹\A џџРR}єk#8LAidIWZkjU[qˆETr|qŸЁ=2Pa|j=хлРМРщщЫ“‹™Œ™ТџпŸУбге%PX\cmsvkˆ€f-UgoFRTRPPNLPTXX[ti/LXvZPPPPTUTT`TVVRRQRUWW6>V[tFKipdZ‡jovCizзсъџџџџџџ^^^Bтџќ%0Zg_;8ТџЦ*@WZЪДЁj8U^_^_Cхы>8II;qЄЁ›ŸЁ˜•–Б ВŽЃЄ™Ї ™ЄО‚2'пџЫP308%emЄ„Žp|hƒvˆЄ„—}ьmL^WWWcU)EЙ…Ђ™—ДЩЪѕџбпrih}Єчв€nˆŽHnџбfF^tАfvvzЛйF2#Лџџй-4 Є…Ÿwe*8LTj{tIJZ\eWA&stLavqm)8RgœKkзђьјнЭЈ‹}…‡˜ŸВГМЦ—ЮОЏ=[[X85мШВ|› ЂzЄЧаЮТыДоѕљ=!\XXЯЁˆ…ŸЄЉЏЈКПХбаВЙщлўN[kKŒтЏЌ™‘ЂРЬтлэѓыјьыџџ6\[-4яп­Є•ЂЙдЬЮЛгнємъџAgZ2JсЇšš’ЯЧсячы№ђѓѓџџџ#'_\''џњЩОыќ№ѓіјќќў§§џџ6a^XџЄ˜ЋЩЪјџјјіяхгмлџk^FџџтбОœœsˆzЂЏтцџъјJ`_4nд ™‹А™Ј‘‘jtkJo‘jЃ'\fWЋщлезлмппџЮыЭЯВЧъф\XZ™Дœš–Бv4\X>AЂm„yqwfLˆ/_Z[ZjXRNH#EKNPPLQTTV[ZZ\[[h\\\^^[\[\X\WXXXXXX[XZXWNIHEEHEHFHFEHEFFEHFEEFFFHFHFCECECEBBAECEECFHIFоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџќEKJJIIHFCEFECCEEHEAQEECCCBBCBBBEB@AABAAA@BAECBEIRdZ[\Z[Z[[mZX[[ZXXZZ[Z[XX[XZXXXXWXXXUW><;5-06>FNUZ^crm8PW\dkt˜|–EfgVR`UPLJUX{TKLJLN\PUZ[XX\m\[[^g2QZhe;__QKIFHFFIHIIJKIJJI5QZgnBNRQTUXWX[[F^LE8AEBd_-TX\\-’•}|wPРђјџџџџџџџџџџџ'^Z_5Jџ>X^^FIТџF>X_TXA4BQLJTŽm^Q68ЄЖ3A<=ŒƒzqƒTŽЄm˜ДLRVWZUT'IчўџџЪšЄŠОИœЯШычяџ’v›Љ‚2хџЏVc;zŸZigefZ4#AМџџэ=)}ЇˆЯ‚pwˆe0-=U^}m\XX^jV44UE_|“q/@Pf˜nzђожДЋА‰ˆ–{‡‰ŒА–УДЛЧОыџd\[fBƒКЌ}vˆx…yЂЂЊЬЯВРдЈеџˆK[^;*еБšœŸЄМЖЪЋЗмЪиШВХцРKZ[/;сШЏŽŸВЧЫфыстцъѕыѕџЈ^ZX™з”Й­ЉЁДыьщаПЫ№ъзџ­\\X!Ъ™”œЙЫлјъяђѓўђј§џc`^ŒџЧЈЯлёѕђїџњњќџўўџџc_[Ъџ™КТПђэџјўџътУмчџ*5^^AџјыЭИ—˜{ŒЙЩј№ыџЫ^^`вЃo”„Ÿˆ|[n\q[‘y€'f[HьщЮгычиЯМсоёЬазХх \\XЙВ›™ЁОELXXAZ”z…wpxgcŽV[\ZZXPLF2FLNLKNPeUZeZ^^^^_^\^^Z\\^^^XZWXZ[XX}XXZVPJFFHEEEFFFEFCEHFCFBEHCFHEEFFRHCEQBBBCBEFEHHHIоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџћALLKIIFCCFCCFEFFEEFCCBBCAQCBCBABCCA@AAAABCABBBW8QV[^\\\ZZ\\ZXXWZXV[[ZZZXWWXeXZ[XXXZW`NA<85-%6@FLTX^_ciE3Xafkvƒ|}ƒ‘!R[n[NУџЃ/JW\H-0#*>HUzP^<KчџёjTdU“Сog^@')*)Uяџџиh™Ј–nc‰’ye#&=Q\…{^LZf[WPKLLK;NPU[^_^[X\^^\Z6Q[ge8PPPLHFIHJLJKJIKLNPL-PW^fHXaimps{™Ђ˜’Ё˜ˆyivmAqi`хџџџџџџџџџџџџџџџџџџџџьa%TX[^R2N^L\Мяv)JXdB#!2200344;4CŽm^\K8TZ^8ГЃ ŸŒšœАлŽ€€˜˜“ˆƒxŠ˜–Ž“o&rџџВ\3<^I@&\z‚РАУ‘ЏятI\VXXZT&@џџџцКпгŸУЄЁУыџЯЛЁV‘џџџvp^j‘зnU6&C-0ЃџџџЄ*ŠЧ{…xƒgvLz||ƒy00LQ\x|PXWZmf2Pe6KR‚В_ˆлгЖТЄЉ ™|…–Ђ пБЮТбЮлЯмœ;[[^6Q’А ‡iy˜ВzМВЇЇЏЯУСхіJ%\\X;NЩЁ{z‹ŒЃЛйЅеМЙЬЮЮќЙP\\8<ЯЖЛЄ•мЩытосуёхщъъџУ^[WжЌЖ Ј­ХЫХзлУ№вэџхPZZ&tЯ€v…ТТълхъэёё№яџџ>^^TCйЧжКвѓэђѕјћќў§§§џџAa^-UђЮЌХУхњ§џўџіуЮЯоџт`^QџџвДа–Ÿ’v“Ћз№ёіжђ>B^_N=Ч…zЈВЄ”TmUoch|‘Й5^^WeчЧЂОаЫудѕѓоРщфטёQ^ZfИ  ˜ЂЏgZW|ŠvoiyX5cm[\eTKIACJXLNKLR`WZXXXhjp_\\^o[[p[[WVZWWZ[\\[X[VPPJHEHEEECEFEFFHFFFEBCFFEECBBCEECEQEFCEBFCCHHFIоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџњANNKKHFEEHFHEFFHEECFEEQEFECCCEEEECBBCBCCCAABBACHcWX[[[ZZ[\XLNJZZZXZXWZZZ[ZZ[XXXXXXVWWQF=<;3#3PPIILNUV\^spi\_^jvA=V^xFPQPPJLi;JLLPW[q\Q“…Œƒ—Ž’—™ˆЂЁayR5mŒБP^^BIџџџџџџџџџџџџџяйг{NKA@`d[pP6CBoяџŸ=HUaA5000000022264Tz}a^W8*ЬОA\ДСЂœ™™Д Ђ”ŽŽ‘ЮŠrˆŠ|i/_ОџмŒ>4LIC;Q^Žd^HZrg0VNFВQkтЭУКЉЂš•’•’{›ЏДЄЙЮМЏоЯ<[^[5=˜š‰iUeŸšzŠ’СЉЖ„џЯл§ЃJ[XH0ЋР’‰ЄЈЗУиКйТолмяџ3!ZX[аЂЬ–Взаиапфивцщёђџ''\ZKСЫЇГЈЁЙЧЯОЪоспъухџq^XJЄ–p”|ЉМЏгътщьїьоыџі``\ŽоУЬиъыџіїјџўџџџўџџd`^œРАЗлђјџјіѓёўЦДцсџk#`^8џѓМЛЏЂД’ŒВЧжџѕжоуP_^*^…–ЃЌŒ„Š`j‡Us{twК^^JЛззвЭаснъэцџСјЮШмџ_ZZ–ЛЏЈЄЈ{&fZV2š‚ƒŠ|tok2@m\[ZVRNH%CK[PNKNRUWWZf[\^a^^[^q^X[XZ[WXWXX[\^ZXXWPLFFFCECHREERCCHCBEEECCCCEEEEECCECCEEBEEEEFFFFFоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџќANLKKIFFFRFEFBBBCCCEEBBBBBCEEECCBBBCBBCBACCBCBBHeTW[Z[\\\\\\™XZZZZ[Z[X[[ZZZ\ZXZXXVWUcJ><83-0;AHPUZzecgC;jksˆ€…ˆ™ЄˆRZfWW[ZaRNJJJLQfVPN;U^xBTWZ\\WcRPNLIHHHNNILV^o<[\ZWWXUUWXVVPLIJKJ4PZjTQW^\_cQa^\`^XUQRPP;=Vfn6W[hn[^^\[\pa^\^[ZQ0QdoU@PRWVTUcVWZ\^[WH\snBPVfi>NPKILNQRVZ[`^``__`[6RXmi6PTPLLNKNNPPTTVWZ^a-AX^i@r™v‘Ћw˜ˆ}šДЂщџщџџџџPZ[apџџџџџџ§ЮxwХџџћwC…ВЇ…nˆŽЈyf‚e—™e‚ˆ”‹=B\oPWL00QP_А™@#ŽђПЏЂЂœ•z“—™­ŸЅЮЙШЙЮгб4-\^zK)ЊzˆВ‹ЋЧУзлЋдЛЯИ№о;[XX*€Ђˆ‰‹v‹‰БЪЧуцвагзоџХ\ZW86ЖТВЬРХЯиоћѓхтфцччџыP[X/_ЯЉsˆЉеЮџщп№щѕцђћџ5\X;[Уƒ„ЈЗеящслцыяыоэџgk^PдОоОоєя§јјљљўџўџ§џБa^EгвАЪця№§їѕђњхбоєэџN^^{џООЏЂ˜v`ЏеынщчЮф˜^jiР‹… ‰Оzmp[ivRv˜Š›Хh^EџхОЮЮбѓмёїєёХсРŽџѕiXXКДВЈОJ=Z[=V™‹‚Šzwsp•R[gZZVQKF-HLNRe=LeWWXXZ\i^^^^[[[X\WIWWZVZXUVp[[ZXaPXJEEFFFEBFEEECEEEEECQCCCCHFECEEEFCFQBCCCBCHFIHоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџіQNLKIHIEEEEECCBBABECBACCCBCFCBBBCBEFBBAACBBBBBC5PUWXXX\Z[Z[ZN[[XXZ\[ZXZXXZ[\[XWWXVVVVTL@=;5-/8@EJT[_eniR5_kt‰|‚…‰Œ˜Ђ#AWmZCX[WRNLJKLPQT_\;T[oHTZ[K\\ZVTPKFEHLNNJ=T[pFZeWVUXWWX\XXTNKKK[6LWkZAW[`ar^a^ap^[[WT`QK6RWsTEi^[[[XX[\``_s\[kf/KUoh=NPTRTRVHZ[^\L^_aarU4RZkUP\NKLPPRWX[__deddes8>VgoAB`RAARRUWW\\`aaffm}RWZi^/ЏyŒЂЧРфџџџџџџџџџїџѓI^^P‡ц€zN!2B0CHKLRaV%Ja[f[8{щˆ6@V[%%#*2222/0/-/-22#@L‡c_kT*&вЭ“ЏšЏЈ€”n‡ˆƒp`’€jdk}}r˜|ye8)tЄбЖn[PKE^FCB684%*-!-ЌЩяўџџџџџџџџџ§‰s^w'%3%'/=FB=@Q‹ЪџџЬˆ&œ„…ˆ‚pt„…ƒXccoˆp•ˆ“‹ˆ™У™8@[АˆC8;VArХš82ŠДИš˜…Ђ’}”ЄИРЖзЛЛТлж3[[i\5}ЈАP’de‹  ЛАДЧЙЄЉУЛЧтQZ[Z=C›nˆy›’РЙРоехооиђёџ3#fXKЅЌЊЄЂлЯхытчщххђіхѕџEZXXАЉ­…ЇЈПЩЦясёяїџјіџЅ\\X—š˜‘ЅДАЮщяххњѓјыщўјP^\-=ьиЮУтљєјљћћќ§§ўџџџ/a^0QДЗСПпѕђііџьхвысхџјa^`тџЮЩЅ™ŽjЂЖоьіџЯбз^2^^^ЉГš—…‹rqiEKhVoŠбg8^^4-џнЪипЙЧмъсЯЄваЯсџ^\\B/ЮЉŸ ˜Л^\Z*|Š‚zt}ƒ!Vf\ZXUPJFBINPcPLPVZ[[VX\^_^_^[gXZZZXcXVVZVUZZZZXZaPIJHCHFEFERCFBFEEEHEBCCCCFFCECFCEFHHFACACEFFHIIоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџђ@LKJIIFFCECBCCCACFCBBABBCFEECECA@CEFCP@ECCBAAABBKdTWW[Z[ZZXXZZZWZ[[[XZZ[\ZZ[WZ[ZXWUVVV`B<<60-6>CKRV\adjV4\t{|’‡ˆЂЇF2Vmg>Z^fTPNNKKLNR`R/QXkZBX[^\[XUR^NKFHKNLK<^ZvXHXXTUXW\^^[XVRPPJJ4HTfn6VgkdaQmcq_LZm[ZZVP5LU[X5WZXWZXX[o^^ac_[^sA=R[jCNPPLPR`W[n_\^mc`dkX2PWoi8^PP^PRXFV[^^cfgjms^0U[pZ6q[We[[__`oeg\jnvkn˜-[^`š§хђџџџџџџџџџ§ыПЛyaF=^^Kџ*4BAA@@@@CCFK^J#)EQi[^^)m55PT###*<22/0//---)*0*;Z”hQ^V5'Р •ˆŠ‰™x’{pЁp“ƒЂ–„ЛЃze/!`nХЉœŒgV`P[ahc^QPLJ/%08IHIJKR_|БЧооЈT&#/gmЃgv‚„z‡šЄnrƒƒ…zzЂЂгщщЂFJRzQ6@EBЅщ„0-‘Б”—‹—„…‡ˆŠЈЄЊЂГЗЭИРУдEZ[^^2jЈ’{|ЃŠЅ’˜‹ТЂЄоЌЖЦЙВоNZ[V6ƒ_Š– ИСМЩœиуУззЬъџš[ZX2VдЈБИЖЙельыящхлчщхџеN[[8^КЂ”БЮпиОођщезіьјџ=^fCР›–ЈЖУьдлт№щщлъыџџПa^^”сОЬъыўїјјњќ§§ќќџџџd_^™УБЩйљџ§џћящЦПдзєџ•`^EџхМ­{wzx˜ЈОУѓ№хЁЪбT^^H2™АЅЧОgoed‰ovƒЖ˜О!