%PDF-1.4 %вгѕ” 1 0 obj << /OPM 1 /SM 0.001 /Type/ExtGState >> endobj 2 0 obj << /OP true /Type/ExtGState >> endobj 3 0 obj << /OP false /Type/ExtGState >> endobj 4 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[255] /FunctionType 0 /Range[0 1 0 1 0 1 0 1] /Length 699 >> stream XЕ ƒ∞ —{^lџґmџ6lџґm'kџґmЫµ{їк4 S≥ƒ6Ѕ±јѕ_B"Й=H$х!@6…bдРЬFЃ#ЈдI0тJЊ#£АћЖQH g«(Т£®ЋЙQ\Jд¬,Щ≥ФФќГYF ж≈,Ч≥ЉT»ПYQ*јђ\≥КT-ДYM™∆ђQЂ¶‘*КU[к√™[ЂЮ‘/Б’@ЦƒjT Ђ±4)Н’TЪХЅj^ЂЕі,ЗЁJZЧ«nSї≠іЂИЁ^:T¬оXїУtЃВЁEЇV≈оV їїф®ОЁSz’јй]ІПф≠Е”ѓ6NPg† ™Л3ЄќZgШ oА3Ґ!ќH’wіМiМ;ґ о8яwВLlЖ;©9оdЩ“w™dµƒЭ÷ wЇћhН;SfµЅЫЁoОћmЗ7OжЈ«[–o°,кИЈXЦt¬[ЏoЩ,пВЈBVv≈[’ µђйОњV÷хј_яГlмЕњI6ч∆я“ЂlлЛњ]vф√яўЧм@∞Gц$Ў7И`њLpP !8<ФаИFpLО'81Ва§ЬIpZќМ"<;ЪрЬЬCxa,бEє4Ор≤\Oxuб5є>СрЖ№ЬDxk2бmrыҐ;дќ©DweЁЭEtѕ4Ґ{еЊйDчѕ z@ЬIфР<<ЛиСўDП csИЧ'ж?9Пш)yz>с3тмвз?//,"~Q^ZLьтвWд’•ƒѓ…лЋИяXNт¶ЉµВдmyg%…їЂHёУчWУ| Ѓ!щh-…«т…:ТOе≥х$Яo щBЊ№HъХ|љЙфЫЌ§я w[HњЧґТюЄНф'щy;й/тл“яvТю.м"эSюЏMжп=dюСчТщoЩ€/9—X endstream endobj 5 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[2] /FunctionType 0 /Range[0 1 0 0.6 0 0 0 0.06] /Length 20 >> stream XЕ Ѕ@ €O£Ш юэ endstream endobj 6 0 obj << /SA true /Type/ExtGState >> endobj 7 0 obj << /FL 8 /Type/ExtGState >> endobj 8 0 obj << /Width 964 /ColorSpace/DeviceGray /Height 1190 /Subtype/Image /Type/XObject /Length 1147160 /BitsPerComponent 8 >> stream €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€ыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€жоэ€€€ю€€€€€€€€ю€€€пщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээыэ€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€€€€€ю€€€€юэюю€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€ю€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€ю€€юю€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эюэюю€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€эю€€€€€€€€ю€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€ю€юэю€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€щь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€юююьэыыю€€€€€€€ю€ю€€€€€€€€€€€€€ю€эю€€€€€€€€€€ыэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€€€€€€€ю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€ю€€€€€€€ю€€€ю€€ю€€€€э€эю€€€€€€€€€€€€€€€€€€€€€юхь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ээ€€€€€€€€€€€ю€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыю€юю€€эю€€€эю€€€€ю€€€эю€€€€€€€€€юэ€ю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юью€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€ю€€€€€€€€€эю€ююшьююю€€юээю€€€юью€€€€€€€€€эю€€€€€€€€€€€€эфь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юююю€€€€€€€€юююэю€эю€€€ю€€€ыэюю€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€ю€€€ю€€ю€€€€€гф€€€ю€€эь€€€€€ю€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€юэю€ююэю€юэ€ююэьэ€€€€€€ю€€€€€€ю€€€эю€€€€ю€€€€€€€ю€€€€€€€€€ю€ююююю€€€€ю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€ю€€€€€€ю€€€€ю€€€ъэююююю€ю€€€€€юэю€€€€€€€€€€ээ€€€€€€€€€€€€€ю€€€€€€€€€€€юю€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ьью€€€ю€ю€ю€€€€€€€ю€ю€ээ€€ыэ€€ьэю€€ю€€€€€€ю€€ю€€€€ю€€€ю€юююэю€€€€ю€€€ю€€эю€€€€€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€ууэ€€€€€€€€€€ююю€€€€€€€€€€€юю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€ю€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€юэюю€€€€€€€ю€€€ъыюююью€€€э€ю€ю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€э€€€ьчцйёџ”ЌЌ…Їґј„ф€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юю€€€€эю€ю€€€€€€€€€€€€€€€€€€€€€€€фхэ€€€€€€€€€€€ю€€€€€€€€ю€€ю€€€ю€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэээ€ю€€€€ю€€€€€€€€€юююю€€юю€ююю€€€€€€€юэю€€€€€€€€э€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ъщхпйгббЏ“ќЋƒњґ∞®•®¶•©Ѓ°УУ† лчыююэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыэ€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€ю€€€€€€€€€€€€€€юююю€юэюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€€€€€€€юю€€€юю€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€ююю€€€€€€€€€€€€юююю€€€эь€эюю€€€€€эью€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьъщутпгў„”ћ≈ЉѓѓЃ™ђЂ®©Ђђ≠ѓ≠ѓ±ґїЄѓѓЃ©©£ЬЬЮ≥Ўмхъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€ю€€€€юю€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€ю€€€юю€€€€€€юэ€€€€€€€ю€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€ээ€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€юююююю€€€€€€€€€€€юю€€юээыю€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€юычхулая№’Ћ»јљЅє≥∞™ђђЃЃ®¶ђѓ≤ЈЄєЇљњґ±µ±≠™•ЮЦЛЕ~sokf^ZbvР¬лы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€эююю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€юю€ю€€€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€эю€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьщфхсибЏЏ÷ќ≈љґµµ≠∞≤ЃІ®∞≥≤∞≤ЄєњЇ≤Їі±Єµѓ≠ІҐЭЦТЙВВ|solc^[TTRKB<>@DKQ}ћц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ююю€€€€€€€€€ю€€ю€€€€эюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€юю€€€€€€€ю€€€€€€€€ю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€эыщшцсмгяяЏ”ќЋ¬¬јµЃЃ±≥≤≠©†Ьђє≤±Јі≤ґґ≠¶©Ђ®•ЫРРКГwqkd`\WSMJMMDDIA@B;=<75774834747;>AGQTXЦд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€€€€€€€€€ю€€€юююью€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эьыычфрннеЁўў”ќЅїЇє±І•™Ѓ±≤™Ђ≤≥і≤ґµ≥ґґЃ¶ЭШЦЧФКАunf`^\YUOHIIA:67642131000.+-.-,-.-..-096653210/..,)()++++,++..++.--///021/1AH>9;>?<>BBCGPSUZСяь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€ю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юэю€€ээ€юэ€€€юю€юэюээюю€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€юю€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€юэ€€€€ю€€€€€€€€€€€€€€€€ю€ю€€€ю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€ээю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€ъы€€€€€€эю€€€€€€€€€€€€€€€€€€ююююээьышшцфпегёЏ‘≈ЉљЇ≥∞ѓђ®®ІІІ≠≤µєїїґ±≤µѓ£ЮЧИ~А|vpjd^\WQOKGE>9676520/-,-.+*+++**++**)+--.....23001//36567545FNGAACCA@FFJMRYXWНа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€€€ю€€€€ю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€юююю€юююю€€юэю€юьэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€ээююэыэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€ююю€€юю€€юю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€ю€€€€€€€€€€€€юэььчщтмйиеЁў’–«√љ≥©ђ≤ђ¶¶™ђЃ±ѓ≤іґЄїЇ±Ѓ©†ЬЦОЛДvlf_YUOKFCA<8667434530.+*,..,+++,0/,,-,.--.-+-../32023456578788:;;><=>MWNDBDGHGHJQTTXYZРџь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€юю€€€€€€€€€€юю€€€€€€€€ю€€€€€ю€€€ю€€€€€€€€€€€€ю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€ээ€€ю€€€ю€€эю€€€€€€€€€юьэ€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€юэю€€€€€€юю€€€€€€€€€€ю€€€ъъю€€€€€€€€€€€юю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€ююэююэю€€юэю€€€ю€€€€ю€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ююшчрлиб—…≈¬ЇЈѓђ≠±±Ђ®©©ѓ∞∞Ѓіј≈њЄіі±ЃђҐЭЩУМД|wpbYSPIDA?;5555430-01-+---,,--++,,+,0/-/-../.0.-00101/25456:9448;;<;;?@?BB@AR]QGHHIHHJPTUUVVYПё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€€€€€ю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€ю€€€€€ю€€€€€€€€€€€юю€€€€€€€€€€€€€€€€ююэю€€€ю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€ю€э€€€€€€€€€€€€€€€€€€€ю€€€€€ю€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€ю€€€€€ээ€€€€€€€€ээ€€€€юю€€€€€€€€€€€€€€юю€ю€€€€€€€€€ю€€€€€€юю€€ююю€€€€€€юю€€€€€ююю€€€€€€€ю€€€€€€€ю€€€€€€€€€€€€€€€€€эььцройаџ÷ќ»ƒњґѓ≥≤Ђ©≠≠≤ЄЇЄ≤Ї«»ƒјƒ∆јґ∞≠Ђ§ЮТЙБyqhaZTPMFA=<943/,+)**)',.../.**-,.1/--,,+,.-./1110011122333755574:>:9:<==<=<>A@??ACACECDEBDUaTJLIJMNQTTUVUU\Уџы€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€эю€€€€€ю€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€ю€€€€€€€€ю€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€ю€€€€€ю€€€€€ээ€€€€€€€€€€ю€ю€€€юэю€€€€€€€€юю€ю€ю€€€€€€€€€€€€€€юю€€€€€€€ююю€€€€€€€€€€€€€€€€€€ю€шфчфрре÷“—…≈≈јЄ≥∞Ѓ≠®§ђ±∞±µєЉј«–ЌЋ–—–«ЇµµЃҐЬУЙzqlf`XQKE??;630.---(')((+,*())**),.-,-.+*-//10/00/./1015:76447768;9::;;9:<:<>=;=>@BAAABA@BAA@ABA@DGGFYh\NNMMQSTUVVUUW\ФЏы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€ю€€юю€€€€€€€€€€€€ю€€€€€€€€€€€ю€€€€€€€€ю€€€€€€€€€€€ю€€ю€юю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьь€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€юю€€€юэ€€€€€€€€€€€€€€€€€€€€€ю€юэ€ю€€ю€€€ю€€€€€€ю€ю€ю€€€ю€ю€€€€€€э€€€€€€€€€€€€€€€юэььэхуфпозаџ”Ќ»∆√јЉЇЈѓ®™Ђ®™Ѓѓ±µµµ≥Є∆…ƒ»––ѕ—Ќƒ¬њЇ≤®ҐЫХЖzohe[UNID?8851,--)*+,+'&*,,)(***-0.,,-.,-/..,.//./2422544555568:><;9;===?A==@?<===>>@@??@@@>AEDDBBA@BBEEDHFDG^r_PPQQSUVVUUVXX[РЎщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€юю€€€€€€€€€€€€€€€€€ю€€€юю€€€€€ю€юю€€€€€€€€€€€€€€€€ю€€ээю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чч€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€ю€€€€€€ю€€€€€€ью€€€€€€€€ю€€€ью€€€юэю€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€ьь€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€щь€ычшххцтквя„–ћ…јїЈ±ђ¶•§§§І£ҐІЂ≠Ѓѓ≥єј≈ћѕ–—“–—ѕЋЋ≈јїЈ±ѓЃ©ЫПИИГreZTKA655.-/-*))+-*),-*)-.-*)-.-,,--.000./12256334434579879;;;=>;;<===?@>>?>ACC@?AA>><>A>?@AABA@@CGDEEBBBDDGFFEDGJ_r`RSTTTUVWXWVY[\РЏшю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьь€ю€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€юююю€€ю€€ю€€€€ю€€€€€€€€€ю€€€€€€€€ю€€€€€€€€ююэюю€€ю€€ю€€€€эю€€€€€юю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ыы€€€€€€€€€€ю€€€€€€€€€€ю€€€€€€€€€€€€€ээ€€€€ю€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€юью€юэ€€ю€€€ьь€€€€ю€€€€€эю€ю€€€€юю€€€эю€€€€€€€€€€€юэ€€€€€€€€€цшю€€€э€€€€ю€€€€€€€юю€€ьъчштсцпждвё”––»¬јЇі±Ѓ™¶§Я†ЯЮЮҐ•І™Ѓ∞µњ« …ћ‘“Ќѕ‘‘… –Ћ√¬¬Ї≠•ЯХЙ{soot|~ve]b\J:3.+'*)(*))-++,,++..00-,..+-,,./0001455436889<:9:=;66:=>>>@@@BBA??@A@?BBA@@@ACC@A@CD@>?AA@@CBBA>DFFEGIECCCEGGFEDFHbxeTVVWXWVVWXXXY[НЎъю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ью€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€ю€€€€€ю€€€€юю€€€€€€юю€€€€€€€€€€€€€€€ю€€€юю€€€€€€€ьь€€€ю€€€€юьэ€€€€€ю€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€эь€€€ю€€€€€€€€€€€€€€€€€€юю€€ююю€€€€€€ю€юэ€ьыэю€€ю€ээ€€€€€€€€€€€ю€ю€€€ю€€€€€юю€€€€€€€€€€€€€€€юю€€€€€€ущ€€юююю€€€эышшъсйгЁџЎ‘Ќ»¬ЊЄ≥Ј≥ђ©І¶ҐЭЩХЪЮ°ҐҐ•™∞≤Јј Ќ—’ЏЁявяая„”—Ќ«Ї±™•ЬСПОЙyume]SLE=647=@E@07@9,&'&%&*+)(*,*)54--/21/0110/02122135579;=;<>@AA@>=>@@=>>?ACDDA@@B@@?@BBCDCEDAACEC??@DDDDA?BDCBACCBEEDFFFGFEDCHJHGHGHf}gUVVWVVZXUVVVWZОЎъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€ю€€ю€€€€€€€ю€€€ю€€€€€ю€€€юю€€€€эю€ю€€€€€€€€€ээ€€€€юю€€€юю€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€ю€€€ю€€€€€€€€€€€ээюю€€€€€€€ээ€€€€ю€€юэ€€€юыэюью€€ьэ€€€€€€€€€€€€€€€ю€юэ€€€€€€€€€€€€€€€€€ю€юю€ю€юююэшккфулзжгвя№Ў– ≈јµ≠¶£ҐЬЩЩЪЫЧЦШЬ¶ђѓ±ЄїЉЉєЅ ”ўЁявилнрффрмзаў–√µђЮУРМВvokh`URPKFB<851.($$%'+)&))%(,**))((****+++-1;;21224687555799::===:=>??>@BCBBA@@>?AAA@BEDFC@?>AB@AB@BDEEEGEBDDBB??CDDCA?@DDBBBDEEFEFGFGFHEDJLIJMLIfАjWZXWXVWXVWVWVVИ’ы€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€юэю€€€€€€€€€€€€€€€юэ€€€юю€€€€€€€€€€€€€юю€€€€€€€ю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€юю€ююю€юэю€€€€€€€€€€юю€€€€эью€юъцы€юю€ьыэъь€юю€эьююю€юю€€ыэююю€€ью€эъьюыыщпосфунидбЁЏ“¬ЈЊїі≠©£††ЬЩЦЦТМУЫЬҐ•®ѓґљƒ« ѕ”№бдкрттфууффркзаЎ‘ѕћ«ЅЄЃ†ЩРАuoh^XTPG@<873/.-++)''&#$#"""$())+*)+**++-/-,...10024448996:@?<;==>@>>@A@A@??AA=>BCCBAB@?BCBA@AECDAADABDEFEDCCDC@DDDCBEDBBBEDAA@AFDACCDBBEEEFFFEFECHKLKMNLhАn\XWWXXXXWTUWWXЗ”ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€эю€юю€€€€€€юю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€ээ€€€ээ€€ю€юэю€€ю€юю€€€€€€€€€юю€€€€€€€€€юю€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€юю€€€€€€€€€€€€€€€€€юю€€юю€ю€€ью€€€€€€€€€€€ээю€€€€€ю€ю€эьюю€юю€ю€юююэююээю€ьыцшю€€€€ээээ€€ээьшьюъчцццфснйдеаЁ—Љєƒ∆ЊЈ∞ђ©ҐЯЫФПООНОРХЪ°¶®ђ±іµ√—÷ЁядлпучшъьыьыъшцуойвЎѕ√µ©£ЩПИВ|wpid[UL?<<721,,*%$%'(%%''&&%%&'%"#%((*,+,++..-//./451258769;>;:;=>@@A??@?AAAA?@@DC@ADDA@BEDBCBACDDB@?@AABDDEECDRLCGFDEECCCECCFECDDCDECBBGEBDCBCBDEEIHEDCFJJIIIJIJf}kZZXYYWVXXVUXYXВ”ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€юю€€ыь€€€юю€€€€€€€€€юю€€€€€€€€€ю€€ю€€ю€€€€€€€€€юю€€€юю€€€€€€€ю€€€€эью€€€€€€€€€€€€юю€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€юю€€€€€€€€€€€€€€юю€ээю€эю€€€€ю€эыю€€€€€€€€ээ€€€€€€юю€€ээюээ€€€эььюъъэъыэюэьэ€юьъьюыхфхччутттнлиЁ„– »¬љЄґ≤™£ҐЪСТЧХХЩЪЭІ®£•ЃґіЇњ∆Ћ”ўбжикнпрцььыыъщщчтнлжбџ‘Ћ¬Є≤™†ХИАwne]WPJDB@86641-)('%#$$#$%(&&)'()(()))**(((++**,--/00479856::::===>>==>>>?ACB?