^o_“џШпТџЯбйэџзОаЯХжџB^[!WСВЁЋ­Z\VЁ`„‚{hqm_*Xg^VURPFE3\dPPPPQVWWZXX^_^^[[^[[WXXVUWVXdUVZoX[XiVPHICFHEEFFFFFCCEFCFEFBCC\ECFHECCFFFEEFFCEFFFFIJоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџј@JIJJHFHEEFCCFEQEEEECBECECEEBEECEQECAACCCA@BBBCC8fTTXZ[[XXZXZZ[Z[Z[ZXXZ^\\XWZXZXWXUVXWQF=660#4>AA@@>>>BBEHE#>@HI8Tg_j^<;P[&%#--/-/*)*''&'/&F[ЌŽP^WA0*tŸб“qŠ—ЄЂ…}qv“ƒo…qpnˆz‘М ДЄƒP=Rƒ­v^^[[[XddZ[^PNIEIFFJEECQQNQ_Kcdfz™•УМЊ\)=LPV}™qrompexz{zzj`Ђ Šˆ‡‰Є|ЂАлЪзїЪ5@F4Uај\=-^›{jyzy‰Œ—•ЈСВЛЇЖПабd\[^g;PŽnNcŽœЈЄЇЙЏЯЈЗиОЭИB[XX=eŠ‡v}” ЫЭЗжЯвыйЭляёє5Z[I—БШЄТдпсмЭхфмёіщцєџ^ZK#–ЊЇ”ЧлвзлящъѓэяєџєQ\[`ЮЊЂЊЌухЭПёћъхЮщъџџ2-_^8глХџјёџјњљјљњќўћџџa^KАЧвеёэњіѕящынмєщџџ6k[_џШУЃeŠ…f‚ГвхьєщУРОa^h‡А™ŒД}rrgaU}„xjЖСИ[`\ОєВЦЃзЗКсЧѓњПаѕРоы_\[#ЂИЏŸЛ‡'\sE4Ї“ƒ‚wr„85Xg[XXULFBBJNKNN;RWWX[\[___^g[^[WZZZXTVXXZWXZ[XZXdRKFFTHFHFEEEEEFCFHFFFEFEEFEEEFCEFEEEBCFEFCEFEFFIоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџјCLJIIIECEECEBCEEQBCBCCCCEBAECECBBBEBBCCACAAABBAA3aTUX\[\ZZXXXXXXXWZ[[Z[[Z[ZXZZXZVXXXXURI>;84&2;BIPUX^aa\;A|ˆz||•‹šЗtRZnZZqm_gXTQPPPNPdP=RenHT\h[ZXU`TPNLJIHIIFJT[nBPRUWVZ^^^_^[WVPJHFCJVjd6W^`m_a`[X[^^kt^\XP0QXtVP>TUZZ\^^^^cnPmk\i>@V[mBJJLNNQVZX^``dddedad5PX\dBdmZXKXXVKPgjnsy}|•pUZh^>zpfgwpqenhwx€ˆОаѕџџ-\^c/Єџџзв…ЄДЧеъјџџџџџџџџџ[[iX0-;<=>A>>>@>@ACPB)3VPL@PAd_`_Z>P_%)-6*)*))2'/)'!3U™Џ\P\RPC)ћЇtЈГgvoorn˜z‡‡‰ˆ›z}zЈВ‹‚——šЮмСЇf)0Pcpwxzsj_aaa_`a`a_``^``_ceyzŠЂ‰kjK*)'-HЭdcaRj’‡Tih[ioor…vt^oу”‹s{Ž—™ляСОЭиЙ%2A)[џф;&AN8^{…PWQae€‹ЙАЙИЗБПГЭДм‚K\_^AB‹’{ywFš“˜Б ВМ›ШОЇУДа62ZX[@>pLvŠˆЂЏЊСШжЯпиъёзй№џr\XZZОЏТСсдльпфццчъјѕьџйP\\<=ЏВПЫулосцоъјяэђџW\[BЈЯЄВвМецпяящъђощъџџa_^)eыШлџќђїјћћћњњ§џћџџ<^^5BЊОЯоъ№єѓ№іўлОсЭщџџa_ZДѓГЧœŽtŠЅРўјёмлБЏ–^^[ЯЋ…УŽe‹zgIF[ofi‘ЦЄ%_`EќсМй•мВЧЮМѓыИйвъџЌ^\LМ›ЈД|КBE\e*FЄ…ˆ…ƒƒt˜`Z\ZWWdKF2ENcKNLPRWX[\\^^^_Z\Z^\[kXZVVWXWXWWfZWZXWQNFHFFFFFEEFREHBFHFFCCEEEBFCQCFFCFFCCEECCEBFEEHHоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџѓCKJKJIFFCEBCECCCCBBCCCBBBBEECBBB@BBBEECBBCABBCBB5`TXy^[[[\XZX[XXZX[Z[XXXXX[[XVZXWWWXWWRL/884-#;>FPVW\`mnF0r„{{cˆŠ™’ЉPXh^Ckdd^[WTPPLKL^\%PWoVBegZUUTVTQPPKJIJUF6PdtU@`WXXW\acpZXXVPLKI46QZmP^TZf[^i^^`ddc^PpV0QZfW4NJKKNRUW^__R`fhge`C>V[tFLza_^NN__gorznn{ƒ™8)[^qB^ikUTwjpЩ“ЂЏИОѓёЮќџ„3__V*gјџџџџџџџјјџџјјўџљE[\oR3)8=<@>=>>>@ABA!3LeZ[FQ5=Xsk^c@Z!%&''%%!!###'Q‘ЮkR`[UU-АБƒ”‘‚Ž™ŠЂ˜ŽЋœ‘ЄъŸ‚›˜ЯЧŠ‚аСЛЛуД›ˆ€Q)%-ATV\_ors{z‚vzz‚{}mttvsewwWJ@50%/28Vqw{™џ_Nk^“\WNgsfWj€qqdqZˆЇ…ЂЂ{›”ЫяЮпОвУC*N<>Ÿџ›#'ЃLRQ>&ZaHmchci„”ЋИЈЙЊРЖЩХgK[zoJJ”‹yyNx™ˆŽ—™ˆЁДjЄЈЋддW[[jW2p|‚Œ˜ЄЧЮвсъвдЪимммжїаP^[E%КХШПЧвсцпфэјфхщщэћџ[XZ#œ ЏБРоЛмх№їєэыыэ§џџK[W%PЦЮУмчмщёђмщъщџўџўџy__[ЏЮЫмїёџџљњ§џўўџџњџѓd_[˜ЯвлфџњєјњтВЫмъъіџО_\PњХ—’ˆ‹tˆ•ИЈйъџъУМЙdB^gHсЂЖАt€c\caag}^…sР<>qpKџоцыіЪМАРсдсЯЭЧђџJ5^g/@ЪyŸЁЌШ^\X#ƒВ—„…{zt’V[ZWWUQKH3TNNNLKNUXZ\[^`^_[^\XZZ\[Z[XWXXXdXWg\ZXXWPJHIFHHIHFFFHFCFFCETREFECEBEEBBCCCECFEBEEEFFFHHHпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџь@NKI\HFBECCCBCCBCBBPBAACCEEFBBCACB@CABCEBCCCCCCACP_Vp\[[\[Z\[\ZXWZZZZZXZWX[fZWZZWWXXXWULB<;60-6=CLUW\anpU2d‚||™’‹‘™‰->c^mBivcp^ZUPNJIKP`=>>>=>>>>>'BNW^_;ИsBfŒ^kVJ!!3`А‘QN^H;3џœ™™•——›ГЉˆ”“К…|‚™Й™w ЁЌ}›РмИ“•–ЇжŸоеЧА-3NV@@KIFEJAIEEPFPQFLC=CZ_xFPџџ§џјјјјљљјљјјјјўџџƒPi^n`H/<<=A>==>><-BPa^`2FяџД%!Pto\jfC'!#VЁдqIRXF_сЦЈ››Ÿ ИВ™™‹Ї–t“˜œoЮ sЊ{‡ЄˆЗЅмСЙ™ˆоE-KX{€WP@K|jUcaLfQKKaacfgmy{“Ž–ЇЅ‡‹ЈЏ™‚˜В–š|NUQ_`^`Pd{^Uzaj’ˆЃƒˆШqОЈŸЁЗТs8!‰џоFCcЈ‚BWVdaPAT^`Pqz•ˆŒƒ”˜ЄЙaJ^onA@{ghiUv}‰–‘”zЩ›ГБ‹ЅеХОЉЊСЭвзЩѕѓлхтпяусыј-ZZJƒСŸЙЩдојђќёёёяя№яџџ@^[22еєРзђфяђѕэќіыяљeДџЄ`^ZƒХКЯъчьђјљќќќ§ўќљџџN^^#Pвлфќќџ§џієсллылџџџc^\ŸџЌš“tŸœСяџџѕлЊМБЖ^\^Л­Ћ˜Œƒxq…IaenxƒŸАЙ_^\оєчымеЈхлбфУЫЪМџх`^JуАЌЌЛ)^ZJЋšˆ—ˆkyH@@@>@>CPXhK3`јўЌTFPr[\jd;!&4zЯГQK^A%яŸЏКИ”ЏДЂВДœ™›ё™}–ЦЛОџЊŸ˜‰ЯŠzˆЉЄЬђж›КРГ3CLZ{UN6cДЂz„ƒm’П{qtrn{‚t’|}ˆxˆˆ’”˜œАЧ™“—qrzQ_\^\^VmqLJa{}‡ŽŽ‡Ћ™™™ЃЋ•A@яџ‰3QN’Ыg[XZjXQ)H•m…Žˆ™‰•{ ›a)L[_xLIkpXFUrzw™vЋЂЫВўЧћЯКЛЂ&3X[XF8„‹—ЁЊОЪЭаЬёггжзлззуєм>^ZLˆЛОЬЧужлнјут№ѕосъьў[XWEЏЋЏЦсйиїээёђєєђ№ьџ‹^\IжђщщффШ§јэяяёџ­-џџ%>_\J*­ЌЇбољьђџјњќќўўќџџЌ`j^™ыёѓџўієяијуеЮчёџџБ`[[ъя—‰i‘ТвжџјџяДЄ‘с_<_\K0Э Цz}so{gg^wk•iуm/_^CџїмџэЦвеХеЯПхШЫДџš_^C*ьЄ­Дˆй>N[j8TЈŒ‹”ˆƒz)EZ[[XcUNHFCKL=LJPVZ[[\\[^i^[ZZ[ZW\XVW[IXVUW\ZW[\ZWRLHEHFFHECCEECFHFRHFECCCHFEECEEFEFEEEBBBBCBEFHFHHоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџчBJKIJFFEQCECCBC@BBECEEBB@ABCBABBBBCBCCCCAABBCBCCCFaUUZ[[^Z[ZW[Z[WZx^[[\eWeXZ\XXZ[ZZZXZXTKB<;5-/8AFPV[\`niF'{qˆЂ™ŽЂJ6PWhhA\^_`__\ZaQP=LK8LVmj=aUW[\XUURQTQPJIEF2NXm[5UX[^_Z[WVccUTUaxQL5QXsUCV\\ZZ[^^^^`cwddarV4Q[^HNNNNRW\sak^aadcea^A>W[nFRWVUVWZ[^UZ`N[eWimЏ6#[_q*ЅгМХЫђнЂќЯЩУчЩхмгЭє53X\jB-џџv-'&%#џџџJW^deџџјјњњњљјјјјїўџџ#Eo^fR4>=>>>>='4PX\U5eўџ‚QNX2;L>Xm^ic;!#%TВхx4KPЯСЙЋЃЃЅЈšЗЂ‰œš…|—Ћx€€jѓМŠ€‰Œ‘ЊОБДЪ0FLUXXTN-U’xPspPK‰etИЃdypjqjtŸЁЦй‡x˜ДЁБŠ€}Šˆе_NQ^[Pg›ЫLojЯo€”‹–ŒŸ‡”™ЈЈЉƒ*”џџPIA6J>Ag€`LX\kcT)I€‹€‡‡ˆˆ‚ [!LLprL@cdZkp\ˆaЈ}Џœз›ДˆЪЫцбX2XXeWtЂЉГЙДЪЯЦК­нЦгзйчтжёџ^\[[%JЫЦбЦЬбчмнсэтссднеф№@ZZXвЩЧощуъјяяђєїўѕљџџA\[)#ЫоэщјхяцщъльяџџpРџоQ\Z2IЖЧЧепяоэѓѕјњќўџџџџ6__8жб№џ§іѓящжтутъ№іџџ&5^Z-4хЄŠzyЂДгЛлуџђ–ЙЛЪR[\3VМЁх”rwmih^qˆŠk‰Њх'P^h-JяаЯыџЖмояыЯЩЗЬЭтџ)-_h6oЂД–ЃОД#[ZW€Д›ˆ„Œ}y›T[gZ[URLHCHK[`LLPgZZZ[[^[[[[[h^\XkZ[WXVVWVZ\XXZfXVPNFHFFFFTFFFEECFFCECEECFFEEEFFCEEFCFCEABBECEFEEFFоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџт6LIIHFBCCEBECECAACCQBCBCEEECC_BBBCBBBBBBBBCCBBCBBEZTUZ[\^^Z\XXXXWWWXWXXXZZ[[[[ZXZXX[XXXVPC=;6-#4>CKRZ\awjVdˆN‡’{™З\H5W^qX^zdoc_^^kWRP[XH6T[o8TVUVWUUTUUTTRQNHF4Kf^sARVW^Z\g\X[VWVVURRP/NU[i4RWX[\\h^^^_`pcaecn2@VjXALKKRTX^a`^adggrddm/RZ^[=e^^^QQCF4We ЧзсђџЮC^aF2яџєсџпфњаьУ‘ВЋЬлџx^Z`cџџџ…!--%%#'й%J\`\бџџјјјјјјјї§џџё'„^jjnP/>>@>='BPk^K5iџъ8>LXVV_>CZg^nk<#!!