=>CB@BCB@@A@CECBBDEFFFGFDDGFEDDCAABEFEEGDCPOHJHGHHHGFGDADGGHIGFECCCHGDBDDEDFHGJJFDEJKJJJKJJLkЕn\[ZYYXWYZYXWXWќшю€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€ьэ€€€€€€€юю€ээ€€юю€€ю€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€ю€€юю€€€€юью€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€юю€€€€€юю€€ююэю€€€€ьэ€€€€ю€юэ€ю€юээю€ю€€щхшь€эщруъэщтфнжзздёЏЎ”ќ»√љЉє∞™¶†ЪХУЦХФЧЩЫЮ°•ѓµїњЅ∆Ќ”ЁвабисфцшъыььэьышцхунзṄѕ«ЅљіЂ§ЫФЛВzpea]TIB@=931.,))+-''+-*&&&$#%&'&&(('+**,,-/,,...,+-./..1137:;==@@>>=<<>>A??>>A??BACEDB@AFGDACB?=@CDFDDCBEFEFIGGGGHIHFEDDEIHFIHGFEIMKIIIHHIHFCDHGFHIFFFDEGHHEEGGGEHIIIIHEEIJJKJNNKLnЛr^][ZZXYYWWVVWX~»ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€ээю€€юэюю€€€€ююю€€€ю€юю€€€€ю€€€€€€€€€€€€€€€€€€юэююю€юю€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€юю€€€€€€€€€€€€€€ююю€€€€€€юю€€€€юэ€€€€€€€€€юю€€€€€€юю€€€€€юю€€юъэ€юыцъ€щоилорпе№ёяёЎЌ∆≈ЊЄµЃЂ•††ЫУТФЧХХЪЮ†®±єј√«–’џдедкпуццчыэььыьюьъъчтойжяЏ’ћ≈ЊґЂ°ЦПЖvmjaYSOIB?<81.-)''(($#$#%&'*,)(*,-*(()((')*())+.-.0156356776566568:9;=;=??>BB@@BCCAAECAACFCBDEEDCB@@CFGFFIFEGGEFHGEFGHHHFCEGEGGJJGJJFIMJGJKIJJGEDJKHFGFEFHIHIIJIFFGGHIJKJIFFJHJNNLMPNMkКt][[\[YXXXWVVWXz∆уы€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€юю€€€€€ьыюю€€эю€€€€€€юю€€ю€€юююю€юю€€€€€€€€€€€€€€€€€€€ю€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€ээ€юю€€ю€€эю€€€€юю€€€€€€€€€ю€€ю€ю€€€€€€€€€ю€€€€€€€юю€€€€эщъ€эщшхригё„”ѕћ≈ЊљЈ±Ђ®£Я°ЬЧЧРКОШШЧШЩЮ°©≤ЉЅ≈ќ”ўбйптцщыыьъьььээыщцххтнижṄ—«ЅЇ±•ЭХМГyqicZSKEB@;851+)('%%&&%$!$(')(*.,055667867;:511552257;@?=>>=??=<:;><<<==<==>??>?@CCB@>ACB?@AHOSTWXXYZ\\]_aacdbbdffccedggdacddbabehjkmnswz~АГЕЕЖЕЕГГВ~|zyzzyz|{yyxwx{zwvuqpnmligeda_^\YUSRSSSSQLLOONNNNLLNOOKJMNLLLJJJKMOMJKLLJHIKIJKIKMKFGIGEEHGGHHJIILLMKKKMMORNIJeГq]]YYYWXWVWWVVWw√съ€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ээ€€€€€€€€€юьь€€€€ю€€€€юю€€€€€€€€€€€€€€€юэээююю€€юыью€€€€€€€€€€€€юю€юю€€€€эъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыыъумзгЁ’Ќ∆≈ƒњіѓ≠¶†ЫШЦЧЫЬЩХЫ••ЯЬ•і∆‘’ЏбвббгинфчцчцчшччшшхцхуххусокегЁ’— љ≥Ђ•ЫРНЗurmhc^YURLJIECBB>976631255531222257543468<>=:;@DFE@??@CBA@AA@AA@?>:9>@@????ABBEBDs∆я„„ЧO?@BADJNRUVVYZXY[Z[_abceffghiifegijiikkijihjjknpsx{~АГМРПОНМНЛИЙЖГГГ~|{{yvyzursuwzzy{|}~}{|{{{zxwvqmllihfc``_[ZYYXURSSSOMONNMMKKLKLNNJLMLJIKOLKLJJLJHIIJIHIGFGIKKJKJJJIKOMLLMJIjКs\\YXYXXWVWVVWXuјсы€юэю€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€юю€€эю€€€€юю€€€€€€€юю€€€€€€€€€€€€€€€юю€юю€€€€эьююю€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€юю€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€ъсш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэьъъхоозв⹑Ќ∆јЈ≠І£†ЮЬЮ†ЫЧЩ£∞ґґЉЊ√ƒ ’÷ѕ”ёаягкпфщщщьыыээщшщъшчшцхутолзевЎ– ≈Ї≤Ђ¶ЮСНЗ|oif_XQNMKC?>:6654543111332443576876899<::<<;:=<;;=AECCEDFHECDEFECGIGDBBCFC?>AEFFEDBCEGIIFHoЈ—‘йЄgGFGHNRWXXZZZ[YZZ[]^_acdeehjklikkilmopnmnqrttwxvzАГДЕИПХЦЦУОМЛНСРОНЙЖЕДГГББВ|yywwwwvssvtrrstuvvxxz|z{}||}}|zvvvvvsoljgdb`_\[ZWSRPMOONLMMJJLMOMKJHHJJHIFHKIGGGGJNMKMKGHLKMKHIKJIkМqY[ZXYYZXUUVWXXoЇсэ€юю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€€€юю€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эшы€€€€€€€€€€€€€€€€€€€€€юююэшцфоонжџ÷–… Ѕі≤≠§†ЬЭ°°°Ґ•ђ∞±ґјћ”–Ћ‘ёйсптцщшцыьшцшъыэьыщщъшщщщщчтррнив№÷—Ћ∆Ї∞©°ЫСЛВxolf`YPLID>:720/00/-,-//--/00.046956::89;=;:;=<=BC@?@?=@B@?>AGGFHHHIGFGHHFFILMKEAADEC@BFGGDEEEDFHEDH[ВЩЂƒіtKIJNSTVXY\][]\[Z[\\^_acbdghijikmmooqqpquy||}А~|БЗЛНННПЦЦТСНЛКМПУХСННЛЛЛИККИЕГ|{{}{wyyspprrsrqsrqrqrtuuuvwxwx{~~}z{{zywtqljgefd`a]XTSSRPNKKJIJJJHHFGJJIHHJMONLLHGKKLMJJKJIeАo\[[XXZZYWXWXZZn≥у€юэ€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€юююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэюэышхтрлзгяџ’Ћ≈¬Ј≥±™ҐЮЬЭ†ЮЯ§ЂђѓґЅќўёгзнрсхъюэььээюэьээээьыыъъщчшшццупмиебЁЎ— ƒї≤ђ•ЫСЛЕ}smg`XRMG@;:62.,,,+*))()***+-+,..01133359;=<>=<=<=><@BCBACBBDDCGHFIIGDFJFCGLLJIHGIGEHFFGEFGDEFEEA@CCCECBDDEFDDFDDHKP\]Y]]TLKOORTTUUUWXXWWXYZ[]^`_`dedeghhjnopruvuuwy{}А}ГДГДЕИМЛЙЗКЛКМММНННППЛМОООММММИЕЗЖВГГ|yz{zxwuvutvvuvvutssrsvxxwustusrstrrsststuvxzzxuvxxwvvuvxupqnljhec`^ZVSUTRRQOPONMNOKMOMMb~p^][YXXYXZYVXYXnµоь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шцю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€юю€ээ€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€юю€€€€€юю€€€€€€€€€€€€юю€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююэыъъцутплвЁ‘ ¬љїє±Ђ®¶©®¶©≠іЈї»—„‘„енруффччшыыыыээьъщъцфцхутууухспстсссснллзгаџ÷– јЄ≤®ЭЦМВ{phc\VSNG><;61.-,-+++*+,-+,+()***+-+..-.010165668;;98>DC?=?BCBDFFDBBDDCCEDGGFIKIFFGCBEFIJJHGIFDCBBBBDEEEDDFBBCBCGFCEGGGGGGFEHEL\]YYWQIGKMMNOPPQTTVUVWWXZYZ]_acbceefeglnopsuuutvwy|}~ВБАБГЖЕЖИЖЖЗЙКИИКИЗЗЙИММИИКЙЖЛОЙЕГАА}}|zzxy{zxxyyzzxxxx{|{{yxwwwwwtstsuuvwustsqqqqrssssuwwuuvvtutsttrononlllgb][ZYVQRSNNbzl][ZYXYYWXYXXZXk≤лъ€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€юю€€ююю€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююэчтролйжв„ ƒјєґ≤≠Ѓ∞©Ґ©≤±Јƒ…–’÷ўжнмсчшъэ€€€€€€€€юэьышцхсолизедедгдаЁавабб№ўЎ÷“ѕћ∆Ѕїµ≠І°ЧОИБyrjcZUPGDC>82.0/*'((((*('*+-/,,,,+-00/10/0.241225::;>?==ACACBACD@?CCEFFIHEFEBDGEEDDGEFFFFGEBEFGHHJKJHHECDDBACGIHGEDCEFEGJIDFIFHLIFGEDENY[[ZXPDCEHGHIKMNPQUURRTTTUWZ\__begcabeghjlnnporrqttuzzy{~~ГДДЕЕЖЕЖЕЖЕЕГГЖГГЕЕИЙЕЖЕДЕЕЖЖВААААВА~~~~}||}}|~||}{|~~|zz{zyxzzyzy{|xvuutsrstttsppqrsrrppqorttrqstrrsttssrppnkigdfrАwkhdaa____][XZ]nЃлщщчъэюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€юю€€эю€€юэю€€юю€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€ыъщурнйзв‘ ≈љіѓЃ∞±≥ѓ§®±ґЉљљ√“бяџёмфхчы€€€ю€€€€юэюьээьъышшчуттрлллея№ў’””—–—ќ…«≈њЈі≤≠І†ЫЦРЙА|wngc^YRKFD>75200.-0.*((*)))(')+,-./000111/.256535845:;;956?BFFHIGGIGEGJIECCFFCEHIHEEEDFECCCBEGFFHGGEEHIIHGHMKFHGFEEGDCFIIGEEFFFHKPLGHIGIJHFHIFHT]]\\ZQE?@A?ACEFEFILJINPQSUUVWY[]``^]_`beegihhiklkmqqttrtzzx{~АБА~~~}}{|~~ААБАББА}~~Б~}~~~|}~~~БББДЙЕВББАААААААА}}||{{{xxxvuutrststsppoppppqqppomllmnoqpportssrsvxxxwutttvxwtsqpxПїенмнтфуччшъэьъэюэюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€юю€€€ьь€юь€юью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юцурнкеЏ–«њєµ≥∞ѓЃЂѓ≤≤ЄЈіњ≈»‘ёаяиптшшчшъэю€юэю€€ю€юьььыыыъщъъшчфтфспрмиижаџ№„ќ «Їі±©§°ЬЧТКАyrnjc\XUOIDA?;75431,***''((*+,--**,--.-+-01002223359979::>A>AEBAFGFHECFHOQMNPNLJIGKIDBBEIDBFEDEEEDDDBABDFHFCFHEDFGFIJGHJJJKIFFFHIGDGKJFKLFGHINRPLJGHJHFHLJIOUZ\\[VJ:454578989=>=?ELTYZYZYZYZ]]]\[]^^]_bab``ccfjjikjknnnprssuvuwvtuuwvutuwxxxzzz|А~{z{~А}{{|{{}~А~~}~}{|АВВВГИМЖГВДЕЕЖЖЗДДГДЕБ~~~~}}zvvwwvuuttutsrqusrsstqoonnmnponpoqsrsrqqqsqooprrtuvvvxxЗєџ”¬Її√Ќ–’№дейннтцухччэ€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€юю€€юю€€€€€€юьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€юььэчомйа‘ѕЋ«ƒјЇі≥ЈЈ±ѓ≥ЄљЉЅ…ѕ„џЏЏёинтсушыьэ€€€€€ю€€€€€юэыыььыьыъъщшчфутснлкеаёЏ„”ћ«ЅЇ≥ЃІЯЩРИГ|phb]XRNIEA?<7530--+**($%''''()(((+++...1/.10.1134523778:::=?>>?BEIJFJMJMNNLJNQPLNQNNLILOLIJGEDBABDEDBACBBFDBBDCBCEIJGDDDEFDFHGGIIIHFJMLGGJJJJGGHHHLLHKLIHOSNJHKMKJKKJKLMT\^^\O6(*,+---..12348@HPX[]^a`bbcedcca`acca`ccabbcaabdddffdehmommpqnnmnpqpqqqqsuutwzxwvx{{zxyyxxy{|{|}}}~}||{y~АГЕДДДЕДДЖЗЖЖЖЖЖДДЕГББАzwxyxwuuuuwxxutstuuutrpststusprtqqtqqqpqrtqnkmoqqptussryЪ±ЪЖДЖМСТХЫ§¶Ђ±Јљ√ћ—„№крнтчшщщьььэю€юю€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€эю€€ю€€ю€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ышю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ышхуовЎќЋ…ЅЇєґ±іЇі≤ґЈЉ√Ќ–—ћќ„взжксцуущэээюээю€€ююэээььэььэьээыььыыьшццфусокжбёЎ“ѕ…¬Ї≥Ђ§ЮЦОИБxrke]UQNI?:740,''&$%"!!"!! !!"#$'&$%&*+*,--./0.05338658679:;;<;<==?@ADFFFHJILNNLLMLNONKKLLKGHMNIIJJLIGFDDCAABCEEDCDDDFEDDFEDFEIHGGHFDEHGHLIFKKIGJMKHIQNFIGGHGJMKJNMLLKNNLKLONMKMMLLNRZ`a^WB.((!#$&(((+028@EMRUV^bdfeefgfhhhihhghkjedeeeghebdegighjigghhiklkklkllnmnpnprttrrtrruttwvuwxwyzwxyy{}}~ДЖГГЕЖЗЖЙИЖЗЖДГЕЗДГГВББВГГ|||zzywvxwxzzywutuvvuttvvxywttvwuutssrtstwttsrrwvruvttwwz}{{|{}А~~}~~ВЗЛРФЩ§≠≤єЊ≈ћ“Ўядзмоптхцшьэь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€юэ€€€€€€€юью€ю€юььююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€ьыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ычфурмг“ …∆ЊљЄ≠°£ђ®ФНУ¶√ћ«’жгвимосчщщчшшььыю€ээюэьыъыыъъщщщшшщъшщшччцхфтспллз⹄–ћ≈Љґ∞®†ЧРЛД{vpjd`YSNJC<:94/,**)%##$#!!! !#$#$$$$#%(')))+*(+-//01113424769=<<=??AEDCCFGEFDEHFFHIIJLKJIIKKJKMJHIHHJGGIHGHGEGGGFDEGEBBCEEACBBEDFEEFBDGFFJJEFHGHIJIIJHJKJLKJGFKPMDGHHKJJLHIOMMNNMLLMPPLKLNMJLOQV]^ZYR>*# !(*0469>EMPRV[b_`ehghijjllklkkkikkijnlklnnkhfhjgggfghghjkjiiijknolllllnprqpqqrssuuuwwy|~zzАГАГЗЗЖЖЖЗЙКИДГЗЙЙЖЕЗЖДДЕВ~АА}{{{zxwxy{zyzxuuuuuvvvy|zyzywuwxwxwuvxxxxz{zxyxxyyyyxy|}{{}|}БВ|zxvvwwyz{{|~~~АГИМОЦ†§®≠≤ЄЅƒЋ„Џёжинхчыьью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€эю€€€€€€€€€€€€€€ю€юю€ю€эуоъюэ€юьюююю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэъщфммлё÷‘— √љЈµѓђ∞∞§ЪЮЃЊї™™¬„„√ЉЌбсццъюьыюэьюююьъььъъыъшшшщщшщъщчхуттспкегба№÷–Ќ ∆ЉЄµ≥±ІЮУМБzuokgbZVQNKC?=93//+))$#&$!!"##%$#$$!!"$#"$%&')'&(''*+-0/..-.12236658:9=?@DHEFHKMKLMIGLLJJHGLLHJLHHJIHFGIIHIKGGGGFGIJKHGGFHFFHHHGGEEEAEHECBADDGFFGDEEEHGGGHKIIJJLKJMMKJKLIIHHJIGIKKKJHGFIPPONNPMKLQPMLOOLJOQQRVXVUQC0&   "#&+/.3;BDEIQSX`bbdgjifiijjjiknnlmpnnlnnnnnmlllllkjkkhffkmkiighhgimmlklnqopqppqtvvuuxyxДГВГБГДЕДАБЕЖИИЕИИЖДВ~}А|{{zzwvxz{|yyxvutuvvvw{{zyxxwwy{z{zxy|zz}}~~|~А~~А~|}ВГАБЕГВЖДДЖЗЕ~|}{yyzxxwxyxvvwzyx{{|~АБЕИЛПУЩЭ§ѓЊ ”÷Ўаекпхъю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€юьююэ€ьщью€ю€юю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эъшххтйгёўѕќќ∆√ЅєЄЄѓІ©≥єњƒƒњЅ…—яў“ўгонзйушшхфшщъыщщщшщъшъыщщщшшшшчфууплизжегбўќЌћƒЉє∞©£ЫЩЦРЖГВ|ssvvqbYQIB==;610.,+*))(&%%$%$$%##&$#$%%%%%&&&%&&&''()*++,,,++-./4335648:::??>BBBILLMROONPRQRNJJNMJIGFHIFJLHGFDEFHGEFGEEHFEFGFFKJFFHGEIIEFFGJHEEEFHECDDEFCCHJJHCGIHJKKJJJJKJJMMKKLLKKHGGIMNNKLOLKLNQRQOOPNKLLMONPOKJORRRRSTRLC=6*!    !#%%'+/48;=BKPSTWZ_dfgjkmlllmlkllmmlklnmopnkloomihmnmppnmkhklllijlmkjlkkkopopnnprvxxzzz{z|{y{~АБВВБ~~|||zyyxxwxz{zzwvwuuuutsuuvwzywxzywy|~}{{|{}АВГГБВГДВВЕГВВДЖЖЗЛНЛЙИЙККЙЗЗЕВ}}~~{{{zxxyxyyyyyyy|{z{{z|z{АЗУШУЦЬ†®≤Љ…ўяднцэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ююэю€юэ€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€юьыыщцхсмивбЁўў„Ќ∆≈¬њЄіЃ®™≥Ј∞µ…Ќ…ќ’”„вмруусучхшъчшшшчцхчшххчццхфхфуфххххтсслйивЁ‘ѕ– њЇі≠©•ҐЬХНЛИАsmgd`WQPNGEB?::C@:764.*))(&'(&())%',)&('$%''&#%')**))))(')+,,*,,,-.00243124657:<><;@CBFIFEGIGMRPOSTTQPPQQQMLNNKHFFFHIJHEFDABFEDB@ACEEDDEDCEGHFDEDEGFDADGGEBDCCFECEEFHGGGHKICGLJJMNLJLOMKMKKLLPPMNNLKNRQQORSRRPQRQONQNLLMLNONONKMQSRQPQSRMJIE9.'  %&'(+,/2579=AFJOQV]_cgklmmnomkjkkknmkjlnmmknpprrrsqnqsrppomommonmmmkmojkopnpqqoqqqrstuvxxwwxxyxvxwwvuuuvuuuwxwvtttrrtropsrruuwwxyxuw|~}|~~~БГДЕЖЕЕЕЗЗЖЖИКЗИЛЛНПОРПОРРОООПНЙВАВДААББ}|{}АА}|zy}}zyzyzzyz}~|{zxx|АГКУЪ§≤јќ№дочэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€ю€€ю€€юю€€€€€€€€€€€€юэ€€€юююэюю€эю€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэээыыъчрппмеяџ÷”ѕћ »Љґі≥ЇЉЇЉ¬љєЅ¬≈ћ–ѕ—ўёвбжтфтфффхшццусутпосссстсоопрпкийзедвбЁџ№ў„“Ќ»¬љЄґ≤ђ£ЫШШОyqme_\YSMJD>72/.,)''')((*-1:DIJIE?=<::;@CAAJME@??<831120--,+,-,--,-,+-/02/143579:9<::<=>>=@ABBBFHILKHGJMNNSQQRSSRPPRTTQPSSMJIGKLIHGFEDBBCGEDDCDEDDFEDCEGGIHHHGHIHFHLLHDFGILKDEIJIJJIIJJJKMJHHILMNONMMLNMMQRQOQRQQQRSRQRSSRRSQQRQNMONNOMMNOMONNPNMMNPLKOKC91+$   !!$#$&('(,-/1359<:42.,-*)'&%!!!"''),06>CNZ`]Z[ZZYXZ^abchqvqllnkeaa]YWUQLHHHEA?==<9989;66:<=@A?@@BBBBADCBBCCGHHLMKNMPQRQQRUTSSSSRSTSTTTVSOKJLLGGHGGHFDCFFFEFECEFGEBDHFEHIGEEFJJIKPOKFHJLONHMNNMKJLNKJKOJHHKMKHKLLJKPQPONOPPRSROPSSSPPRSRRQPSRNOPPONNLOPOOLJLOPONKOMJNLG@;5,%#    "#""$'(*,*+..-.1158:<;=>>CHHKNUWX[]`^]fpnnoqrrrpnnonlkhhjkiggknlnqnnqrpnoqqqqrssqsutrqppnoqnjkmlonjkkllmnnmnmjihhimmijklorqqstuvyzzz||{|ВЕДЕГАГВГЕКННННОРРПТФССФШЧЧЦТРПММЛЙЛЙЗЗЙИЕГЖЗЕВВБГЖДДЕЕДЕЖДА~}~{{|yvux}}z{~ЖРЩ™Ї«’зшь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€€€ююююю€ю€€€€ю€€ю€€€€€€€€€€€ююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююэыыыщцууунга№ЎЎ–≈ї≥±µµ±≤іµЇЇЇњ√Ћ‘ЎЏаикотртхцхцчщшхутспопороооррпоппнмнмййебЁ„–ќќ…∆ЅЇ∞∞≥≥ѓ®†ЦССРЗ~wx}sd][URPOJC@<:620-('(%#"!%%$*52#""$*.28=IUW\beecffgiighhihhlkloruwzzzxx||{xxzwtrolkf^[ZYSNLKLIIGCCDFFBDEFFGFFDGIKNPMQPPRRTSUWWUUVVVTTTUUSSRNJJJIIIJFGHGHDDDDCDCBCDC@BEFDCFFDDBDHEFHIKIGEGLNLJKLNOLKMPNNLOPNOROKKMLJJNRPRPNOPPOQRQRRUUSQQQRQNNQOLNQONOPOPQPPMPQORROMPQKJKJFB:60+)'!    ! "##&())*,.-.0024677:889<;;?@>>@A@AIPNTWY_`beggggefdcb_^\Y\_]\_^^`ddcdfegillloorqqpoqrsrollmmkihjjjghhihhgeecdccdeddgkkkmnnpruuuvxxxy{}|}ББАБЗЙЙКМНРРФЧУТУУЦЦЧЩЦРОННМННМНМЛЙЗЖЗЙИЙЕЕЖДГГДЕИЙЖЖЖГББВГБАБА|z{~{yyz|~ЗНРЩ™¬‘йщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€ю€€€€€€ююэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьъххрдаЁ„ѕ——∆ЊЉєЄє≥ѓµЈґєїЊЅќЏёбяелорсрхчшчфтфхцхуууррпссрпппппннннйждедёЏЎ‘ѕћ»ЅЇЄ±™§†ЩХФПЗБ{vxxvvohc`[WSOKTbT?