%/zвоU@E'V^ЈРЗАЋЈЈУЇ–Ÿ„š‚Йš…ˆw›ћЫnŠ­ЙЂ‡„ŽВЄЂ“Љз!I\VVXUP8`‰g_[KREsANrЃd`Ѓƒ‹ŠŒ‘—Ќ Дƒ”Ѕ™™ЯЈ‚w‚‰Эcisa\J‰a€XЇЄ’dz€ˆŒ„œРдˆ6\џџ”™ŽgHEHLHaŽ_HW[\dR#HР‰p„Ё…L)Z[ppZH`}j\t}…ŽˆеЩƒЏчиЗмВ‘Яцm\[fW-oГЏЄ‘ШУСЧЪЬЮйвдзиыцсџš^\\EЙСКЦЪЮмЭтмномщэохоц}[XXXКЯЫумсњья№ђђѓіџћџџ™^^\–їщЮсђщщъщщь№яфћ§§џh^\LŸжСаѕумѓяёєџјњћџєџщa__‡ћоѓёѕџџџЫРојжэџјџџW_Z”Шƒ‘Ž…ЂПзхьдщлдЗгЙ^^X•ЖЁ™Ђ|qifj€hy˜i’­`j^‡џЏлџтОџёпзИмиЅдўћ_^\Я“ЛЏЌЬЌ^[V!ЉЃŽŒˆƒ€|w‚a^\ZXTQIHEJNPN=QRUZ[\^^^^^_^^_^ZZ[[[[ZdXXWeZZZJeZeNIHIHFFEEHFECEREFEFFHHRHFFFFFEFEBCFECBFCBFEBFFEIJоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџщ>KKJIIECBEEBBAECCBEABCCECBCCBCBCVAABABBABAABAABBCBI^TXXZ\\Z[XX[ZXX[eXWXXXZZZ[[ZXWWWWWXWVPE>862&4;CIRW[`dkW0Pœ’‘œ’ЂЏVV2T\hZ8whcdc_ihWQPNNKIQZtVRUUUXTUccURR_RNJHCHTXkXBTW\Z[^[ZeXXXUUVUPKJRXvQ=RVZZW[\^`afqdce`gP;T[jRKLLNPTZ_`neehhhijt@CW\t@\dH6U_otРбпСотсищџ2Z^dРџляялэзЙМ–’ЭыјџџЩWa^d•џџџ‹#*'%%&&'&‡HaaCџџїјјјјјјіџџ№џџLrq^jKB@><&EPc^A3aџџj>@>@BACHjTW[ZZ\[[ZZ[ZZ[ZZXVWeZZZ[\[[ZWWXXZUVURI-863&0RWeZX[Z[ZXXWWVVVTP/NV[VAQTVWX[\^_adgedd`iV'PXkWAPNN@RV^`dg[kkaqroeT[n[)‰ƒŒЖ•™ЋЄВТахэїћџіџџ>[k6!іфТОЧКбзїџџџџџџй4R[cRџџџџ‘/)*&#!#&''mџ•`_cgџџјјњјјіџџе)џџџџWp^fVJB;AZa[T*cџџ|B;XIXZ[^^gZE6xp\jgK\UI40-*')&&&%#%&%'')*--/228C>IЬъ‰-F8!)iМТЮждО­ЈЄƒЊ”ЙГ{…‹ˆv|’œ‚И—yˆ„‚ŽјУKQRWXWR8Pˆ[8vŽyЉ ƒzi‡“ЈщџП‰™…kџТ•Ž‹ЁџмwrXcR–’kXkrsveop`h{Ѓˆ<АџџŠ<=i{J@;5;BF=Wi‰`LW[fiTEƒƒ‹Ž66Z\oŽ[TUTLahv›‘ƒАџгЙџјДРЄБ­ЙЋ0X^^@/”Ї…ЇБЦВоЙЦдзЯТвбдщЯејN[ZZ36ХЩЈЮувжггмРгузХеЬтџHXZWaмгтъјчёыь№ёёєџќљџџ—_\\„ѓяыьјлћъъы№ђђѓѓёќџw_^^ŽЭУгђьєоъоїёђіўєќџџF`^#Aџџ§џє№ыхЦоЭлыѓјџѕџ6_^INз˜tx‰ВтемтыоДЋДЩТ`^[2`Т}Х„WqhzPk^ЈŠ™}џ2Kj^*HЙж ДэдмЯѓ№щбяаЛяџ[/_\Bџ”“z_‡;_[Z#qЗ‘š—Š‡z•AXn[WkTLKIFXP[KKLUWf\^\[i`^^\o^h\^[WZXZZ[ZXX\ZXXXVRJHHCEFEEFFEEFHEFFHREFFFEFFFREEEECBCFEEBCCCEEFFEFIпџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџёPKJIHFECFCBECCECECCFQBBABBBBBBBABAAABAA@@A@AAACBAC8jQUZZX[[\ZXZZZZWWXWWZX\^\\X[XXZWZ[WWWTK>883'08@FNUZ^_doH&‰’Ѓš‡ ЄКC[=>Uft5^cc^^[[[WPRNKI^4U\kRPTU[ZXFTRTTQPNLLJEKRid@PTXZZ\[\\X[[UVXXWR0KUii@PQRVWZ\^aaawhgackf6!)vнщъЮЖБЏ›Є””ˆЂЃ‡ЂЈŽƒУР›œв‚ЅЫ{‰f‚Є3KPUXXXV8fЬ–ђАУЇˆЛџОЙЗШПмЇŒ‰Ÿ‘Œд„v^о–rkƒwŽUQQrjadpŠpop‹t{m^knp™nR#‡џџмšx2P[5-*08>CLAh`IXZ\ZT0!€€C6PK{y^HPQVX^f_z„С™Є—™“Я˜’ЩЏЗвЛ42Z[\L-z­—‘ЈПЧСУШЧЛЫуЮЯфЮЮмо”P\mE˜вЮРХЭдсвагаРШегсчяЩ\Xe2ЪуЯлуххщыэёёђѓєђўџџ;\[;лэщ№цлоъълыхѓ§§џљџџK_^=ЭСбмпхђщьысэяђџяяџ–__\ЙџяѕџєёщсЯохљўјјџџџT`[’О…ƒ|ŒКРЯмќъ№бТœЏзВ`h\Є‡||njdUe|s‚ЈŽЈяQ`_ЊЦЄЏіџяяУлзРЫъЇъџџP\ZЬяЉЄЏРЭ^ZZ&•­“‘Ž}Ÿr{œRe^^WXQKIEJLPNLLPVX\\[\\^`^__^\[^[ZXeZXZXZ[WpgXWVWPLHFEEHHFEFFBFFEIFIFFIFFFEEEFFEFCBBABECBCCEECFEEHIоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџэ>JIIHFFFECFECBBCCBCBCCBCAABBECBBCP@CBBB@@@BBAABBBBE`RUXZ\ZX[[X[[[XXZZXZZZ[\[ZXZXXXXXiWVUTN2885*&4>FLTZ[_cpW&cp—„x™™ЂQN_3QZmWW[P``^v[WTRNJI;‚T[pVBTceZWT`TQRRPPPPKF8PXjV=RVZf^\h^[\XVWXXZWP-PWsUPLPTTW[^`cahgffdcaZ3QXoWCTUHJ[aPofqo|t˜ДЦь™K^aF[ўєщщђмЯТЮсоычђџџџџИ&V\cKCџџџ§јјјјјїѕџџЬX^a[цџџџџŸ#/3&##&џџџс)^cHџџ§јіџџПCfџџќѕџџI_s\m\&!3Wc&Wјџ/EXV[^``aa_naj^H2h•c`dPI>5/-''&'%%##&%'''*--/-//#AXP%3ВџђW'8@oСпцЭЄГЊЅБ›˜™zˆ“’ˆЈ˜ЇwЩЮv‚•>VRTX[ZT-P“™˜Рœ˜”Š‡”–БГŠrƒ“–ЌfLЩџЪHŠ`ˆztd‚mJeWvzgƒ‡pjzefЈgH)!pџџџc>‹гz&^A'3/'%%&2>FJQiš^IXZcsF-=ALdБš^TQPTX_akow‡‘™ЇЂЉЏЩ­ ЄI'Z[kH's˜ОЂЈАЮЮЦШЧыЖЧЬЬТЮоЧпЮ3\\^rЮЗдЦДЭодаалщСгзжгцђ'![ZZ„ызђсэщщщьяя№јљ§№њџЂ^ZZ{ђнохъјыьэь№ђѕіѕєњџЊ_^\‚тчхуцщъыьњјэутъц№ћ;\^*ѕџћјџў§ЮоЇоо№їџќџџa_IЮ—‰•‚МсэытсцмРДЏРr0^ZJВz›ddXpRTgjy„ДshГš&p^\ыџŽЇџъсџќзбХсјмпџЮa_[џД—”ДЩ“\fWЏЊ‡|‰…sŠ|Vf[Z[WQJJFJKPKKKTX[ZZ\\i^^^\^_[^^h[XXW[eZ[X[\^XXX`PJEIIEFEEEHHFEFEFIHIIIFRFCFCFFFFHEBBCBCEFEEEEHIFIJоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџзAKIHIHHFCECCBCEEABC@BAAABCBCBBA@B@BAAAACCBAECBACCACNTWZX\[Z\ZXZXZXXXZ[ZXXZ[Z[Z\\ZZWUWWWW`aH><6/)3;CLTXZ^mk[0\^€Ÿ˜ЉЅ­XKe4PVm\E[[iiZZUTTVRPKH/@XgeATWXWUVaTQRTRNPPNLINafh6QTV[\^^ZXZ[XX[[[eh3NUekAPPQTU[\^cegghsgge{8>W^o@^ma`fjekTУОЮтщуџџ[`eђџхихЛЈ ЁЏРЙОџљ'3\_gоџќјјјљџјџџџ^qџџI^cAџџўџџЈ%)')%&&чџџŽ^`d%;џџўџџ ‹џџџѕіџџ@8_j[jP&3;Q‹џџ—#JWW\^`a``cddcnahE/_ƒa^eQB''%#!#!!!##%%&&))**--0vm</Кџтh%4C!ЂџџџыСЉЂˆ™ЊК|ЃЏ…‡m‘­p‹pcВ|…@KPUXXXR6Rz|€›‰tЄ|Ђ‘Ї“ыџўаМЧ•yŒsƒzyšџџ}[Аvq›–w[yJTgq€šypgnpP5-'{џџџpyХ€y‰ZH%43430-'&>BIEjˆcPWTW#8UP\’ŠQBPAQUWchnrtitˆŒЙ”‹ЛЏЛШыМR#X[mX-Pš–­˜ЗТЅТгеЩШЩЦбЫлвТвл;'X[\8>ТУдУШЪЮатЯЮЖдтфйео§—N\Z2%тязых№ъѓыыьэээяэщџ§;[Z<пїтѓхыяяёјўђђѓ§є№џџ'`^=РхыђщщѓўѕьяђёќычщќУ`_\|џљџџџџџјяЭѓэѓјќќџџH`Z8IЯЈ™šЄИузоъямзЮ ЖИЬ)Q[W@FзzЙykd`^T|UT‚ЙŸЛEBa^C&ОС‘д’зџЬРўИЬЙупзџw^^2џИ­ДЉЯJH\\;=Щ–“Ј‹•tЅB=i\ZZXUPHH5VKZKKNRWXXX^^___^^jj\\[i\XZXXZXXX\mZ[[WTLIHHHFEEFFFEHFFHFEFFCEFECCCHFCFFCEECBAEEECCEEEHEHIмџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџм>KKJIFIECCCCCCCBBBBCCC@ACCCBABBABUAAABAABBBBCCAECCEJgVWZ[Z[WXZZZZXZXW[ZZX[X[[[[[XVUVVWXXUTJA=82'0;AIPTZ[`cgB4ЅЊЂšš–ЗZ5gLLVgp;X\n[WXVUVaTQPHCIU\wBRaXT`TVTTTVTQQ^RP;KV[sAPPR[\^Z\WX[ZN`_^Zi=>TXiCLPNPUj[jnfiikhZ[Wm^*R\n\eˆ\TXg`šЁпоыяч§ќџџУI^d#tџШ­•–ЂХбђі§џџgЖE^c<3џџјјјјјјџџЁ#џџџfL`hЏџјџџџЙ0&**%#&&эџџ\`gŸџџџЌœџџєїііџџ;>JhX[cQ5sџљ{5JFWX[^`ccaeffeedmnV*\c^e`0'%#!!!!%#&)''')**A\h=%0=Ќџиk)-*3ЉыгжӘ€˜ДсЇˆЂЗ’ГЃ™‚|gtƒ”j’EKQVZXXT6Pœ›‘ЧоƒДЂЮПšџяЈ‡}™“g‰ŒГЈ^frj{waT^d‰yEc€jЙЉ€Ђq}^X4&2yџџџJšОœzxr0'8;868J3/!6@EKF|‹qZ83HUH€Э„K;LP^VV@ennswyŽ’v„ˆzЌЏ МХkJZ\^6HЁЖЂЊБУЪЪЧЮКЧеКЧЩЩзЧЧmL[ZBˆПУПдЬЬЯбващПвжлщеяй=\\PЈжфосхѕъыяћјќяьщщјџŠ\[XtэхЯслыэ№ђђђђтєўђыџУ_^\wџѕъџяыъоыя№јёэщуфў`%^_IьџџўїџывјхчпяїјћћџџU^X&–ЏЇŽЃЈеъцзяоХџзЮДЙЃ^[W&‘СzvjddNJ„cƒ}Єг^`hkЧљ‰жВїгЈЄЫЉОТыяњџ<_[ џИЙЖДУP^[ƒД—–”‘ŒЁB[^^WXTNFCEKLLKKPTXW[g\^^^p\_`^`^^n[[\[[eWVVX[[\\ZTLHIFFEHEEFEEEFHEFHECFHEFFRCECCBEEFEEBCCCCCCEFEFHHHоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџфPNJJJHFHECEBCCEBEBCECCEPABCBAB@BBA@C@@AA>BABCCBCCEE8kRWZ[^[ZZ[XXX[Z[XZ[[\\\[\[XXVVVWXZZXUUPB;;4%#8AFNUZ[_m_V*p›œ™š™—И‡!PPKT[mWUX^[XZWTXWTQPJE6PXkV>^RTRTVTVWWTRQRRRL*RekXPQUj\\[^X[[\ms`^^gV4^VmVAPLPRX^^Kfjk`ewxz–’EW^aH ™…ˆЅЂЇ‘ощџџўџџџџџ=\_VтќћџџџџџџџџџЩNџz__VДџџјјјјўџцџџќџџ0^dFџџџџџС&2''**)&&&ѕџџ3^dQџџ™Бџџќїјїіџџ66)JVefi<>==>>=<<68=@3&Xa&PFTŒШj5=NIJLPXre…oq‹wˆzŒxy|q‡W&FW\mC8zЏ™ШВšДšЏГЧОйРСУиуОЫПЅ#6ZZX%>КДЉХуКЯноЦйЮлєміфїАFZ^;иѓоычїъщыїьыяў№љєъјi[\X€ынлђъьяѓђѕјјјўєђъџиT^^hџџоёџєё№фыэљџълњяЮz_^PПџџїэъуцЦЯып№їћќћџџR^\8\ЅЈБ– Юиэ맹йРҘЫЦл&Q\X>PИ‚z|gLvgWtztЈЂЄџ`4^yIГДЈбЏšЄЙџмЧЧЬАиьџЅ_^CџщŽЋИПs6^ZB-­ЄŠ•’™‹”…sX^^ZURPJJFIKZLKNUXZ^[^^acmm^^^i\hZXZ\[\ZZXWZZ[ZZ\WQ8HIIHFCFFEEBECHFJHFEEEEFFFFHHEEFBBBCCBCCCBEECHFHFHоџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџщCKLJHJHCEBBCEEEEACBEECCBECEBBBA@A>A>BBBBAABAAAABBCCCJQUXZ[[X[ZXZZVVVZZX[\Z\X[[^[WXVTWZXXWVRJ-;82#4;CJQV\_dcg/@Ÿ™˜‹™ЄЗ“LJ4LV\jTZsRATWVZ[^p`^__dadedz[)RZoUQgVUV\dˆ‡ftaqЏ›дДBZpA@џљщАšŽ›‰˜ЛпџŠј0'Z_IџџіјјјјіџџE!