<;755763300/.,*)%'&$#$('':^S) $%)/4>CHTY_cfhhilosvtprrlilkjhhkkkkkmllmlnouz||~АВДВААБА{xvurlhfa\ZYUPNOLKLJIFGINPQQRPOQVVWWWXVVWXXVUTSRNOOJHEDGIHIGFDFGC@BBEDBBBAAABABFDBDCB@@DCCDEHECBCGGHIHINQLIJMMJHLPPOQRRQPOOQPNPQNOPPPNORSTRTTSTRRRPPOSQNLMNOQTQOPQOQSRPRPNPOPNJKLHE?=:6-,+'!     !!$%'(()++,-./24488876:;:;;<:<<=>=A?BCBDDFGLNMNQSSVWUUUUSTRTUSRRSUYYXVXZ[\\__abcbafmssppmkjifdffeeedffdcbbaaa`_```ccdgggknnonnptsssuyxwxxxz|yz{}АБГЗИКНППОРССЧЧТУУСРСООСППОММНМКМЛМКЗИЗЖЗЗЖИККЙКЛИЗИЗИЗГЕЕГБАБА}~}}~А{|ВКЩѓ вц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€ю€€€€€€€ю€€€€€€€юю€€юююю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ьуолижеё÷ Ѕєґ±©®ЂЂ±≤ґЉљЅ≈Ћ‘ўџбзлттхчщычъыъщххусстрплклоутрпонммлкиебяџ„‘ѕћ«Ѕєі≤ѓІЮЫХРКДБ}wpnjhb_[WTNKNMIIIEDFB???=?HRLB?==<@@>?>:;=954/,,*+,+-49NjV0 "$%+-15;EKRY[`einlmrxАВ}xyzwsnnonmnnkkmnkkjhgfhlnlkloporvx{}ВГББВГВ~zyytommjgc_ZXYXUTTVSPQVWWUUVVUVUTSRQNLJIIHGCEGHFHFCCDBB@AED@?BA@@?ACAABBBAB?=?>?BBA@CA?CAEHJIJMEDFDFGFHKKJILONMORUVSRROQROMONPRSQQRQTRTTQPQSSPNMNNQSRPPPORQPONNNPPMLJKIGIG@<;52/+'$#  !"#$$%$%')+,-+,001224657789;;:==<=<==?BBBAABCFDCEBCEHIIKLKJJMOLLNNOSUTRRTUWVVYYXZ[Z^emnnonlhgb^a`\_cb__aa__a`ba```ab`bddedhihkllmnmmnrtusrsttuuvwzy}ААВЕЖЕЗЗКРТРННООНОППНОТСОМММООММЙЙКИИЙЛККЛЛНОННМЛЛНЛЛЛКЙЙИЙИИЖЕГДЕЖДВВА~}ДТ•Љџф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€юююэ€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыцшумкйб“ ∆¬є±Ѓ∞≤іґі≥Єґ≥їƒ»—÷№икоусхчхшщцфхцхттууутсуууффтсспнмлйзггвёў“ѕ «¬љєµѓ¶ЬШФРКДАyuqmjb^[VQPOMHCEDB?>;;;69=:;?>?EIEELPQQQPQRUWVTPMNJEC@9974564;S]YR>.'').327@FMV[]_cfjprtw|ВЕГГЕzxvwuttrsusooqqpqqnmoqommpokghiiklnoqw{}{zyz}|{|А~~zvwytssqojfecb^]ZVUTRPOMNLJGHEEIGDDFEDECAC@@ABCDA@AB@CCBEEDGGFFGE@@CDEJFEHFCCDBDJFEDFFCDDEDEHGGGFGIKLKNQYXQSQPRQQPLLPQRSTSRRTUTSRPRQQQOOQQQQQQRQQQOOPOPQKJHIIILJC@?;730-+(&!  "##&$"%))**+*+,-./0022/3769<:8<><>?=>>=?>=@CECBAACFDDFEEFEDDDDFGFDFHMMJILNQRTTSYcfcbhkpopqplibba]\_]WTTWVWYY[ZZ\\_a^`bbbccfiillkmklknoomlmlopqssrsvuvxyy{АБАВЖЖЕИЛИЙЛМММНПОНООССНЛМКМММЛМММММННМНОПНМНПРРНОПРПРРНКОМЛНПНЗГБВЗЭљ№ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€ю€€€€€ю€€€€€€€€€€€э€ю€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чурпиџѕ…»ƒњЈЇґіЈ≤Ђ™ѓ≤є¬∆…ћ’аежгикйнухухццхшчфтттфустссррппррпмкииебЁЎ”ќ √Њїµ≠©•°ЪТОИВ~ztqoh`]ZVQMMHEBAA<;:8664355577689757;<<=@@@DEDELQQORWYXXYZ[\^^YUSRLGIF@BE@=?>GgНОmF.,/028<@ENVZ]^bghkprwz}ВЕДЕИЕААА~|~}{}{wwxwvvwurtvtuuvspklnmnmnqvzywpmkllmoqturvyxxyy|~~}~}|z{|yrnlgb\[WROMJIGIGDDGDBBBCFDEBACCB@@><>?=?CCA@??@=;>@BBCCDEBDGHFHIEHGFFFFFEDBHFDGFFFFIGFHNNMOPQOPRPONRQQSUTSRSTUQQQSQRRPRSRRQRQOMOQRQONPOLIGHJJKIFEB>;531/*(%%!  ! ""#"$&(&(()+*)*+-///004754788;;<=<=><9;==?CCA?=?BDBDDBBAABACCFECDCBDHEAEEHIGGHR`jh`gqwwxywvwrnumcc\WPGGGGGHHILMPRSTVWXZ\\_bdehillopmlonmnonnlmmlknpopqqsuwxxz}~АГЖГГЖИЗЗКНЛКООНМОНККНОННМЛННННООООРПОУЦУУУУФЦШШФХЧТФЦЧХТОЛЖДДВАИЮјеь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€юэюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чцхулваў—ћƒЄ≥±ѓѓ¶І©°°≤Ї¬“‘ўЎ„бедктстуфхфсрпссстспрропутппплклйжеб№Џ’”ѕћ∆њЇ≤ЃІҐЭЦОКЕА{vpkhec^TSPLLGBAA?;998534122421113/2435776888:99;?><>BCDGHHIKMPQQUTTTTSVXURQRSPKHFGFGHFEECOwђҐvX=447;>ENSUZ^_`bfhlpqtx{~А~ГЖЖЗЖЖЕДДБАВ~}~}||zyzz}}xvtussutvzБysponnopqqolmppnkmptsruxyyz|~~~~}zyvromid`][ZXSOKFCDA>@><:<;:99:77889<;88::;89:89<;8:;8<>=<;<@BCCDFDEFGJHHIFBABDC@BDCGILNKMMNRPQSSQTTSQPRRNORSRRRRRSPQRSSOMNOQOOLJMPJGGGHJHFGGD@:72/.*++&#!$--!!!##$&%(**&(,*+.../11111497769:::;;<<<=??@><>@AAAABADA@ABBBDBCDCBDFFBFFEFEDDJQ]ebgs|ГЛЛ|wxxuГ{iif]WQIA=;;?CFHKIIMPPQRPRRSVVY\\_ceeghijlkhhihjmkjnnnmnqppsuwxzxwz}|y}}~АВЕВАДДГЕЖЗЖЕЕЗЗЗИЗЗИЛНМЛММРССЦЫЫЩЦЦШШЩЩЩЬЫЪЪЬЫЩЧЧЦПККЙГ~}Й©“т€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ю€€€€ю€€€€€€€€€ю€€€юээь€€€€€€€€€€€€€€€€€€€€€ъхнзвўўў–…ƒїЄЈ≤ђђЃ∞єЇ∞≥Њ∆»∆Њ…ў““глнттопррнптррпрсссррооомйллидаё№„‘ѕ«Њµґ≥Ђ®£ЭЦТОЗГ{slifb\VTRNLJC?>;::712511/-230..1233215463213305768899::;:=>=A?=>CCEFFJKGLLJMPPOLKIKPNJNOQROJGKHGJIIKLRkЛ}gjN77?@CEJLJFFFEEDCCBDGEFIIIJKMNRSSSSUSRQQPPQQQSSQRQQQRRSPOOQQNNMLQOKHHHGGJJIHFA><6120/.*''$"!47!"##&%&%()'(')*,.,-/02023337988769=;7;<>>><:>??BCB?>C@>CC@@@?ACDDDDFDCDCEGGEEGOV[fnxЕТУЗВvt|nlng`b_VI>A@?AGJGJHFLQRQRPPTUVWWWVVYZZ[\[YZ\__aehigjjjlonooposzvuuqrsvutwyzxx|}{|}}~|{~АБВБАБДЖЖЙЛМЛМТЦЧШХЦЪЫЩЩЭЭЭЭЯЯЮЭЭЭЫШФРНКЕА}БХЄбы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэюю€€€€€€€€€€€€ю€€€€ю€€€€€€€€€€€ьшхпмебЁ÷ѕ ≈љґЂ•¶•™±±™ђЇЊ≠™ЊЌ‘ЁееЁвмонмллропстрсурпропоонмлкйегṓ–Ћ≈љєґ±∞І°ЭЦРЛЕ}yuspme[WVTMJHEA>:97510/../,/.*+.-,/30.//23203344757758875667989::<<;<97687763564676855544569779::;:;;=?ACFFEFHHHHEDCDFGGGGHIKMQQPSUUTRSSRQSSROQQRSTRPOOPRQOONPRKEHHIHHJJIKJCA?;75220-,)*+(# (:) "!"%#$&&&&'(&()*(*+.././.143346743:97:;>>>;<<<=?>@?=@ABAAA>>??CJHBCCDBABFGEDBBFJSgouВПЧЦЧП~y}ГqlifkrgODEA@AIKFFDBDHJJKHHKKRVTSUWVWWXXWXWWW[Z[_a^^abdegkliilqqnmmnnnprpsuqpqsutrtustvxzzz{yz|{~ВВГЕЖИКНОНОУЦХХЪЭЮЮЯ°°Я°†ЮЫЪЧУТОЙВ{zД•–ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююэю€€юю€€€€€€€€€€€€€€€€ьчтрзяЏЎ—»ЅЉµЃ≠™≠≠Ђ≠ґґєЇЇњ…ѕ÷№ааблндгрхчшццццчцхфцчфуутрплиеа№Ў’—ЌƒЊљґ∞ЂІ•ЯУПЙГzxuqkdb_ZUPKHCA?>9210/---,,+)++.,)--,.,-../001563344355667:9:8:88;<<::<<=<===>?ACFHCFGHILJJJGINMNPPMJKNOOPPOONMPRPRRRRPMMQPSTRSSVX[YSD;;>CKTTXZZ[[\`dfimosx{yy~АБАГЕЕЕЕЕЕЖЕЕЗЗДГЕЕЕВАЕДГЕЖЕДЖЖГГГБВГГББДВВДЕАБ~|||yyy{|zz|}{xwwvwuttruutstrqqoknqoqqrtttwxwwzzy||{}~}||~{xwpolhd^WSPLGEA=9::665256755465679867889:9<=<@DFHIIIHHFGGGGDDEGHINMPRSRRTTRSROONPQSTRQQNNRROLNQNHGKKKIHGGFHIIFA@;8521//-,+*&$#"" !! !#%%%$%&'&&%(('))+---//./22134/2248:<=9<:;;<<<;<>?@A@=>@>>?@EJFBABCAABDBBBBACGSgnsАСЬЪЧПКИИХЬИsmjimaHGFACCHKGEHFEIFHIFDEGJR[UMMMIJNRSPQRUVW\be^\`cgfbcgdbgfghhhhiiijlnnnmmnonmopnoqqrrrrstuswywx{|~АЕЕБЗЙККНТЦЫЭЮҐҐ†°°ЯЭЮЫШЩЦРИВ{z~УЊиь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€юю€эыююэ€€€ю€€€€€ьъшчсиждЁЏ‘»јЄЄ≤ђІ©™Ђђ≤≤єЅ∆ѕ”Ўёзкносхщъээюэ€юэээээыьшчцуойгёяЁЎ—…ƒњЇЈ≤≠¶†ШХФПЗГxqnigh^TRPJFDE?<78:400120.-.-++,-./-,-,./00..3211000345678:8899::878==>==?;=@@?@AABBAABDEHJHKLJLKLQOOPOOQRQQRRRONOQRRRRPNOSSSSRSSROPTVRRSVYYY[YQA;>@DMSSUVWXZ\^__ekkpruuv{~z}ГГВЕЕДГДДГГДГЕЕДЕЖЕИЗДЕЖЗИИЗЕДВГЖЕЕВАВДГГДЖГВБ~БГА~}~}ДЕВА}|zwwwyzwuvxvvurrssrrrstwxvtruutsstuvwvttvwwxxyz~Б~}||zvohhd]YVQKHB@@<9899::76768996689:;<;=BFEIJIIJFGGFEEDKIILMNOPQTTTQQPQQRQQRRNMSSNMNONJMLIIIHIGFHIIDBC?