Ыџ§џ‚Q`eЏџћјіџџ@Ќџ§јјџџџ#n`T№џџ'/0*&&'§џQ[\`a'Йџџќїјјјїіџџ&;=3;Pi\f[5^8rбџе*3B<3/)rЉИг–˜|p€Џ}r_qv<JPTXXXT8EЌЇ–ˆ˜˜kГВЪn—СЈ‰ДƒšЋt}„е№r‰…fTftpwz‰…гоh5&-&*Z№џџгRA>><;8686!&NE5Nё’NC4*HLLLBX^`Wzopt‡tˆzyx„tze/EW\mX4…œ‰ЗК•УЏМЁДЦЧЈвАЧВЄŸR#X[[CЈДММПУЫЫхоцънолчифпї6-\[_eњяыщщоъъь§яыяћыщыђцI[Z3олжсщыяђєіјјјјіёь§џBj^Kыџџѓіјієєё№№ђџіфѓјЮH^^/џџщъяўнжзо№ьђјџќџџзa^XВ‚’Ÿ•щнљјџягЬРЖТЁ„\XW‹Ђ{„mhVeiprs{ЁzršфP`qZщЄ™ыТББЅџхоЗсэгџ<_\2џў–­ЋЯ-R^Z#rР—ЌЄ”Œ‹ŽœA2Z^mXWUPIIHIK_LNPVZfZ^[[_^`_`\^^[[\X[[\[XZWXeX[X\\aNFHFHFFEFEFFEBCFIHFFFEEEBECFFFRCFEBCBCEECCCEECCHFFIмџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџь@LJJJIIFEEFCCECCFCCEBBAEBCAA@@@A@AA@@ABABBABBECAAAA@5`VVZZ[[ZZXZZ[XXZXZ[\[Z\Z\^ZXWWVWWZWXVTL>;83&/6AHPV[^adn>&ВЁ˜ЃšЊЌ*>JH\^\^c[XcTqЏЯРм§џџџ\W^aЈСЇ€–Щя§џџџїhџЧJ^eЄџџјјўўџџДiџџћџџ/^cUџџџџџŽdџџїјјљ§џіPcd>2џЄ/0''&&љџ^^qeЛџџіјјјјјїѕџџBZHJP>FeZ\\E=PPUWX^^^^^^``a`mc``i8E@8'-PzЃT_i^@%&&&&))))))))''''&&%;PCAPZ=ОХЙT!ВџяЇ[4Ao|VIC=IIQ;K6B334%!;H4‡џВ4LF3H6H_QV[_`UffZjoaqs{zmh_4W[hzW3[ŸЇЙОЊТ֘Є›Д ГШРЏЉЁЄvX\[[ƒШЭОТЯЫЪЮТтЬыыынсбсэ[[Z4яўєяъыєыэьээьяњщђып=^[[ŠјсцчєяцєўјјљџїђящџаJ^_Kџљѕџљјјїіћђ№яђулнЭ^^\џяужіхМЦЪяјђўњќјџџ8^\J%ЄЅzЧпц№фђћхРлСДЄБXK[WV)Ј‰[z\dfnrvwgd‹hеЄ`k`ДсɘЩЯ’ŽЏЌwжУхвџџU^\ЖџзƒПЪЧ^^W— ˆ–•“ŽˆjЈTj^ZXWUNHIFIJNPPBUZ[\\\\_`^^`i^^^\[W[[[[eXX[ZZZXfZ_JCHHFFCFFHEEEHHFFFEIIFECCCEAEBQBEEECEEBBCECCECCEEFFмџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџыCLJIJFHIFFECECBBEEEABABCBBBABBAA@AAAA@BCCB@@BBBBACA=-aUWZ[[[WZXZXZ[ZZZZZZX[[X[^\[XWUVXWWWVTNB;;4--6>FNUdZ_cpVdБ—š™˜ЄВ*=KKJQZgZCXXXZXWZXVVUT`P/KUeh3ILPQVX\fZWUXXX\jW0NW[jATUVWV^_^Pahginno‡N*U^mAagB>UdvЈЈЧџќњџљјћџлW^`6#џџџџџџџџџџџџџ)^aJџџїўєоџџџџџїџџМN`ftџџџзџџџјјјљјџџLRaeJW’џџГ2>*'%'џџZ^hjQаџџџїјјјјџіџџь'PdTF>_2Vf\^d>NR`cW\[\^h^^^^^^_^\jKA;4-!%Jo…yR^dF!%)-)*)-)')***)&&%')4K@0IfE=ъџбRЙјѓ›V;QAB/584>gŸˆ‡–ˆ’ЁГ6X_UVdcQ8IГЇљЮЖЂЪиЋУЏОЩМ™ЈВАаa“WPЊ‹ }ОЩswjC!&52B‰џџџЏ0BRPLL[^wRcfnW=JKKPXhjmm%022-)*))%/LB>Їу‹F`^VQP6KcV^pcsc`adgiiged`J6TW^‚W<^zЃЅ˜œЄДЄЂ Є˜ЄЃи˜•ЈЄxW\gL&JЯЯЯйЧЬжЭМЯаозы№яХэзШ=Z\FЂџыфщђьяьыэќэъъіщфыЈ\WZ)хўафыћђѓіјјјјјєёєџџA&^`Hоџџјњњџјієђђ№ъслэОЙB>^[AџџыыиЯŸЗЬХђћіјњџјџџe^^0hЏЄ‰ЧсЯмџјовЏЋЯОЪ‘•8^^XFcšnggf\sm™€‹k‘…џp!_kFсіжЌЁќ”ЧИЏЬК„aзыџЖ`^CђџЯœХЭ^\ZЧЅ˜––Ž‰‡|ŠV\\ZXaRKKHHKNNLPTdg^\^^^^^i\^^\\Z^Z\^XXZWX[\[fZJeWQ*CIHIFHIIFBHFIERFFHFFECHHCCECCECEFEBBBBACBAACBCEETIлџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџхCKJJIFECEEBCCCBCEECECCABCBBABC@ACAAAA>>AC@@AABCAAAA@'F^aXZZ[ZXW[Z[[XZZ[XXX[Z[\gZ[XWUWVVWWVVPH=86/-5>EIPV^_cm[0>Ј–›Є˜ЄЙ5;PN5NUmtCWe\ZXZ\XWUXjZTN=RZrQIJPRV[^[WZ[^^^L^ZQ5V[tURcWUU[^_eijm}e{ˆT[h^;wŒe™ЛјџџџџџсЬлзџѕE[`eџџџќўўјџџДЙџўџЋK^d џњіџџџ8ъџѓјјџџџ`cVџџџ§џџјјџљјјјџџ#^`vTWџџџџЛ2>'%&)џ„BaX^_-џџўїјјјјјўџџхRX\QFrГ5kv^mZBRTUWZ[f[\\^Z\\X\[ZVL>4*&%&EdЈЃW^hK--*)**)'***)*''*'&4>BBFIHCTZ^`__scRccwa[FB6UW^{Z8Zo‚|ˆЄ‘–—Ќšz›ДВЁš™šЄЅŠy*AA@'@^UVZ\[Z[Z[ZZ[XWk\[WX[[\X[\XZXZVVWWVXVRK>840*28>HPW[[`nr>•ЊЋ›˜—ИWBJKVE0T<'ЊџЭŸб—e;&fВОщЁcEKQ[LIA0%0-k)&&HXLI0<ЧšŒ–ДЂЏ˜ЇЃџАЈЈО‹œЙЉsЄВ{Z305FE6EHvВьџыˆ^FА›”{xazpcoezXNIEFIKTW\^Pov!%IW6tџЮIAXm{gcHZhU><^TXz\r\__^ETL3Q[^’^BE\c\Œ€”‰’”ВК–“ЂwŠВ‚B4XZ[BЂасШЭЪЮпбжъЯаыРсЩЖКЯpZXk4щ№ъђхлхъъыјэ§ђечмвЪz\[[!'џѓђщ§ђєїјјїјџіњэчёџ@^^Jсџљџљћ§џњїіё№јфмсРДV;^^Qјџозад“ОПАх№їџўёџџC^\B<Ђ ДЖЪЯ№іцъЙРЙИЛлВŽIQ\[H>fcPdwqi‚˜rВЏŒ—‘-\`sГГчаоˆˆ—zПуэУџџџK_^иџєЖЯЪ^\\zРxЂ™”ŽŠ„›!AABACCCACCEABBCBAAABABCAABEBBABBABAK5ZTXZ[\^[ZZZZXXVZ[ZXZZZZ[Z[WZk[WWWWVVV_LA;83*/8@HNVX^adkVЄЊЄ›ЃДi=RNJ5Pd^Z=[\^^`^^Z\Z\[WRџџџ§џџ2PZ_JџџўјїџџzяџџјџџЈX^eЋџџџџџџјјјљљјџџ8Q`f-•aџџџјјјњњњљљјџџAh`oZџџќііќџџЪ0>)%%%&*0QZ^VnџџіјјјџџьH[^L%iџџЊiKhq\\WRTUXXXXWZZXUWXVRRP\%)&->}мˆP\_J**)')&%&&&&%#%&2>FNLZF^B8&zХЙБИ™xiW%\yШт™˜nhJPN\[ZHUAHF25'5„‹xzz“‡|nВ‡}{“ZK8#&/);BBIIH\rДфтЏr-PR‚ЌЖ“‘ˆrdvPgdxyX@HFEF;Q`Z[_^Rfo!!!'VVUsXWaU^N;R[`pUPTV\amr{˜ƒ”ЇŸš€Š‡„}„A5WXmE‰оЪнлхЮЙмсужОЙпЦЏУВЙДEZ[[„џьбтяхчщщщымчыиЭГБГ%6[XEЅџущьјѓѕїјјјїіѕјщоўХQ^^џџѕџњџќћјыєщяј№цзЪЪ^^\џџйдфЏЅ•боЮфџїџђўџЉ_^Z*{ЅЗЏЪбжэЮ­ЙДšЗЊдЈ^[Z=^w{c`Fck…k‚ЈaТœЧrЭgA_`KџВЯаАc˜ДЅ‡ˆЊАџЉџџЄ_^@џџЊПК/^gZ™Є˜—˜ЃЅŠ’šVt\[ZXUPKIILNP[PRWe\[\^\a^mr_\^^^Z[g\X[VWZJjX[fZek[AEVHHHEEIERFFFHEFFEBCCEHHCEHCABEEECCCEEEEEFABCEHFFJкџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџь@KJIIHFFCEECBEC@B@BCBECPPCCBBCBABAC@AAAACBBEBBB@AACK6C[WZZX\^[ZZZZXWZZZWZZZXZ\ZZ[ZZXWVXXUTUQF>;50-5>CJQW\_dr[%KŸЄšš›Й}EXRN;NVgk>k^_``a__[_\^ZsU=`^xU>NPW\^`sa`dgfjn”e-TXfXZr^[\PLNIhВЃЬќџџџџџ@EW_`PГџјќњџ‡JV[eЁџџїџџњtџџјјџџџK[cNџџџ'ђџџџљјљљјўџџ@_deCџџўјљњљљљњљјјџџјW^`rќџњўјііџџЮ2>*##%!%&[V^^ZŸџџ§їџџфU[_L)kџџ€8PP&FNXp[g[ETWZXWWZVRUVQRRNKW##!*\В­hJ[`B#4CJQ^fF-BN=8=hСџтЃŽtˆZ5/\–ЛŽ˜yed^[\Za`_U^^[PE84)6''''*4CKA\^N^PcWj•ŸЖЧЦ™qBLv€ЖОУЉ  ™ŠУ…’rwy^T=HEFFKPPWX^`_ehm’–!FV!qѓџkACIA_šiPZW[dU@RTZ[^LWR`kˆ„ЇЄ˜p‚}{‚e*XXmheЪтдШЬЯъЋабщдЯМЌхЧ–ЏЄK0Z[\8яямсфі№цщщчїьосЭВАЋ}[[[CџџёэяёђїјџљџѕђјџтнѓA)apPлџ№ќџјњњњјјўџячдзЫъp%_^PЯѓѓ№ЭМЄšсяфъёђјщьџ0[\Z0ЄВумнлсЬВŸА­›ШЧЇ•„-n\X;odeKsdtTsz‚­[Ј‡ЗzМ!QajPџz„ьy—Џ•€q™Ђыніџ4_i@џџх3ДпEFZ[8@ЮЊœЈ–’‹–xVg\\[VU=JIKPPPLPUdW\^\^_p``a_p_^ZKZ[[ZXZXZ[[Z[\XXX^LEFFEHFFEFECFFEHECCCCRHICFCCHHFFHFEHFCCBCCEFEFtFFIмџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџы@LKIKIHFBACCCBCEEBABEFEAAAEBABAABBBBBBAAABABABBAAAB@4%џџўјјјџџџЯ2@[%#&%ЉVZ^^HЯџџџџыH\_L)vџџx)PTWBEF;cw\^[ERchVVWTRTaTPNKIQ8#&#B’СP^hU!!!A`TPUxLCAB>;;>0)хџјyo›МИ œƒeP2'BCCBAB@BABBAB@AABBA>ABJ3#%Z^WZXZZ[Z[X[[ZZ\fXXX[[\\ZZX\ZWWVWVWWdVN2<83-08BFQa[\anjI‹­™Є—–З[T^WPNPZg\@^ancRcod^_cdnh@AX^oERQPU\P`ii^_i{s‚zF'V[nH{›‡tŸƒЇКЈ­Й€}f^&0PXnmF'&&*УџџѕџџVЫI^cВџџџЪДџџјјјјўџД[cT!џџџўљњњћњњљљјџџ/_apCОџџјљњњњљњњљјјџџŒ2Q^`T•џџјјјјјџџц04*%!!'AT[^aBчџџлUj^L/jџџ^=CVNB>BFI@iz_^[BRTTRTRPPzTNJKJFT/!!2aЩЃ^E[`@!\zVeQNJFE2@<<>B*PЫѓјИЦ™ЈпсгХЧŠw8-AR`zq€{{€pj‚o|xnac„tox|cwnt”y€x}feKB/*cŠзИ””’•t „ жВчИЂ˜›„n^AџТ{ˆp{{•Ј™еуџџИc`IџќхrPАiZ\ЏПЂ™—›™ЅB\h\[WTPKJJN[aPLQVX[\^^^_^_i\^a^\^\_^^[XX[ZX^h\ZZXfA&2@FFECRFEEEHBCEECBBFFECCBFECEECQBCEFHFFTHCECEFEECFFэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџэCKJKJHEBBCEECEBBCCFEECBBBCBBCCAACAAABB@BABBAAACABBA>3'`RXXZZZ[[ZZZZWVZ\[ZX[[[[Z[X[ZVXWWVWXZa\E=;5-2;>HNUX[^`q\`ЖЅ™™—БQgaZR3@Vgo<\mcRa}gaaedggaU)U[mWPQRUXNp{pXo|ƒzˆ•’W[iR`еЂfmQZhopŒ›Ј}e=-/KV\wL!'')'џџџђџџ џ^cFџџџџџўјјјјјџџсN_ePaѕџќјљњљљњћљјјџџЦZ^j_џџѕјјљљћњњњњјџџЮ2F`aQиџ§јјјјџџџё%#3P*&#%'@wUhka8џђU[\B!nџџI=PUN@*=BCIIPW^__fEBR^QPNNNPNIJHCB5!#IсKTjV8&%ATvJcQqCQQ88)6THJJ^[^pc{ormsssstƒcqc`ca`T<5*)%#4BEE}ˆЬМЄО•–ˆš™­Ÿ­ВЙџЉЏЌ…“ƒp=E;JFHJLNQRWWXZZiavcB)0Ыџх4&FLHFEEVEEABJE\zzIIXp\W=K`dZLJRPf cT85LPTaeZ_naacn__\XFEATHXB;XXfK&ˆЏЦ–Р—чОЯЏПоООЛТО›ƒŸ=@Xp^&EоъцзлбёУђопѓЯщљпŸЏЇ•!ZX[)јџхъыёѓєѕѕѕ§ђяъумныХP_jEџџєѕєђѓєіјјџѓячбојєJ\\'џњж­™™ŠЛХвычіўћџЧЬŸa^Z@AРЄЪРдЫЧЬКК ЛЏЂДšЏUKgZTEjpLe|L‚{nЄw•у›Ѕц#\_o2џеЃ–Ž rz™Є‘щПџџ3a`CџьўУhЫKz^Z0*ЧЁАЁ™˜ЄŒ‚‚c^h[[XTNLIHKLPj4&&N`UZ[XX[ZZZ[ZXXX\\ZXZ[\Z[XXZZVWWWWVWWVUJ>;6008Zph>#')аџђѓџџHџџЊLcgЙџИхџћјљћњљјџџџ^arV{џџјљњћћќњљљљј§џџEZidШџњјљљљјљњљљ§џџГJ^c<џџїјџјјєџџA/*2P-%%%#NmWq``/IKi^R€џјm/KUL086;@BHII@Z‹`^[EPPPNZKKJKJHUEPX&%-gтЧi8^dF%#4rPo‰^Lj`mBojE;/A46@;>;3FABC=03%4@Pcsx™ЁЗЏ™ЫочŠЗЙŠX˜€ЄЅgГ–_Œ}Œw`xk/08NKNXZNRUZ[[g^^mX0)%џџ/8CAC@ACACABCHP^Єˆ`JW\ifF!UL@F^kВ}>K48I24QWXZ^ˆ^i^XW_NJIEHJ;PWZnX5mЏЉ˜˜ЂЏšИЙСЁŸРЧЉЂ„ЏВW*[ZfHЇсЦ№ШозвДхйчОхЬвЄАДЛ<8[\J џњчыяяћўѕѓѓў№їхчспц--^^Jјџёѕџєђёђєїѕє№ыђпзџИ^^\ˆџѓыЌсЂвЭлџмбщхџДЯy0^[Z'kŸЛСЮлЮЭЗšВ— БšБ’Ј5P[VCT\LHkC‰pБ‘|h”ЙoРЌ^`^Тџ„Ђ|zГ›aЋЩ–д‘џџaaQБџлЩ­kПQ\['ŠЛЂЂ­Ќ•’›ЊC4Z^\Z[WRNKIIP=PPPTX\Z^L[\[[\h\^^^\\[^\[WXZWZW[\[ZZq_#2KFECFEEFECCCFEFFCEFCFEEFECBCCCEEECEFBEBHECBCEFEHFFьџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџц5LJIJHHFFECFFEEEEEBBBBBEBBBBBA@AA@BBAABBBBBBEAABBCBJ3%%8WVWXZZZ[X[ZX[XXZZVXWZXXXZZ[[ZWUVWWXWZiNA88305;@IQVZ^adjJ“Љ™ЄЊИ‚JddrW5QZgf<^cdhh^{stˆkhwZ8TfoHUW=FitkЈ‚ХџўсёЭаЬ›V^qLVЄ–“Œ—ЄЌЈ™g@<Œ‚#ZmvK*-*џџѕџџђЏџџџ#^cI/џRџџїјљћњњјјїџњ<^tw2џџўљњњњњњћџњњјџџeJ_Z`Kџџџљљњњњњљџџџ%иџ[`ae_џџїјјўџџ˜-')0H/&##'>^Wg^^^;UU*pџџW2EUN@'56;>BCHKL8kvc^^T5NPLJIfJKJJIFTE%!!!!#%#2џО`E\[C#&2>^KCŠ-œCйLU`…gv—™><'Р&нь–ƒЂ‹ˆГбЁЋˆŒЩЮiЗF@*PoŸˆR8PйŠmzT\kN_Q`wi^Ѓy˜­ЄЂ…ЏДЅˆtЭТЇ˜БЏ›Є”vѓА‘МyjЋ­оџџџџј’ЃŠˆ^`\LKJLPVV^^^eW8))IџџчsV'><<>@/@CEFBBHB\‰‘FAWaiB!LWPˆЖhF3HKX[QPTV5/W[Wh`QNJEAB02FLVZeV;PŽ’™Œ‘—›ˆБЂА™|‰™_Št4WXXHœЯтЂЦЯьеХЯЂіўиХОЌЂšж„Zfh#џџцчыээєџћёяњъфчЪоѕП_^^Eџўђѕјїђщєєєѓ№эщтнпљ;_^@џџіыП™вЩРАвџџџјЬщКО!J^[K2ЂЄКжООдУŽŽ•ЂГs…“Ž‘€3^[W@Xe[Rv^_БrЖЅВXЂ€ЩВ><^pIяў›Њ‘j„{ЂtCГПМсДџ a_)џџљЏЙ… -^^IУЬЃŸŸ˜‘ŠДVjg[\ZWPKKLNPaPLPWZZZ[^^_^^\[^^\\\[^^[XZ[\XZXZ\g[XnW&!3@FHHFHCEFECBCCEEFFFEEECFCECEEFHFFFFEEHFBEBCBEFFHFIэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџсALKJIIHHFEFECCBAEEB@ACECBBAABBBA>AAA@@AAAABABA@BBPA>3'#ZdXZf[ZkZZWZXXZZXWX\[[XXWZ[ZXUWVVWWXWWRF<8403;@ENTX[`emZeЙЉ™›Ш„Nhhd^;QVgm@[_sy{‚trwxs^ooW&TZg[J_dgmˆ дЉънЧЉŠŽ’ Џ@Zja4ЃŠŽ•™ Ђ­Ѕšv\E!џќUXof/гџџіџџ8џџђџЏL^c@‚џџџјјљњљјјљјџџV\kyWмџўјјњњњћћњљљљџџЮPX^ezџџјјљћњњјџџ‚џџџ4aaiРџ§їїџџЩ!4\2&###=LVjZkV0#ВiB™NŽˆe‹€Џ„ˆ*5;!*џјћ™Ѕ—ЈРгБŒv‘біВн/BHT[LXBBBГИŸz“PtџsiznqryЁœЊМЪsX…йЂтЃiЙсЧЄаyодџџџџџџџџдџџЊ” •‘cJP3N<>@ACBFJJFBBF>_›‰^UPF*KVKЁz<=FHKPTUXZZjRQP5>JHE@><>ABIRWdVEWz}v‚…ŒЄЂ’Ž‹ k\ЁqK_e^nW*ŒRџџCA;TPA888588<@CFJLPN-NЋzQ\U*2HRXXXTA\vmsyzoj‚qzcxtX`ŽIHИЉЏ•ЂvЪЇбвйљиоwЏk‹ЯУaWXXjџџїзъыыїёјщЮутъгЮШіА__^Wџџья§ѕјњјџїєћыхбЫёџ<_\6џџтУмзиябтўџќќџОхБзTJ^\W#vŒБЈОЙР‚ЙЂ›˜z‘ŽЂ’…5^[ZRUZpTxr“ˆЃkгЈЭ€‚ОБдz-isLВжݘWЃ}3„“ЃылšыиЋжam`џџдџ…Ь‚#_^[ОЃЂ ŸЄ•ДH%d\XWWUQLKIKJP8NPTdZ[W\^`p^^_^P^XZ\fZ[XXZZXZW^\L[fka6!3LEFECFHHEFEFEEEHCCCHFRCCCCCFCAFEEXEHRCEFEEFEEFFCCEэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџш@KKIJHFHFHEEBCECCCBCCCBBEECABAA@BAACACBBABBBAAB@AAAI2&%KZUWZ[\\ZX\\ZWZXX[ZZZZZZZ\[ZZXZXXXVVUW`PA84304;AFPV[_cdjW‡ЙЃЂZqs‚zq6QXno4^W`rP)J^m\˜ЙфогH[qPPgqv“ЙЄЊ­ЋЈЇЅЄЁЉЌЄH[j_H˜™—ŸЂЄВšœt\8%№џxIR[veуџє§џџџџїїћџПF^sc'џџјљјјљљљљљљјјџџ=[_eЉџўјљћћћњћњњјџџ_Ш5<^d<џџјљљјџџџџџџјџџ‰P_e-џџџџоџн4W0%!%-I_e\fX_tОK&A;T8&868666<>BFILPPN)Iz_^Z>NLLKKLLKC<5000-/-0I@03434B66580##wєџ€3BZQ=5KpZFXTTxZXJFМNМ‹PpЉСqCvTВШgлџИРВ ВУДЉzВѕ>ELRUWTQ3PŸ›zi„QQQRz•Š}”ƒTЮЋЙВœж•ŠЄWЇ№сРисэџџџџоОмэйˆ4K|kfZsyzKWVTPPRF23% џџЬ#8ƒШДЂtpœЂ8%CCEIEJJT^6#4@HLRim8PCTЈЄTBJ2EJLPFn\[\[[[VTNKF><=){JHPWZƒULkcp`fz€}”ex€qaomfdeqeN3WXnI-tЫЃ˜ˆ•И АШжеУџГЉ‘Я–#LXW&нѕіїєцыыыэьчіцзаЏКмэ;^`@џџыъдьђјџњјє№јимЫіџа`^[|џљїЩмідтѕђьъЬџџРЉ…w_\eHP“€—ЂУ˜ЏŒЏЃ–­yЊŽ•„ЁR;kZVRUKni‘g}…Њ•РЏКВВ—'L[p0c€Вm“”脉€_Ащыnџмбm-aa-џџџэ•ДoCihLУЖЄЂЁ›™•ŽЂUo\XXXVPJIIINPNPQgX[\X[^^\^^\a{\^Z\XX[XXeZXZX\\\[ZVU!#2[FFFCFIEFCCEHFHEHECCCFEFEFCFFECEECHFBECCEBCFFCFEFFэџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџхBLJHJHFIHFFEEEFCECECCEACBBAACAABB@CBAABBAAABABAAA@AI2#!#;\TWZZ[^^^\[ZXZZ\ZZ[ZZWWZZZZZ\[XXWZWWUT[E;83!48AFN`Z\_ccZaГЌЋЃЄX‰zssj86V\g=5[mЈ‰ЂЧпўПэџџлУ>V^`6АЧИУЇ„Њ­ЙЊЈЄЃ•ЉЋЈB)Z^j#zЄЊБЄЌЌŒ^R@&џџ2[m^xAџџіџџувџєјјўџџ^`zVЌџџјњљљљјјјјљјџџе8Tp`NџџўљњћћњњљјћџЯџ[`ae}џџјјјџџXзџўјјџџџQagwџџ4šџџџя4a3&&2%3KVe^^ER0'2E&*66;686;<@CFJN\RR8;p…d`\RNNPPQ\WP;320<-)'-**/0002320023!!