=<6122/,,-**'$#" ""!"#$$#%%%&%%%)(&)))),,..-.234.-/203878;998::;<<==>>>>??>>>>>>@@@A?CACBBA@@BCAAEQflrОШХОМПОСЮ¶†Уnhh[GHFDEEFHHHEGHJJJJHGEHGVoeVSQMNORQJKJLMPRc{uorpkjihikjhggjiifeegiihihiihjihjjjjlnnlmjlomlpqqqprtvxy{ААДЖЙНЦЩЪЭ°£†††°£†ЬЬЩХРКГ~xxИ≠ўш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€ьщьыышуупиб№ў„—ћƒ¬Љ≤∞±∞≤ґіЈЇЅћЌѕ”Џядйотцщыэ€€€€€€€€€€юэщчфсмкзв№’—ѕ…≈њЇ∞©§°ЭЩУЛЕВ}wspmgb^ZVOLID@>:;B;220,,-.01-00/--.110//00/./2651/0254324789777699:<===;<=>???>=>BCDDECBFFEEIJJKJLMNPQRRPPQQRUUSQRRRTTRRSSSSRRSUSTRRSRSTTTTSTTPSWVTTVVWY[][VE;>ACFMOQPTUWYZ[]agfilnprvxw{}~~~БВВВБГДДЖЗЕДДЗЗЖЖГДГЕЖЕЕДЕЕЕЖЕГГЕДБГДГВВДДВБГЕДДЗИЕДЕГАА~{~~{{{~~zyz|xwvuwy{|xwyxwwvxxwvwwttroqpqonptttuxz{{{|~БВБ~~|uolhc[WURKHEB@A?=;9;;8789<<;>ACCHHFIKJJJKLIFGKNOLOSSUTQSRSSPPQRPPSQPPNNPNLKHHFHKJIHJGDEDB>?;672/0.,-,(&'&#! !!!"##"#%$%#$$%%%%%%$&*,**+-**-///..111452477557:;<=<<<==>?BA>>?@?>??@>=>AA@?@@@BA@ENdpvКТУОННЙОЭ¶І§НrkiYJDCDBEFFJHEEIJJIIHHFJKZwiWXXWVUVSPRQRSVWkЮЎоЏЉЂ§ЮЦРПНЗЖАzqomklhhjijihgegfgghhhhijgihihijijmnlmoppputvw|БДЛРСФЩЮ†Ґ†£•§†ЬЩЩЧУМЕБ|xА†”ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эъшхтплжбёЎ‘‘ќƒƒ¬Љµ±≤ґєЉЈїЅ≈»ћ’ёдиофшээ€€€€€€€€€юэыщцфслмжбЏ„—Ќ»ЅЉЈ∞≠©ҐЫФПЛЗД~ysoidaZUPMIGA@>;:941242/.../.64../..000/.413323565036433469:5577:96::9=@><=?=>=@EEBDEEFFFHGFGKLNNNOPQNKMPRPRQSTTTTTWTTTRRVVTQQTSUTSSTTRSUSTWUUSTUVVUSWVTUWUVXXYXXWX[[]a_M;<>@CGJKMORSTUXY[^^adgjlnprwvxyywvvz|xyy|~А~АААБГВВГВВБАВВВДГБДДДЖЖЕДЕЕГЖИЗЕДДЖЖГЙЛЙЖЗЙЖЗЖДДДБАГГБАБААБГБ}}Б|}}z}АВВББГВ~z{|}|{z{{yurtstrrrrrqopsrqrpnopqtwvvy|БГГБ~|~zwuqjfaYWSQOHEEDDB?>>==?>>AGJJMQNLHHILMMNRMPRPRRUSPRQNPQRRQPONQNHIKLIHHGHFHGGHFEC@=>:6643///*'*+'%#"""!  ! "#! #$"##$#$%%%#$%')()()*)*/..-+/1/1.0256574397:;<;9;;=>?A=<>@@?>?=<<=>?A?>@@@ABFNcqv~ИРУТПЛИПЭ•ІЮЖrf_VIBBBBEGGJHGHIHGFGGIIGH\xjYXZXVUTTVWTTVY]pЉю€ююэ€€€€€€€ьЃ¶£ЫУОИВГСЗtmnmllkjhhihgghhfdefhjjiiknomnlopswxxВДКОФЬ††££§£ЯЯЬЩЦУПЛД|yЭЌч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъп湓—ѕќЋ√ЉЈі±≤Јєњƒ»Ќ—„ёекорхщььэ€€€€€€€юэъхсокидаЎ÷‘ћ«√јЄ±Ѓ©§ЫЦТНИАzvtnjc]XRONJFJH<;8631//../10--./-.././01.0:80021147745:97677:;9:9<;7899:=>:;=?><>@ACEEBBFHGEHLNQPPOPNOQOQRRRUVUW`[SQRTSSTSTSSUTUVTTTTRTUUTQRTTUSUUTRSUSSVVUVWUTVWTXWVXWWWVWXXXWYZ[^bcXB68:@BCGIHKNQPRVXXX[^`adhjkorqrsrqtwuuvuwx||{||yz}||~Б~~~~}}~~БББВВДЕЕЖДЕИЖВГДЖЖЗНЛЙЖЖЗИЗЙЗДЕЕЕЕДДГЕЕЕДДЕДГВВАБ~~ДДЗИЗЖЖЗЕБЕЕЕВ~БВБ|zyzzxvuuuusqsrqrnmmmmnnlkknrsqtsrz||БББДДБВА|xtnlhec^\XSOLIDCGGGGJMMKKIHKKKPMMMOPQSRRTRNOPPQRQRPPJEGKJFGGCFFFFGFFHEAA?<;88842.,,--+'(%##"!" "#$#"##$#%$#"$#%%$$&##&&&&'())'(--.-,//.0/1246:832569<<:9::=<<==<=>=>==<;?@>>>?AABBNdou~ЖПШЩФОМФЮ•©ЬГp`YTGED?ADGGGFDFIHJGDFGHEG^xjWXYWUTTTTWWVXY]oє€€€€€€€€€€€€€€€€€€€€€€ьжб€сє∞©ЮХРЗАzywtpllkkffghjjihhkmmljlonorrvx{АДЗОФЪ†°££§ІҐЫШЩЩТИА}z~Ч ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эшю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€шџЈ¶Я†©Јј√њЅ “ўбжксцэю€€€€ю€€юьычфсонигаЁ„“ћƒЄґ±≠©§ЫХТМЖБ}wqmkg][ZVOIGFCC=::89643373,.../.,-../00./00122/.14457A>767899=====@=>??>?BC@?@?@ABEGF@CGJGGFILMOOMKOQRPQQVaVRTSTUTUVTUTUWWW\[XUUUUVSTUTUTSVVUTUUTUUVVUUUVUSUWVTSWWUVVUUUVUTXXVWXXYYXYXYZZY\[ZaeghT8569::=@@BCGILOPSTW[\\^_adeijkmkkopppqqstvvwuwvwwwz{}{{z|zz{|||}|~}}БВВАЕБББДДИМЙЗЕДЖИЖИЗГЖЗЖЗЕЕЕЕИИЗЕЙИЕЕГБААВДДЕКЛЙКЛЙЙКЖЗИЕДЕЙЗЕГБВГА}}{z{yyxtsurqqqonpqroprsonooqqqpprtuv|}{}~АБГГДЕА}zwsnhdb`]\][[YTRQLJNNMJNPNNRRSTSQSRQRQROLKJIJGDIIGJJGFHCDIDC????9;9770-./-+))&%'&$%#%#$%$%$&%%&$#$#&%"%'$#&#$&&(*'()+,-,,.../.02224672257;:78;<::<<>=;;8<=<<<=?<@<>@?@@Lamu|ДПЩЫШХРЦЭ¶ЂЪЖr_XRIGCBBEECDGFDDDHEFFGEDG]xgVWWVTSUUUUTTVXZlЄ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шд“ЅЊЄ≤ђ¶°ЩСЙГ~zxuupmklmmlmmlkmmnrwwz|АЗПШЮ°°•І¶£°ЭЬЩРЙГ}yЧќь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эщю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юлЉ†ШЫІѓіљ¬¬Њ…ЏвежгявоссскддвяЏ÷– ≈ЊЄ≥≠¶†ЬЧТИБyvqlhea\ZVPLJGDDB?<;;<:774366112442136413024444654328747698:75:68>D?:?@=>@@@CDBFGIIJILLKJKJLMMMQROMPRSRRPRUUUUUSRSUVUUVZWSSRVVTUVTSVXYWVTWYXYWWWWVVVVTTVWVUUUVVUWWXXXXVVVVVVUVWWWWVVTUXWXXXXY\\ZYYYYZZ]^]\djjqiJ761/03569;=>BCGOPORTVWZ[]^^begffiijjjmnnnopnpstrtuttuttuuwxxxvvwyzzz}|yyz~}}~}АВДЖЖВБВДДДЖЕАБВБЖЖЗЗИИИИИИЗЕЕВВГГВВЖЗЗЛОПМЙККИЗЛНПЛКЛМКЗЖЕДДЕВ}}~|vwxwvvvsswwtssttsrrstusqpqropqqpoooruwwy|}}БГДГААББААБ}~{urpiddaZVVURQRPQRRRSTSQPQMMLMMKIEGHLJKKHHJJIFB?A@>=<;76642.,,,-+**%&%'(&%%$''''$$%&&&&$$&#"$!"$#"%'(*()*)--/1--..02432303348868;:78<;<;9;;;=<:<==?>==>>G^ltzВМЦЪЧХРЦЩЯЯПБr]YOCBDDBEEACEEEHHHGHEFDDEYsdWWWWUTTSTUUUVYYlґ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эоб— ≈њєЈ∞©£ЯПГ~xqpljjlnporwy~ЕМЦЬ°§•¶І®§ЯЭЪФМВ{y~Щ—ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыаЂ£°°ҐЯЬЬЭ††Ґ≠≥≥≥µјƒЅјЉїіЂђ¶ЯЫФМЗГ|xqkf_][WNJIHD@@=;9:;;8978886666779:679;85768879<=9978:;;<=<99;>=;===>@?>@ACFLGEHEFJLNONLKRSTUUWWTRTRUUTSSTSSQTSTSUTUVWVVUUTUVUVWXVWWUUVVTUVVTWYYVVWYYXYWWWWWUXXXWVWWVWUWWVVXYXXXWXVUWXVXXYYYYY[[ZZYXYYZ]^^[[[[\^_a__cjhlp`>-,)*/.,./038:>?CCCIMOVZ[]^`a`bbbbefeehefijihknjjllopponpstssqquuuvvvwtuvxz{yzz|}||}АДГА~~}ГЗЗЕЖЗИИЗЗЖЕВАВБ~ЕИЗЗКППММММЛЙМОПННННМКЙЕДДДГБ~~{||{}{{{zxyywyxyxyzxxz{zxuvvsssqstsqruurrpqqrsssuuyy{АГГЕЖДГЖВВБА{vusonjkjfc`^[\ZWSMNLMOMLIGGGJKIJLOMJHFFDA@@=;;89562-/00.-,)(*)((((%'&&'(('(&%%%&%"#%$''!#$$&('&('+,/.-..,//0023234434587566;::;9<<=;::<;;><<==>;<=?=G]lu{АКЦШСППФФЦСДym\YQBCCECBFGEFBDIHHIDBAACDXugVWXVUSSUTUWVUVYlґ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъаѕ∆Њ∞ЩЗ|tomlllprv{АИРЫ§І¶Іђ©£°†ЭЧПЕ{w|Ш“ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€юаҐЭЭЬЮЭШЩЫЬЫЪЮЮЯ£≥“ѕ™К}zsnlc`^XTQLHFA=:6679413444754458<::;=;:;=?=;;??==<>?<>?A@>?@@CA??@?BCBDIIHKYRMOMTQNNNQUUTVVUWXXZZXYZZXWWWWXVUTUUSTWWTVVWXWWXWWWXXWWYZ[XXZ[YWVVVXWXYXVW[aaZVXYYWXWXYZXWYZXXYYYXWYZXX[[ZZY[\ZZXY\\YZ__]]]]^`]_b__^^\]aa``abgnmibR<)$##!$&)**+..0458=DNV]agjjkkiihgghgdfedeffcehdbegiijghlmnnnnnqrrsqpqprtttsuvvvuwxxyxzz{||}}}}БВВБГЕЕДЕЗЕБВ~БЕЖИИЙЙКМПООНОПННМНННМЗЖЗЕЖЗЕЖГБ}ГВА~}}|{{z{}{z|~}|~|zzzywvxyxwwwyxxvwuvuuvsssrrprtrrrtuuxx{|АГБВБВДЕЗЗЕДГz{{qkhb]\WUPMKHJKHLKKKJKIHHGF@>?=::8962/0/.--**,)*(&)(*(''')&(&$$#$$$%$&$""%'$&''('++),+*--./---/20./2312572588588789::9:;;8;;=<;;;>??