Јџћ4[jZxRBzTsŽa‚џ’МЖь‰ъОыЂzxtЗЏ­˜џџмЮыўџџљј{jRVtfI;™Xasmk[d_^jXgP50-џџџjKˆŸ”ЃУЄsp™˜H2IIHHIW\4%#5<'&P@VAvйˆ@66VFHKPUZhj`^Z^[WRNJC=<<-wNRZnhaL6HJNPPW^rvƒyipa^\FW[hZ6V[[W2e‚„wЄЅ}ˆКЄЅЦА­ЏРГМЫ&=[ZXЇџвнсыхёъщёљхозЯЙЊхџi___fџѕъыьяхєїјџќћйЩйнўџ%%^^AџџДЫлгѓјЧыџйщУњщЏ’бf=^ZW*zЈВ–™ЂЃy˜zЅА™‹ƒ{=[ZZR>U8qov{ˆ}—‰ЂВ–УбЊ&^XZЈДЛxŽqВ„лŽСщл–ЪвјW^^ƒџјџя”8E^[8JЃП˜Ђ Ÿ™ЄЊšV^hZZWUPLIKK_PNPRUX[\[\_\^o^[p`N^Zg^ZWWXXXXZ[[\^\[_Z'#0KECHRFCEFHHEFHIFFEFEEERFFFFEEHEEECCEECCCECECECCCCFьџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџчCKJJIIIIHFEEEEEEBFEEAA@@ABBABAB@ACABAAA@AAA@AAAA@@>P3'!ZRV[[[^^\[[ZXeZ[[\ZZ[XZ\fZZW[[WVWVXZZVRJ>85346BICFVNPP^^68rЉgRgU3Q^^\J@42-*'%&%&))))--*--F00-/2”џџq-FPRVVVQ8[tpt[ƒЋnNcˆwFW­ƒРџЧџТЯЧzdqŸџџџзјјџџВZ>5PKB@>IZafn‚rmkha\[hQ408!‡џџџkiЖ“y”€•ЃЙ’Ke““36JHFPI0#4>&>C4—ъx0@@H6\KLBi^^_k`^\XTQLHA*<<2JQXp‹XLE@@0@##-#>UTWVTNPNPUV8T[zmZXiQџџјџЫлџџјјјџіџџ4g`dџџџјљљњњћњљјјџџ{8EXa\ђџџљљњљњјџџ^эџќџжB_g>џџџџќџџјјњњњјџџШE^cTJџџњѕ§ўџќ*'=F^L5UACILPPQURP'w™jQ_ZCRR^B&30/)!!%)&&&'***-///-/00!#)%*›љџ•)8IXQ&IE-BNm3-i…N4cЄ^3ыrpиvBР“ЧЌЂŒМДџ=INTcZXT5_‚vRfдѕ•­™r{’•ˆ”‰•ŽЯВлЪ˜З‡KЈџљџџџџЪЅ};>EIA@UWUUXZ[Rioy‡‡sVE*4%Ÿџџџz`‡ЌЂ‹t{v|Йа­Uq‹r8IIAF*[c*F>ABУџi3tePP<;PPU^_`_^`[ZXTNJB@@>>EQZk|\NEA>><=<686HPUZ^aer\RПЊЄЄsтїџџўџqV\t8XЙЌЂt{—™Њ‚kЁСЩE*Xoc&“ЛВЋŸЇŠВЉЅЏ•“ œ™БxW\kEXПРЏœ|a=<Уџ”))#FU^dАџџџ%џџјјјјјїџџ2X_e!\џџјјјњјьјљјўџџ‘&8\c3џџјљљљљџџуџџіџџ[T`VdџџџџџѕљљјљњњџџџH`aoNџџўіјјіџџџX)I^c[;Uk!Eps^g4џ‹x;8;<<8;;3џџЄ;;TXT=2/#4/EPE>)АgЈ\V ™eЄt{šЏ’МšЈЌж4IPUX[ZR=V‡•’qх|}}ЅИКУs_mЧУУ§ЮЧєуАџџњџ§Пm%6X_j@@)CXZ>XH[_dfxrt_=3--/РџџџKT’ЈЈЈ”–Ћ‘‘o™šД’IQ…_AE;)#iK'QsKT_RP8R‚[^__a^\oZRNH@<<@FRXr‡^AFAA@<;85866;CP=88556-IQX\wXR‘xz}|€wcXqhd„ 8BXXXяівЪШГœМЦМдЄЮСј­ЙЂУсИQ[\CџыЧўл№ўяэџџящемЦищџ^\[”џзеоичмџџўѓто№ЄŸЇ3^\ZI@‹|˜iRggfdVknrrtrnqAfZWRV^visy{t–|ŒV„ЁЈяj8[ZWщЙsЙ|q–hЊxмЭХбЃјџџT_\АџљяџЃЦ/U^g&TпРšЂЁ ›ЈЅWm^\\XTPNJJPQQPQVUZ[Z[Z^^_[^\^\_h\^WXWZWZZZ[gg\[[gXL6*#3QEFEFBEFEFFEFFFEHFFEFFEBERRFFFECHHRHFEFEEEFEEFECFCьџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџтPKJJIFEEFEEFFFCBCCBBBFCBCABPBCACCABAA@ACBBBAAAACABA=4&#BeWWXZ[[[WX[ZZWXZZZZWZZZ[ZZXZXXXWXXWWUTRJ-85//4>HLRX^`an_6)ЙАš™XЮ§іџэјРCX_T&ЏГАЂœЏЃЋЏЖЏЙЯЉV^aCNПЖЉЈМЅЖЈЇЅЄ ŸœšЃЁ#F\jc-ЂСЋ™–sW48џџ-''/=ZZ_Eџџлхџѕїјљјјќџб#Q\aiъџїјљњњџњњјџџFџ’P`fŒџџјјјўџџ&џџўјўџџ*rcZчџ—Дџџјјњџњљљњјџџ%a_xqыџџїјјјјџџџJTe^HAЈєP%R}`\TбŠ{“*6;;8;;<=>AEIILPRRT`T#^{ЉVP[RI>#/0-'#%&&)'*))-0@02388686’ф“>'@PcQJXhfP3hnk`_aiZ\VPLC><>FQ\c•_@JEAR<;;8548;@CB<;8643!0LVXmhNHP|z“€œ›’|qomQiigk{rŒF5XZi4*цЖЏЦЖжЫгвЙЖЄЈs›чЮџЪ@inN№џјщјџџџ№ъщљџыйцзсљєP^[;јгЩИяасцыяіџРоЯЃЈošƒ;^^Z8g…|—‘kUN^N[^ccdfwUa^HeXTBm`g€€{—XŽqЇЅ“zо8H^eA-о“‰‚H q ‚с›Ращђ^_>нџїџџЄЏ^_^ВдГВЉДЁœ—ЏW3[_^ZXcQLN5KPPRQPWj\ZX[^i^_^\^\_h[\XXZZXXXXX\^N^Z^^gU5'#4KCCCFEEECEEFEFHHHFFECEEFFHFECCCBEECBCBBBEECEHCECFHьџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџфBKJIHHFFEFBCCFCBBCBACFFECABCECAA@@ABCCABACACAAAAAAAP4&!!*=iWXWXf[\fX[Z\WX[ZZXXZZXZ[Z[[XWWZZWWXVVQWB;63/3=CIPV^`aekL‹ЙЄЈzЈоЩлК™‹/3X^c'˜СЃ ЌœЂЂЄЏЏЇГЧВA\^a#ЇЩЖЈЈБЇЅЈЏЂ œЄ™•ЌcW^a8oЯЏ›€g@-ŸџЈ')&)%HW`fзџ'џџјјјјјјџџJW_f)=џџјјњњљљљіџм­џџ%^aWџџјјјџџуџќљјљќџЬNRd>;ђ=џџјјљљњњњњћљџџџ@^^oKNџџџјјјјіџџЙ'Vf^@=џџˆ/Qs^^NFP€ЂPP6U;N!5kI{=qtICIozЉЅ;JPTWZXT8E–˜ж›џЖa`a}јџџџџџџџџџџџбџџѓџt23EVHXWTHHPg}mkj“nqnXW83'-‡џџџП0Q{ˆ›ˆŠБ‘…›œ‰ŸОzaŒˆ–s>K‘;&!'CA=5Аџ0LV{РiBWZ[aQ3Wsdd__XZVNIB>/ERZd–kTJFB>>=<85558<@PA&65546>ITXogN>PWovtm}^_kegˆ}g6VXdW%{’ˆ‹ЉЏЫОИООЛ•ys}‹ж^^^4ћфђўыъќџэзаЄЗЃХУЮэџ`^\tџГЧлбтѓђъѕчцХБКАГ™Ѕ6_^\X4ˆŠ“sA`^ZWTVX[[ZZFeFeWa;Frgmtx‚”kЊiЊx|ЅŽŸ#^ZW)qЃw…‹mr–‘™•сЌцЏЩћћF^_Wџџєџњm6^ZEЯДКXЈ В–ГE^i^[XUPKLHZPNQNPX[Z\[^^_``_^^_\Z[[ZZWVZXZ[Z[\_^\^kUH4'2KCBEECFCFFEFFFHHEFEFBCEFEEEFEFFCQFECCCCBBCCCEEEFEFьџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџш>IIIHHFEEEBPBCCBBAB@BCBEAABCCCBBBBBBABBABABAAABAAA@>4&!)&tVWWZZ\\ZXZZ\ZZ[^[Z[X[XWf^XZZXWZ[XVVXUQZF>65!3;AEKTe^`dn_0NЉšvtœ€šŠ&W^kCgЦЏЂ‘›ЁЃЄ„ЄЉЛЊP[^j/^ТЙЈ™Ѓ—БЅЅЄЊ›–”Ѕœ&>\_a)РЛ™t\*#џџ%)'%&IU[m@<їхџџјјјјјџџЮ5C\chПџџјљњњљјџџџџџЮE_e-Fџџџ§џќiџџјњљјјџџgRaeP>џџўљљњњћњњљњљјџџ‰&dradРџџїјјџџџœW^^<0Йџїa\<3\i^^_8I—d;88<8;<=LЙV^aL@%2/!!&))**-/--4PK><;;8=@BE0F-4—џџРU4BNaPP24FHKIKsJCA/6[Z*5iXEWCi^eЖЈ^3<2<4)@Ъџџ§j;ajr|”ˆŠ‹Ž•Дš”ЙОР™”vz…šx>f2%!!BR8^џфH&0)E>N”Žh=X[ZWP-eyc_^ZVRLEA0FPZe‘aFK5FB===<85656=AC@8644#3#'8^aXZ[[\Zf[[[\[X[\Z[ZXZWX\ZZ[[XX[XXWWVUUQJ@86048@ELRW[_doa@! ЄЌА ЁЋЂš›ВВ!\ja˜ЌЏЅЂЄБЈЄ ­Ÿœ˜…šЃ^'X\a0ˆО‰hR0hџЯ)'&'#‘&K^d[j#џџјјјљџјџџ0;^d>џџјљљљјџџЙоџўџџ``[Гџџџџ&џџўљљљњљјџџ`acX&ЮџџјљљјљњљљљњљџџџPe_c@тџўўіџџЉ![\_E2БџѕP*X_'A`jp^^J^ƒ);8888;<<>>>BEIJNTRVZ[\eW2E‹Д\N\QC0'#'3--*-2;KA>==<8=ACFFCA3*&'cЯџџH2AJVPK6H*EFB0T-ACA02RjEPPTFET;!FQUVXXU-Q–›šŽŠВыџЖ„—UR4/0@2eUzc`[TQPRi[^c|•ВКЮЅ™f<24E0=Єџџџ­JN\^cgjw™ˆˆˆ‹‚—ŸБЗЅВЃ›ŸŒŸЈzNš&!'JE&˜џЙ8=HEBF=CЏfNXXdhR/Zn^^XRNJB2FRXcŽvH=FFEA><8;6556;>AN<8656)E\XZvRE4*-*)))*)))-&%%!-nXUXWUQJ™—„“ЌŠŒ€ЊwzwTqtsg`ЗP=[[ZrмџѕРц§цЧЯУЪвЈао™мџџ›`_^ЂгтдДждзлџмеСДЏ˜КЙЯЭ@>[\K4ˆ…yde_eQNNNPNLJIINTZ[VB4ˆnnrxz{|p„švБŽЂГ­&^\X@FУŒ}CzewДГИЂКЮжМіџL/^[!џіОјџг“^\XЗлВœЅЄЂ ›З8)j^ZX[dRLKIJKQNNPV[[Z[\N^^^^a^[_i_^o[ZZXUHZh^^^^`^\UPE4##2[FCEEEHHFCFFFRFBCCEFFIFFBQCFFEFAABCCEFCFBBCCECCBCHыџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџы8LJIHEFEBEBCBEECC@BEBABAEBAAABACBAABAAAABAAAABA>@BBP2#!)5Ki[Z\Z[[X[XXZZZXX[XZZ[Z[ZXZZ[[ZZXXWXWVVTNC<6436>BJQW\^`pd\ˆДЏŸЂЄЁ‡šЈЙd)V^c)€­šœ‘ŸŸЂЌƒЄЈŸw^/k^q8ТЋЄЄЇИЇЋ‹Ž›œ™˜“ЄЂUX_UEЈt^I*џџ6#)'''џZ_jPсџѕјјјљџіџЫџЅPcfšџџљљњјџџBџџјџџџ5^cLџџџКХџџџњњњџњљ§џоK`ayRjџџјљњљљљјјљљњјџџ&R_`c3џџџџџЅ[^NF&џь;8JTE&!>P|y^^XT*)88868;=>>A@FIILQTWZZ\^mU83sиЄF^gK-4%%))-28J>>ACA=JZVQ>;*/-C->>><>JjZ>NNNP^E*FPUVXXUBa‰|ЄЏэx8#>EPa^\^^[n^\X[ZXJWURCH^^\_}ЄжпЋv6/26&‘мџџъJLN^\[^`af|t‘–—…Б…ЯР—ВЄК›‘—”ƒšzW‚|!CR/Jіџ'4KHFECCEAPŒœtIKZZXR8WoeUPKFC6RZdŽdJNHFCC>>;55555;;=AA<6658BaX[edF!#-*))'')*)')&)*)**#PVVsRKcqƒqj|gƒp{^nvUehj^Ur˜2L\[@-гЛ—ОЧмучЧУЈ—ГŽЖчУЬџџE^^BРщЫТУээълпМзБДЏЇЂЃОŸ%^[Z4cДЃˆNLPWPLI8KIIHE4aVeW`6XŠrs€zz|Œ€ЏŠœ€ˆt2^[W&{Ÿ{wx{i‹Є­гИямwфйR^ZЅџџџўџжHE\W>BCCBBAA>AAABAAAA@@>3!'4CnX[WXZZ\ZZ[XX[ZZ[[ZZZXZZZ\ZZXZZZZWXVUVTPF=5525<>FLUZ^_ooj0<ЊЈŸЁБИŸ˜˜”ЂHZjWUИАЋ››ЁЁЄДГВЄВПЖH\aV6ДЁЂЄЈЈ™Ё“ЁГ›™—™ЄДF&V^q8„vRA80џь*)''#•џЋI^z`%џџјјјјјјџџAџџ_`Tџџџјџџџ›ќџџјјџџŽI`ecџџ)џџјљњљљњљљјџџŽ__knџџџјљњљњњљљњјјџџ{U!a^c)%џџџ•/[__A<Џџн2-KRgU%##>P|k^^c>@CQFA<@=ACBECQCBC-BE2%C˜лмГ—R@Q[WTPJF42/-*3xxWALLNKA*F_UWXXU5\8#УўHI_^nia[LZXVVWVVVVTRPQVVVToЄonˆxF3-*/-=‚эџџКW6Q^a_^o\^^`^cZycrtqyˆŒ”™ЯЃдЏˆŒw„М…LBF@#œџн@E;654458;>A@;55'BPh^oTJ80-/--***)')'''')'''&%I^Wd_J&Є^!Z…xzosyŠ{naƒpˆv—ЌЌ5N[dTAŠsrsf•ˆЃœЙ“ГƒЁКŸЭЄ^^Eџџ§ўЭАП`^[*…еРЛ­ЙЏ ЏyX^_[[XVP=IJJPNNAXv^o\\__anak^`^\_Z\^^XWXZZX\^_^\[\ZPLP6&#3UEECFCEFFFCEEEEEFFEERCCBEEEERFCEECCBBBBCFEBCCCBACEьџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџрCLJHIFECBECEECCEBCBCBCCACBBBBCBCBBBB@BA@AAA@AAA@>@AI3#!'5BfXZWWXZ\ZZZZZZ[X[\Z\[[[[\Z\ZXXXXXXXZWVVRLA86346[|€_nWI/86866<;<@AACFHKPRXZ[[`KA>/34}Чš_JaU!%AP=ACEXFB=@=@EFEHX2ACIF@*Zfš˜|\pЇn||T[UXvcTPdRRRQPLKNgi_VVX=264;8I84[”ёџъбqBXvgZgheQ^^^X\ZXL__`RUgirw•…Š”йжЈ‘Š„y—N-;5№џ”->KIFEBACEHEH>855445;<=@>;88@JVZwjK<///-**'''&'&'&))))*A_WWg_>&%!џџџџЯЏN2dzdI[g^ABЋ•­œy­Є­ЂЃВЅ­Й“ŸУУлРI^nL/УнЮ™ПЏЦЄУотеЧŸ‰™„™К”&j^[/ZЫМАŠyh_XRJHFEBBA'ZUZXUPPV_cg„ox“yz|Є…œ…‰Џˆ>[XV=^|map^‹—ЇыВЧРЙЩбп'B^^џљВ йŒ%^[LУЮДВДЅ—ŸЈШ4[^_[fdTNKKLPQLLQXn^^[\`^csQL^`_^^_\\\kWXZ[[[^_[\\[XPIC5%2LCCECHEFEEEFCEFEHEBCEFEEFFHFEEBAFEEBEB_BBCBECBCACFъџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџхQJIIHHEBECBCCBCCB@@BAABAABA@AABBBABAA@@@B@AAA@A@@A@I3#!'4ANpWXWe[[Z[Z\ZXX[ZX[ZX[XX[Z\[fZXWXVXWWdhUPC<8446;@FPa\\^em\'iЖВŸ‡‘šƒ–Й›Мz/V\aAFILPRWXXaPF>;'*)4HБЬt@\QA!-8=@BF3FFPA>>>BCBCECFK|WA<<;')05%%%4NN^>!!HPRaXJV”njgded_tocB=_RNLP<;LJ;JJ8PB4@0HJ[PCE^tГУяа‘F;wŠ|…„‡pzQ_gIVWUQQTRTUCXZBHWTRe\n€”ŠnT0)АџџCAPJIHCAAACFIIEIAIh•{KLZccJAIKW^ˆЊ`CœX>@<88>JeXyiN>3--*--**)''')'*'))&)#=\_WqfE4-%%*џџџџџџџџџџщАwaX3\ZmI'Ђ•ˆœ€yvm‹gŽ…ŽŸДмВо/6\[[2zЂЂЈЭаХД­УЗШЮВ™•–”ŸCF\XX›бВ“‹‚ymc\cQJHCAA@5cXeXQIIPTXmeh^‡z{›„–‚‡ДCF[WU=qhmpvZošš…а{ы•КђуЊ^ZLГџжЊ­ЂхJ\Z/BбРЛ”ЉЅЃ­ЙЋVf\\^XWPKIKJNj\QU[\\\\\o^`aakaaP_^^^\[WXXZ[^^_j`^^ZUQKN4%#4LEFEEEEEBCCECEFBFFFEECCCEEFCBCAEEABBCBABCCBBCECAEEыџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџм@JJIIFCCCFFCCECCBBCEBCCCAAA>AAAA@AABBA>@BABAB=L@>@@I2#)3@IhWXXZZ[[X\\XWXXXXWZ[[\[ZZ[Zf[ZWXXXWWWWUQU>6536;>HNUXX^cs^@5ЃД›’А­‚›­šЃЁ&@\_a6ЈЂ›ЁЂЁЅЇЈЈœЅЅЋХ0-X^a&—ПЏЄЃЄЄ ˆœŸВ›‡ŸКטHZn[P2Жџ—*))*џџјџџ<^qcџџџјјјјіџзхџџєџѓB^d0%џџџџœџџјњњљљљџџzR`pj4џџјјљњњњњњњџјџџ5P[^aFџџџјљћњњљџџџPвџџџКCaccZLX>)Уџэ2@0џVd_-!%#EXFCFFBA>>>AECHXBFPrICAA<86;<<@)0%3/Uj™ЂЁЂxda^P^\[WVRP><)AI^XvrPA0//---**&)''''''))'*;I^VdhJ!%'/#*џџјєіѕџџџџџџџџEC\^iKIJHECFFECCBAEFEECCCBBABABBAAABB>BBABB@AA@@A@>>AAA=3%*5@E\VVX\Z[[Z[XXXXXXXXXZ\[\ZZZZXZ[WZeZXWWVTRKA<;448;CKQU[^aeaL{ЇЇВЃГƒЄœšЃКc)U\a6wˆ˜ЈЄЂЇВЌЙЊВЉЛР’V^jCQЧВЄЄ­Ѓ ›šš‘ЃЇЛШ&6X\oQ0џџ#**)/EџџєџџI)Z^d‹џџјјјџџџ&-џџџјџџd^_X­џџRџџїјњћћћџјџџ^asfОџџјљњњњњњњљјџџУ#>^_d)џџџјјљљјџџК|џџџџџ›Qk`qR#LP<Уџз>6%iџџџx!aP#&%HE_—`^hN2634448;>@BEFJPTU^LB>;8;666)'F­џŸCK`T&%&3<@AHZEHFFEAA>@CFFFIFEaJ6CCAK<5648;V=/BF068B^{Œ˜™xŽga^^ZXXaUfa`PPLLII;8058>36352554L@PPQQTRTWX[Z\`cg{•БЅЄ­€V!TЈmsnZˆЅ•dz}š’€ƒoe^TPPNKNPNNPAPPQQVHWLeoa[425/фџѓ#Aj<8HEAABBEFHJNPN/;NI{ГwPRJ*%KHPЂ”^584Џ)FECA>8633346;8===CQXZVRI@=AFJPV^njnpcz{“j–hFkZT>V\aiteƒ|УŠЖЦаАздЄ_\^Ќџќлтйсc*\\ZЯнИТЙ›ЇЂЌР3[\X[h[QKJIJNaP>RV\\\\^^^aa`^\Qa^[^`^^\Z[X[^^^p^i\fUPPJB3!#4RECECCEEFFFFECEHHFECEFCCFEEEECFBBC@BCEEEBBBCBEBEEFъџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЩ>KLJFEEHCCBBCBFCEEBABABBABBBAB@ABAAAB@AB@AB@@@@=>A>I4%&4ACNTTX[ZZX[XWZWXXXXXZ[[[ZX[[[\[XWWX[XWcWVU[H<65448@HLRX^ads_*XЂББЏЂxšЋЌДЄC[oPC•ЈЃЇЈИЌЙЉЈЈЉОЙ43[_mЁЛЅ˜ЄЂœœ›ЏЄЖЉЮŽTJmk2_џУ--*-сџўѓџџT^aUџџїјјџџыщџіјјџџџ0`aJџџВџћјјћњњљљљџџыB_ky/'џџјјљњњћћљњљџџџjW&`afkџџјјјјіџџџџіјќџџz&n`ƒqR*ЮџЧ646kџџ§џџ{\V#&&Xi&_„eaj\2&32358==ABFINP[LC<;66856556)oЦјzB\aQ%#48=BWCECFEIRBCA@BEFFHIFJHFaE@<=8655<;>><=!@4F6ABFKPW`pgosx™t0ZZcQPUX`mt™‰СƒЄ Хz‹Вяj2^^FўєєжРєзR\[JоЪСЖВЉ™ЃМ›Wm^[^mXNIJJKaPNP`XX^^`_^^a_\^p`t^^^i^[^\X\^ZZ^iP^\dT>KHB4#!3VQFBEEEFEECEFFEEFEUHRBFEHCHHFCEEAECCABCBBBEBBCBBFEъџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЩPJJKHFECCBBCBVAABBBBABB@BBABABBABAAB@BA@AA@AB@@=@>A>3#'6LBKfUXX[f\ZZXZXXXXX[ZZWWZX[Z[ZWWVXWWWVVTWVTW>85248>FKQc\__ok@*Ђ˜­ЇЏ™™ Ё›Й<3W_a=—БŸЄЄЈВЊЉЈЅЉИДЉx!W[kARЮВДЃŸšœ›‘ ЂšЋГЙЉEWgtHџџ<2-*-/џџџ§џбJj^p!kџџўїџџI&џџјџљјѕџŸP_f-”џџјљљќћћњјјљџџx[^qN>џџўјјљћћњљљјџџџџ5dcTМџџјјјџџFјџџјјќџџŠRr‚ks<џџ2'tџџџ§џџџ}[P%'I”4@_v^ja33355;<@BCHIJUE=86556886886;!3”њКc2\\F*>ACEFEEIJHFBABBBCHUKKFEFCREA==86548=;><>;@@A@@356>TEJLN\_qq{€{{„zqzp^^^^^`^\_^j`_ackj_h_sƒ„v–ccURA8E`ЂбхџВzЛP|Ё…q€k`Œ{Ž‚p˜ˆpd_ENKIJ>T\chkjkXhidrZ5;3rџџЯ%68;>>>FHLW[^d|…ŽqfJZeV>RV\VqyЅ{ЧŸЏЄЦ АЯїP[\)џтыщЫџ–^\X’жПЗВПЈЄ­ЙIe^hZ^ZRKJIKPPLKQWVZ^^aa`m_\^a_Q`^\\\\[\X[Z[Z^\\^\\VPLWIU4#!4LCCBEBBECCFFFEFFCH[JHCFFHCEBFC3C32WAABABBABCEBCCCEыџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџвPJJJHECBEBCECBBBCBBCABAABAACABABBABC@@@@A>@@AAA@>@A=A#!)6LE6rRVWXZZXZ[XWXXXZXWXX[ZZ\X\[XZXVXVXWVVXVTNB=84E6@CIPJFTECECAA>843548=J=;;==>==>04JLNP5XH>008ZXX^^_jxhwzxz‚z‚€{s€t„sngmg\\N[AFBE5<4<63333466;=>FRcknTH)320---/)*))'''%)'&''&6T^WdTH6%)**&%!'-џџєіјјїџџ“_`j‡ЏџџјџљљџџџџџџџџŸP[^L2=rЏ…‚ƒ€–{trqkZiZh=\[Z=hЩŠ|yƒn{rcgUPI8IIE6ZUXZaPB%866;8<@CFLPV^ein{=[[mR>V\chs’–‹‹жŠЂ’^‹В™\\ZЧџЯхј™џ@\Z@KЁЮДДБЏЇЂЏВEf^\\fWQJJJLReN@A@@AA@BAB@A@@A>>AA@@>A@><3%!)5LP0KRTWX[Z[\[ZVXWXWZXZX\Z[\XZX[[X[ZWWXdUXVVQH=85468>FPVeh`an`83ЗД­ЏzwБЂЂЂАЌ&Af_a-™ЏŸЌЄЃ–—Є™œОЄšЩz'Z^aEQББЂŸ Ÿœ ЂЃИОКОЛ”RZ_aџЈ#-/-/џџѓњџў-IL\d'EџџџџkџџџљњњљјџџщI_cw;џџџљњњћњњњњљџџџ™La^nAџџїљњњњњљјџџ-џџџџ`Q`dBџџўџџџџіј§џџz&3=TX\[[B;iџџџјјјјієџџœQB5ЅQ€rAL_wa^aJ)!58<@B>AB><64544568886566;88#%'QвџŽFB[RLIHJJLNLKFFB=>BCK^jIHEBCC@<>;334468><;=<=><<>AJXLLPRkƒmnrJJPT6AC>TUTc^_UVWWVVZJIUTFUBTHUFZN\PZ_{ˆ˜двtyxˆeAŽЗЂЏ‚Бˆx‡vˆzzzz}…tpjmVQQNPUIxs—–Ђ–›Зw;*2ѕџџz#ERxzae„ŸzwŠX>FIJJNQW[\`fhЂWALKAъr4H)44VJ!