>G]mv{АЗТЧУППТССН~uk\ZODECEDEHHGIHFBGLJDADDBEZwhXWVUTTTTRUTUXXYk≤€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€д“≈іЭЕyrljkntw|ВНЫ££ІЂ™І®¶§†ЫСЖzw}Ы’ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€юю€ьў†ШШУТХХУЦЪШЧШУХ°њЏЊФqRFA<755667421/././/05504667:999:;=@A?A@>@DEDDDEFCEHHFDBFHEFHGFHGGIKKGILKMLLKOQPRQTVUXWUXWYWTVWXYZWWYWZ[Z[\ZYZZZ\[ZYXUVWX[XWWXWVXXZXXZ[YYZXYYYZYXX\\YXXYXYY[[ZYZ]fi^XYZZZZ[YZ]\[\\Y[[[[ZYZ[ZZ]^\]\]^\[\]\\[]_bb^^`bb`__]aaa`_bddb`aajnc[UI7( %%)*-3>O^hqvwy{|{}zxvsrronlkhghgffdefgeddgfedigijjmnklljmpmommqsrqrttvuuttuwwwxz{zx}ААББВАБВБДБАБДДЕЙКЖЖЗИЛМЛККЙИИЛЛЙКОИЕЖИМИЖЖДВГАГВАББ~~~|}~|~~~ББ}}~}~|~~{|~}}}zy{|zzyvvvtstttstuxxutsssvuuwvw|~АБГДДЕИННКЗИЕАА~zslhfeb]XUSQPMHKKFGCBB?;;;:7652./11-+,**))*))+)))(''&%'%$&'%$$$%$$%#'''''**()''*++---/..//-/000273366583669:;::<=88;<9;;====@@?BBDHGGGIGHLIKMONMNLPSRPOQPPQQQRRRRTVVRTVVVUWXWXXXWXYYWXYZ[^[WYZYYYYZ[Z\[Z^^^\]]\^\[[XYXZZZXXYYZYYWZZZ\[[ZZYXZ][XYZ[ZXXWYYYZ[[[[\\ad^[ZYZ]]][]^^^_]\]]_^[[[]]\`_\_^__]]^^]^^]`ab_abba``^]`_^cbaabbabcfjfZSNE:-  !*6BLYclszДДДГВГЖВБА}zzxttrmmlmkhiiiieggfeegiffihgghjiimnmnoppsqopqqqssrrttuvz}|yz}}{|~~~БГГЗЗЗИДЕДГГАБББГЗДГЗЛИЗЖЙММЙЖЖЗЖДДД~~АБББАААВГ}ВБА~БДГВААВВБАБББА~ББ~}}ywxyxxz|{|}zzyxwyvuwwuvvuwvuuvz~АГГГЖЕДБА~АГДАzwyxupkie^WROJFA=;:;776622///.+**++*+***)),*('''$%(&"&&#$&%#&(&&%()('''()()+.0.-.//0000034115985789;:98<:98;<9<<<;9;=DZkuw|ЖОХТПНУХОЗzum][O@BA?ACCDGMKFBBIFCCEGGGXykWVUUUSRRSSTUWZ[hЃ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эа≈Ю~qklqyАЕМЦЯ¶®ЂЂЂЃ©¶•ЮПАxx}Юг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€ю€€€ъ”ЯФППООСПОМНСССТУ®єНWWQ75;MK=879878::<<;=>?@>@CDEEIIJNNNPPQORRQSRSWXWVXVYYYZ[YXXYYYZYZZ[ZZ\Z[ZZ[[\\[[^db[[ZZ[\\^\Y\\[\[\Z\\]]^]``_]]__]\]\ZZ]\YWX[\[[ZZZY[\Z[[[YY\`[YY\[Z]\[[ZZ\]^^\]^]]\\\Z[^_^_`]^``^`^__`^[\^^_a^]``__``a``___``^a`acdb__^`_abbaaaccddghf`ZVNA9-    #+4;975510----,,,-+,,,-+***('&&((&$"%#$#%$$%&')&'''(((()+,+,,.01./010/1313798567996463579==<<9=;;AACBBGGHGJNPNOSRSTUWXYXW[[YYZ[\^^_]^]^`^``^_^^_a_`_^_^^]_`^][\^]^`ed]]\_^\\^^^^[]_`__^]_`a`_bdb`ba\]^^\^^]\[[[\[[[\\Z[\[[\\[]]^\\Z^_^_`_^^]^___^_``_`ab`_`ba`_]^``__ab_aa^^__^``ab`__a`b`a^_ccbacbbadd`^_`_`cea`bccefigeda^XQH?4(   !#%,06=BKU\akwy{ВЙОТСРРСФУСПНМИВВБ{{{yvtrsooonnkmpnmlljkjhhfikjlmmomooooqrsstsuwwuwvx{|zx{}|~|{xxx{{y|}ВДБГДЕДЕДГААz{~}}~}|~~ВГВВГАББГААБВАГВАВГДЗЗЕЕЖГДЗЕБДВВБААБВБАВВВГБВА~~}~А}}~АБ~}|x{{{{z{xxvx|zz|~~~ГБ}~АААДВ}|}wqk`TG@841..//-..,-.-..,*+,-)'()(&&$$$$#$%#%%&$%()(&(()++(),.,.,,,.010./11375436655630169<<<<8=<;9BZirv|ЗТФПМРСОЛЕytgXVH@A?>ACADCECCEDFBBGFEEIYxiVUUUVRRSSTUTY[[gЃ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бїЙslmtz~МЩ°®Ѓіµ≥ЃѓЃ®ЭМАwuО’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€шќЭЩУСРОМЛМОНОПМОТ¶єШ_B@CAA@ABDECBBEGJIKILQSTSTTWUVZZYYZ^`^aabbabbb`dddccfecccbacabccaceaacbab__``^^^__ac`^]_``ab``^\_```bcacdaaddddbba`^`_^^__^]^\\\[][\[[^a__^^_^^^`^`aa^bb__`__bda`_a`_bddceeb_`_^`aa`ca_``^``_^^^_`bb`_bb`a]_cccabdb`ba``a`acdfcdcdhhhgdcda^\WRH?5/'    !!#$%'-.25;EMRXbnzГОФЪ°§§¶І™™¶§•ЭЩХСНМЗВАА~{{xxxwxusrsqqponpljmllnoonnopqoqqoqssspmnoostruvwwwyxy{z{{yxyyyyxxwwxzzywwyzx{{zx}~}~~}АБАВГДЕГДГЕЗЗЖДЕЕЖЕДЕЕЗЖЖККИЕЗЙЗИЖЖЕЕДГГДДДДЗЖЕЕЕЕЗККЙИЗЖЕДЖИЖЖЖЖЗЖЕДБЕГБДГАБ}|}~|xwzxzy{}ААЖЛИ|gUF933//--/-.--,+-+)'&'&$#&#%&%&$$#%'('(*'')***+-+.,-./0//.113.0220134232464499;:6767:9@SbnuwВЛООЙЛОСШН{rbZXG>@A@?>ADFE?ADCADCBEHCAXwfSTSRUVSTVWSUXWWd•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€и≥qntyБНЬІ≠≤ґїЇЈіѓ¶ФЕzwБ≥р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ююююю€ю€ш”ЮЦТТОННМЛЛМНОНЛП£є¶wRRTUTVTUVWWXXY[[\\]\^`bcc`becceffghhjjlnjjlklnqlmomkihkjiljikjhihgjjggddefhfifdc_affbadfechjgabcecedhgcfefhhighghfefecabccc_^ababbaababcbceda`bdcbaccbbbdccccccgeffb`bbbedbb`_`bbaaaba^bca`abccbcbddecccbaecbdfcbccbbb`cabcababcbaccegfffa`a]WRLD<:2-)   #$#&('%((*((*,.,069=HNX^hq|ДНХЫ£¶ђ≥ЇЇєїЇЄі±ЃѓЂ•°ЯҐЮЧХУНЛЙЖДБА|yywuvvsssqrspnppnnmqqonllmkjmlilmlorspststvvvwwurttssuuqsvvutuuwvxxxwz||{}|z|~АГАВДЖДЕЕЖЖЗЗЖЕЗЗЖЗМКИИИЗЙЙЖЗЕИЗЗИЖЖЗЗИЗЖЗЖИЛЛКЛЛЙЙККИККИЛПНКНККККЗЙИЗИЖЖДГГГБА~{zzyxwz}||БЕЙНЙГq]I=52321.-..-*,+((('%()%%'&'%%!%%&'%'(()))+,,-+.-,/../-/.//1///.1322105656867657787BS`irwБЕЗЛЛМНКЖ~vraWVE>?@?>@BDCD@@BC@B@?AB@@VsdTQQRSSTSSURTVVXaЭ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ц√ЙpovyБОЭ©∞ґЊ¬ЇЈЈ±°СwwС–щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€юю€€€€юцѕЭШХПНЛИКЛНННННМО†ЇЃzY[[[YZZ[\\[]\\aa```_adfgfdeeggijkkmmmmmolinmnnpooqnmnnmljlllkjkljgkjhiiehghiikhdcfifdcdfefijfhhghghfihfhjjllkjjjkhijgggdefcbeegfcbab`cdbcdddbbagdccedcbbeecedddjiffdacddffdeca^`cbacc``ca^_`bdcdbbceecfffddfedgecfd`accccab`bdfbea`dfgfcbb``]ZUTOE?;41*#  !!""%'%&'&'**.../7CLS`how}ЕЛУЬ†§©Ђ≠±µєєЄЄЄєґґїљЊј√…∆ƒƒ¬Єі≤≠®ЯЭЪХСОЙИИГА||xyvsvtssqqstrqqolkmljjikjlkmknmorqqspqomoolnlkkpqqpprrrtttwxywuwyzx|~~~~~АВАГДДДЗДДДГЕККИЙИЗИЖИИИЙЙЗИЗЗИЗЖЖЙЛЙЗМЛЛНОНЛМЛКККЛНОРОРПУТРМПООНОМЛЛЙЙИИЕБББА~~~}}|xy}АГИПЙr]H7330...-,-+*)(*''&$&%&&$#$%$%('$&(()&(+,*)++,.--..+,-//-./..12/134436525669877AQ_houДЗИЛКИЗВ{up\SUD=???@AA@@A@BA?C@DBAA@ATteVTSRRQQRRRSTVVW_Щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эћКrpt|ГС°ЂµЉњњЊїµђЭЛ|v|•ж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€э€€€ю€€юфЋЮЩФОМЛЙМННОППОММЮє±v]`^][\]^`_``^_cdedddcghhigffikmnmmoqqopqnlnopnnqqqrqrolonnonlknlkllknjjkkjjkljfdeijiigghgkkljllkihjjkigkoklnlnklkjkjikggigcdgefededccdeeefcdfecggececcdffeceffgiheeeeccfffeffaa`b`bedabc^_bbbdbbacbffcdfhfffeeddcddacabeebadebddcedeeddb`a``_\ZXSNGA<:4.*%# !###%%%&(++125@LX`jwБЗРЧЫ°І≠±і≥ііі≥µµ≥іµєЇЊƒЋЎжрсмуфуллржџ„ќƒЅїµіѓ™®ҐЭЧУОНКЕДБ}yywvstvusqqqonlljiggijhghiiigihfhigfegfhmljlknnonpqtssuuvwwz}zz||{zx|||}|~~~БГАБАГЕЕДЖИЖЗЖИИЙЙЙЗЗИЙЗЖДГЙНКЗКЛМОПОНМЙМММНПТПРУТУЦФТФФЦФУОНОММПММЛЛЙКЗЖИИЖЕДБА}zwxЗРФЗlP<5141*,.,+*)+*)&%%#$%'%$&%&(''&&')'()-+(*,*,-./---+00,01/.00./32224135356658=N`jou|ДИИЗИЖД}wtlZUSB=>5../-+++,)()'($"'''($$('&&('('())),,++-*+--/-..../...///.,/0.,22045235128;M]hmt}ЖКИЖЖЖГzvtkZUP>==<<=<@@@C?>BCB@?A@D@AV{iRSTQRRRPOPPRSTW^Оу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“МpqwЛЪ©≤Ї≈…»ƒљ±°Р}vvЩб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ююю€€€€ют ШЧУСПНННОПОСНМЛМЯЊ≠w`a`^]_^^_`dhcdhhjiihikllmmlmnqrqsssrtusssqstsssrtutusqtutrqqrssusooonomopprooonmmlklnlmnlnpponmnnlppprnnoppmqsnlnnkkljiifegfifddfggghhgjedfecghjfeffggeebdggeghfeggedeeeebadcbbdaccdbb]^cccggeb`dfddggheaaccfeec`eecbfeebddeecbhfbabcb`c`^aa__][VTRKHJB?9421-'"!