ДCFE@=;;4545458;>FRWZ[UI)33//-***))*)'''/&&'&)!E`adrL;!))*'%##&*#ˆџџѕїїџџј6_`6џ#џџїљљљњћњћњџџџС[_x!Eџџнˆ=I@J^n{raccPZ\[W=r{srnzc^\VRKFCCHJKK_X[X_L@886586;<=>FHPU[^dzB[[UPRWPfWz“ e™УtСЉАŸХ>@@@>>>>@=<2!'6RBA3aQWZZ[[\XZZWXXWWZXZ[Z^\[[[ZZXZZVWZXVUWVTWA;6466>BJRZZ^`skLЏЃЌw}АЂЊЂЈУwX^pAhГ ГЃЁЂЃ­ЅЉОЁœРЙ6\_a*ЏОЁ“ Ÿ œЁЁ—ЌМДБЃyFBU[a>“U2/0/3|џџєџџRi‹Z^ZоџџџУџѕљљљљњљџџџU_`zWдџѕјљњњћњљљљјџџџ&NZ_e/<џџјљњњњјџџУЯџњџџџ!`cZBџџџQђџџїџџџt*_@>P@U\^p^=€џџќјјјјјјўћџџ™=TŸpI‚n0E€’i`mP2%;<>@B@>86533354568;8;586668;/vЮђ–>;^T5LLLIJIURB@@BFIL8HBEEEB@@@<64646;<8=J<<=>=AELPPLAXdŠy…”Ј\-ITgЂm@<`%';@BFILPPPRQQRTQaVZ^aeWq‹…ŸУЗВ0jPPF^T‚JWqpasqrvw‘fvyŠ|ywvnoKURwRW\sxЄИ€o06гџџ•`ƒ…z‹ŽnŸ‰‰œ}rxWCEKPRWWXXZR@PZ_za”„Š˜Ћš‰ДˆЄЙ­\[\ЬЫЮоЋЃn&^\IB™gЮЦОБЌЄЁМ4\_^^^XRKJ;`TUQARXZ\^Lo_a`racac^_^^[\^^gZgZVX[`^\^\dPKKKKU5#&6@ECEEFCFERFEEFCCCECEFFFBFEECEEEECBCQACBCPCCECBCCEFъџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЪQKIIIHECEEBEFECBEBBBBCBECEBBBAABA@@@@@AAABAAA@@>@@@=3%E5NEA5rTVX[\[Z[[[[WWWZ\fXXZ\\\ZZ\Z[\[XWZWWXWWRPF<6356J_ag”џџјљјјјџџBџџјџ§џџadhxџиŽџџїѕџџm)X^^B8*3Zˆa^^&фџџіџјјјјјјїџџџЋ™›4…‚\24aЙz`f^F0>APA@;532033444588<;68;88688='sђџŒH>^WB=/JJFFC>>@EEJHRCEEABB>K;5434588;<=;<<=<>H_PR=R^f}}’—ЄfAFQH{wBKs!#&/6@RLPPTTUU`VVZ`dinv‚ВУЮЧЄfp“m`3EB=4=KLQafnˆst^yy{{{|ˆadZVWRTX\e€Єt\!&ЬџџКoЂИДЮЁРИЗwcˆpŸ„z^sWPNPRW_sdZvkƒX=CLXЮг>2ACj^WeR4Pm0FC>>;86445546=CPW^zWJ=!2/0-**-**')')'''&''*=W_Wa\E!'')')&#!!#'%%Eџџўўџ€P`a>џџџoџџџљљљљљњљџџБQ^\TхџњўџџџџџџџџџџцH@kX\^^WE\\[ZVUBP=J2>A>@PFFPaZZeVPIFA@=8868886;;AAE5QEZjWP;TZ`|v‰”‰›ЇœЉПЄЄоi@gXAуыаКлгР^ZZytЩЗВЏ­МСŸV^iN^\VPJJLP^PPPW[\^h\Z[`Q``cc_`^j^Z\q[XZ^\X[^q_\^gULKIKIP6#-8RCCCFCFEEEAAEFECFeCFHFFEFEEBEECECEEECABAABABEECCBFъџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЪPJIJHFEECCCEEBBBCCBCCABAA@CBBBAB@@>AA@BABBAB@AAA@>@=4&'6NPAE[TUW[Z[[\ZZ[XZZZZZXZ\\\ZZX[Z[[[[\ZWXVVUTPKA;4366oОŸ/'Zx^aA#ќџџјјјјјјїјќџџЁ06Д=xvj!4^Ѕ|U\aJ4@AA<642302334446;<86H6886866>><>632585;<;88;<;=BKPQVUWajen€{ЫkCJRW[XQLq)#>Z_QQR`VTIZaf{€w’|ЉУ›эУt|БoRIT>6CVQTBXadwqstˆ{}z€ˆwV^XXUUi^rhV-Юџџв!;eѕœpšнТРъъ“qwy‰ЃЃfXmWATVZ^vii‹dX2=AcмЏH*W[dgIHXWRJFB>==>>BB'cVe[cRL_TFX><<8888588;>@E\UZZ_=KU[Vo‰n–wЂЄЇ——œДАг^Ze'kхеЖ’АЪ‡^\XзоЬЃЌЉЇСfZh^[n[TPJJLLQP@Qim\[^i\^^aa``^_\^^i\^^Z\\n^Z^zcQQ_mQNKJKHN6-8BBCQCCAEEEFCEECCEFEREBHFHREFCECCCFCEQECCCBBABCEBEEъџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЭAIIIHEEFFEBCCBCEBACEEBABBBACBBAAABBCPABAABABAA@ABAL<4''5BEBCJ^VXXZ\[\ZZXXZXXZXXXZ\XZZZXZ^\^\ZZXXVUTU^ZE=8556­КЏЇЄБДЈЈДЁ ВЋРW*W^k<`ЏЂ ЂЄЈЈДЙЈЈЁy^=20NW^oQ)320Тџђєџџ™џџџ'\_ABЬџџјјљњљљљљљљџџџEfae˜џўјљњњћњљљљџџk!џОQ_f>џџўјјџџ|џџџљњљјџџЏWeTVTђџџџџџX3^kU&CїџџƒAXp`a3уџџїјјјјџўџџО{ЗcXˆv^5VyЄiR[QF2=<;53023L0332588868888;88<<=<-/{ињЌ[2PWP88E@>@@BEEEA@A@A>A>@<65856;;<;;<>;>IPPUX\`eagО а`CLRXWWP=q!!&=6Ѓя‡56^pЇЁhP\ZXTNNgC=<8;88555#20----*)*'))*))))')'-6T^XeeK8#'%&&''%%!R&%џџџ\`UЛџџѕџџqџџјљљљљјџџTPi[R%џџџљњћќќќћћњџџџR\[o##џхœWB==>A=@A4K`V\ZVNIEHAB@J<8;4;85468'FRhXVPIKU\y€vz™ˆ‘„’{sЇЧ|*^XAЩУаЙ”охPhZ/5ѕ`ŒЮДБ­ЈАТF\^[\heQKXLLPRdPRWn\jj^_`ka`aaa^^`^^Z^\Z[^[[\^^`cdZQKLITBA5%!*8VBCCCECEBCCCQFFFFFEECCFIEEHFEBEECFFCFACEAABBCCCCEFъџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџТ=KIIHFCEFRCECECBBBBACBEEBBECBBAAB@AAAAABBBAAA@@@@@A>4&&5APC3HkTVXWX[XZ[\XWXW[[XZ[ZXZXZZZ^g[X[[XWVUTUURH@8426;>FNT[^_cd_5<ПЙœ{™Ё ЊЁВЏA3X^m*ŒДЃЇЏЄЄЅЈЄŽЂД­Р@\j`/ЉЌŸЁЃЅЈЊЊЉЃЇˆoWF0NU[npE&22џџєџџм-џџњџЈK^cdZ\џџјјјјљљљљјљџџџ0V^cLџџїјњњњљјјџџџВџџ=Q_egџџџџџaџџјјњџњљјџџhd_apLyџўџџџr2iaV3>мџнv^-Cd_e0ъџџіїјјјљџо`Пi;wdj&'4AˆГxd^TI2*8644324234345686888;86-#0xьџд[0AVQJEA>@BFCEEBABCCUCAQ<;845686;;><*BLeXWZ^ipvnЗЫЧдhEXTVVVR>q!#4NTPPTWjtcgkpk‘dk”‘\`^srŽpWqFcva[WWRAV[^aXnr„”‹zja^cQ4#HaHхџџД2…КЖ—Ж‡ЅˆЄЌЅхмуДЃ”p€˜ˆZgxH_adem[0H)AЦы[08/B4APŸ›X_ZeXUAPf2<866544;ERLt–kL>#0-/--*--)*)'')))*'**&%FaVeiL=#'&%'#''&%!!&ф&'ђџrL^`;џџџјџџџЦџћјљљљџџЫT__8V\џџљћќќќќќќћћџџ)Kam[RЭџџџџџџјЯ8<-8^ZfZXQKFFEC@>;8654C84556'WUZXTKFJU^yzqƒ€vЁœГ kЂ­^XX6`ТЁŽЅqДЉ_^[™є™’ШОБЉЄШ|Xg^Z\\ZQKKJ[Q^gRVZ\^j`^____mm^`a^^^[^\ZXfX\\h^^`_q‹KNLVHHA>5&%8LBCBBBEFCCBECCEFEBFFBQEEHFCBCBBAEBCFQEBCEAABCCCCEEъџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџТ=IJJFEERFHFHCECCBCCCFFFCCBBBBABAABABC@@ABAA@AAA@@ABJ3%&4=CCCI\UUVXf[Z[\ZZWXWXXZWXWZXZZXZ\[WZXZZXXVWUTgLB85268;BLRih\moqJШЉp‰ЋŸœЁЃЖЏŠW\pRJ£˜ЂЃЃВЂЂЏЄЂЏЧ[*W\`6kЙЉœЂЅЈЈЊБЉЃePB!|&Z^n[!4!zџџѕџџE%Eџџіџџ#`apRљџіјјљљњњњњџјџџ_&LX`e!BџџјјљњљјјџџT!џџџџ#_aTДџџџјЏџџјјјљјјјџџџ#a_sm*џџўџџ^-^aT22сџР;-^Ъ'ede4сџџїўјџџџиoNЊ|FavoK526^Ђ™WPhN3<;65430024345558;88;6<=>><8=<@A53Rоњлh)CNRKF4CBFRRCBEFC2EAA<8855;<;8=@>@IQVkBNjptdЦХЛфmCNRVVVTNt##0>RWPhn`ogmrw€štf‹„‹TImmwTcN…ŒhcKmXIX[[Qceg`rƒ|––‚yrHR5nQ|џџџЁ/€ЌГЄ˜ƒйzА›ОЊДїЄУГЖ‹^ЁŽ“™„Ziifx„jE-AqџЦE350>BA8Bf™ŒiI[[Xi'&&'%&'&&!##*џC&EЮ@\_#џџїјјџџџeџџјјљјџџ6_`>гџџјћќ§ќћќќќќјџ№U\^^#џџљџџџџџџ‡XЖVFZ\fXQKHFFBBA88422233A4%APh[UPFEI^^stVsz„{‰ŠŒŽД-mXVА­“ˆЩˆЯRB[[<зф’­ЮОЙМЄТ2[^[[q\UPKJLNQP=CW\^\_^__aaccPca^^^\\\[[X[\[X^\`_P`˜>`KHA*WN5%%5LCECFECCCCCFHEBCFCECBEHIIIHCCPBBACAECCCCPBBBBCABEFъџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџЬALIHEFCHIFEEEBCCCCBBEEEEECCEBEBA@BAABAA@AB@@@@@@@BBJ4#!)3;6532223024466;;;;<=>AA><<=AB@BF<>Мџњ•L2PUPJ85CEBQCBWCABL<88668;<<>BBBI=e˜ЂKEWXWT@Pd>865;CQ\e˜r@C832---//-***-**-**)*)&!A_VZqQC'&%&&&%'%%%!%*џџ&'\I\^HЮџџјјљљїџџЯџџјџџџ__`Q™џ џѕјњ§§ќ§ў§ћјџџ^^^Pьџџќ§ћљњџџџџџџџз^^\RPUWEECFA>=<5330--0&I_eZ^JAAFXQ[jgxez|ƒˆˆˆ“Џ3PZXF3Йˆd йšЭ^\\tЧЬЄа˜­ЛСЁV^^\\nXPLNKKPPPQU[^i\__a`v`_mRm`^^\^h[ZeW[\\[\sr^\\f4LJF#EHF;%#4LFQCEECAACCFCEBQEHEFEFEHEFHCCEAAACBQECBBACCEBCCCCEъџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџџТALIJHFFREECCFFCBEECEEEEEECCEECBCBBAAB@B@AAAB@@@@A>A<2#[4=CB0C6aQUWWZ[\[ZZ[ZXXZXWZZ[X\ZZ\\^^^ZWXWV