$$$&(+1:JTbjt|ИХЯ•©∞≥і≥і≤∞±≥≤≥ЈљЅЋаикоч€€€€€€€€€€€€€€€€€€€€€€€€€ююышшцццптчхозааа„ ≈≈ЅєЃ°ЩРЛВ|zujgfefpqghb___]^``___[[^__`acffhgihjmkkkortpqroprtstsuvvvyyywy|||}~А|{ГГГЗЕЕЗЗДВГДЖЗЕИКЖИМНММММКМНННРФШЫЪЫЮЭЮЮЭЫЭЬЫЩЩЫЬЪХФФЧЦЦЦТЦЦХФХХФРМКЙЖГБ|zy{ГНЧСvP50-.,.+*(('()&%&'''&&&('&%'('(&(+))*+)*++-----.----,/1.-,./-,12013303234;JZgkr~ЛОЙЖГГГ{xul\UQ@=>>==;????>?>A>>>=?C>BRucSSRQQQPQNNOQSTV\Нш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—Зos{ЖТ†≠Ї¬ћѕЋјЇ≠ЩДytБЈч€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэц»ЫШФТОЛЛОМНПРННЛН†њ∞v`aa_[``__begggiikljhilooppoppvvvvvxuwttwusruvvwvvvvwuuvvvvutvtutvrssrtonttssrrrnmnnppppnmosqqooqspppsrmqooqonnlmnmmmnkjigfhhgfdegjihhfgihfhffgghgghhggdbcefhfgdegffefedefebbeecebbcda^`abdccfeebbecccefeba_cfcbdccbabegbaadddbfhedbefa_a`^ab_\]\YWTNMLB@B<;6..*(% !"&%),2??>?@>@?>>A?BPq`QTQPQQLRRPQORSXiЮ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—КsuВКХ¶ґњЋ—–«¬ґ§ОАwwОќээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€ю€€€€€€ючЋЩЩУООМММННННЛЛМНЯ¬Ѓt_b__^bbbcdghhiklmomkloprstustwuxyzzyyuwzyuuxzzxxzzwwxvyzxyxtvwvuwvtsssstutuutsqnnopsooqqoqsrsprqoopoqplpoprpqoonnnmjmkhghhhiggihgigfgfighhhjgfegjigfffeefhhhfeedeggffcecdgfdfecebabcb_bdbcdddedbcdecbfeabeaddeccdabccdfec_`cabffggfdcb`a^]_`_]]]ZXVRPPH?C@><750,*$#! $&+.:EQ\eo|ЕОЭ£Ђ≤ЄЈіі≥Ѓ≤ґЇЊ«Џзлнфы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эьыььр“»Є•Зxshbfrvvyvtjaa_XVWWdxДyvtqqnqlc^_]^^`_```bbadcdgghklkkmkmmmknnqstrsuwxyxz{{}yz|{{|~АДЕГГИЖЕЖЖЗЙИИИКИМОПРСФУУШЮ°°§££§ҐЬЬЭЭЬЬЮЭЭЮЬЭЮЯЭЬЪЩЬЧЦФФТПЙИЖВ||ЛМoL62/.-,,,******('%'$%&'(($$&()+)**++,,+,,-.-.-..--,-//..---/0/.00012318GYcksЗ†ЮИБДБ~ytthWWO=<==>=BA?A>>?>>=@????@@OqbPQNOROPOPRNORR^}Іы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷ТvyЕЛШ©ЄƒЌ÷“«ј∞ЪН|tvЩаю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъѕХЦТПСНМЙМНННМЙКН†јђt___`_bccegiihimmmpppqrrtvwxvxwuxz{z{{z||{xxx|{y|~}z{}z|{y{xwwwxyxutttvusuvsrusoopprrrqporrrtrtrooppqppstqprqqrpomllmmkjhjjhhhgfdfghfhjgiheiheefgieehefgeihgfgfbcffhdcgc`defefccbbbaabbdcbaegecbbfeccfdadcbcefcbbcbebdccdaccbabdceea`abda___^^[Z\ZWVSPMFDCE@=963.*($!  &)1;MXdpw~НЫЯІѓ≥≥≥µµµµєљ¬ЋЁиоы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьтѕ…ЈТsgbbluwЖШМВ|roi`RILj±∆јЇєЉі∞ІЗqf]\[\ZY[[[][\]]]]^bfdbdcceecfhjkjlopqstrstwxxywuwvxy}~}}~БББВДБДДИМЛИЙЛКИМСШЬЯЯЮ††ЮЬЫЭЫЭЮЮЮЭЮЯЯ°†ЯЯЯЮЭЪЬЫЪЧУППЙЗГА{z~ЕgH30.,+-*,))+*'&''''''()&')'**()'+,+++,,,-,,--,-,.---.-,,./../01002106AVcisЛ®§ЛДВ}{usgXVM;;:;=>=<=@==?<>???<===;<>A=<=?>>AMnaOPPMQKLQQPNMQRS\Мт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќБtАИЦІґƒ–аб–¬ђЭП}uv†л€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€ю€щ«ЩФТСЛКНЙКОПЙИКЛМ¶Ѕ£oa^a_`daahgklmnnqpruvwuwwxyxxz{~~}~АА~~~||xw{||~ВА}}}}|{~~z|yxyyyyywxvvxwttssuuuvtrtpooptusqtrrsrrttoooqprpssqpnmlmljjlkljghihgfehllkhkhhggghhhfcfihghigffgikhhhjhfdgebdedefdbaeegfcadbbcefceegbcfeddbcccdfefccbcbbeaaffbeecbebddb`bb__^^`]]\Z[[]\ZYURNKKKGE><51,*'%"!#(4AN_kxДЙСЫҐЂ≥µµіґЈї√“Џвкх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф‘≤xjlcbls}ЭѓІҐМДГ{ngZtћ€€€€€€€€€€€к—Њ≥ѓЂ®†ЭХХПЙЖБ{vspjgdf`\\[ZXXWWYY\\\\_abcdfgggggikolppommqstttvxwzxvy{~{z{{||АГЕДЖЛЛККНОНРТХЩЪЪЭЮЮЯЯ°¶¶Ґ£•§¶І•°ЮЪФНОКД}|}ГИpH1....,*,(')(()()'(&'*)&&&)(())*+**,+++,*-.,*--..---.--/-,240/0013?S^gx≠‘≠ЖВГzvvreXVN::<:9;=:<<=??BNk^NOMKNIJMNLMKNOS[Кт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЅ{xДПЯѓјЋЁкЁ µ•ШЕxsК—ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€эыю€ю€чјЩФППНЛОМКНОННЗЙН©≈Ґl`_```cdefgjmopprttuwyz{{{zwyz}АААБДДАААБА|{|}}~БА}~~Б{|}{{y{|xywvwxxuuutvusutsrpqprrsrssppsrsssqppppppturppnlmmjjlhijiihhggghikjijkjihefgggefggggfggefhggggfigdecdgecfhccfcecgdbddbacebeccefhebedddeghgeefc``_dhbbcadccdecaba``_^a^\`][][[\^^WXXURNOMJE>5/.-,())1;K[lzЕКЦҐ©Ѓ±іЈґґЄљ∆„ям€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эв™ДБrmtzИ°є«ЅҐКВyqj]ЗЎ€€€€€€€€€€€€€жќ√љЄ≥≥±≠™І¶£ЯЬЧУПЛЗЗБyvwrmiiea^_^\[[[YYZ]\]^_`cfeehhhghkmmlorpquuvtwwsuvvyyyz{yz|ББЖИИЙКНОПСЧЬЬЩЬ†•£•§¶§§®Ђ©§†ЮЩФПКЖА{y~ЖxN3-0/-,)))*))'(&&&&%)*(()''(*++,,,,+*,,+,--,,--/.-,--,//,/200/121?O_ix†є§ЗГВ~yvvpeZXM989:<==?@><===>=<@<>===Ll_OPQLMMNKIOOLPQRYЛц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цІ|АЙУ•ґ∆Ўкй’јѓЯПАw}ѓф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юю€€ююю€€€чњШФОРОМНМЛЛИММЗЗНЂ∆Ґj_`_^_befegklpqsuvtvvx}~~~}{{|}ВГББЕЕГБВБДБА~|АБААА~АБАВБ}}}|}{z}zxxuyywvxwvuvvvuvtrsqoostqsrrrrqsusrprpronpopqponmlkljggkkhiiiggihjihijgffdefegeffefhhffeghfedffhhfeeijgegfdfeeheddcddcbacddbcfggebacefdhegdcfdcdadjedbbaccdbab`aa_c`aa^]^[\\]\_\YYXWTRPNHC931.+,,2>O`oyДПЩҐ≠∞µґµіЇЊ∆“№кю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эд¶Б~}}ВГГЦЄћЄІЧЛБsd]УЁ€€€€€€€€€€€€€€€з‘ѕЅЉєѓЂІ¶§•†ЮЭЫХТУРКЙИЕГА{wvutqmlhca_a`^][\]][]`^__bcdceeggilonnpqmppsttrprttvx{|~АБАГЗИИИРУФТЦЫЮ°••¶І®®™Ђ™¶§ЯЪЧСМКД|}В}X7-..++*+***)'&()*'')))**)*+,),,,-,)-/-.,,-,,+-.-.-.,/0..1./-/04=N_jvНУПИЕВzuupdWWM968<<><=>>=;>>=?;=><=>730,-5AObp{ЕСЭ•©±ЄґЈЄЇЅ—Ёжчъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь÷ЂД|}|z{{ГЩ¬№є¶ЩСЛwdcФ№€€€€€€€€€€€€€€€€€€бЁ‘Љі≤Ѓ®•ҐЬЫЧОЙЕА}ywsrrrqrswwwxywtuuurqpkhica`b][[[Z[\\Z]__`dbgilhgjmmlkmnrqttwwxyxwx|ВГЕЛЛКНПУХЩ°•®®™™ђ©ЂЂ≠®£ЮЩЦУЛЕА{{ДБ[7/-,,(+,+)(&)*)'))()***)*++*++-,*+,/---+*+,--...,.-/////-../14<;:;>;;==@?=Kg[PMNKKJJJJIJLRRTZЗо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЇ{|ЕТ£µ…Ётрё…≤ЯПВzЗƒь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€ьюьэ€€€чЊШЦСНММЛЛЛМЗЗИИИТ≤≥Сh__^^acagjjmnnorvwwwxx{{~~~~~БВГЕВВВЕЕЖДГБАББАББВАВГГБА~|}}|{z{|{|{wywyzxwwxutsuwsrsostuppssqrpqsspttrpqrpqsqlpoikiiggjiijifglhhijigehgdghffjhedgfhgfehgfghgdfgghighiggdefgfdceefefaccccfedcbcddddfeecccdggcdcaeccabababcdecabdb`__^^]]_^^]\\\\[[]\XTPH@<:6238CWiwБЛХЮІЃ≥≥≥ґєЊ≈—ат€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь“§}z{z{yzЗҐ”еґЭФОДvmkЦ№€€€€€€€€€€€€€€€€€€€€т—ЅЉЄ≤ЃЂ¶†ЫЧУЛГ~wqjf`]ZWX]\Z^cceiknorttuyvvstpnlgdcb`^]\YY[Z]]a`_`bccdfgilnmqrsuttvtwx|~АЕЕЖККОЪ°§•®©™Ђ™ЃµµЃ§£ЮЪУОКД}Б^;./-+))*-*)()'&(*))++++))++,-/---,--.-+*.---,--.,../..--/./02=M[fВЋб§ЕГГГ|wur`WZK8;;>=<=;==@==:9;=<;<>>>KfZPLJHMKIIIJHHNNRYС€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мУxАНЬЃЅ‘кшл‘є®ЧЙ~ђу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€ю€€€ь€€юэью€€€чЉШФОНОМЙЙЛМКЖЖИИЦљіОf_^^^^bcfikmkmqssvwz{y}~БАА}АББВГДГББДЖЖЖЕДВДГГДГДДАВВГБ||{}~||{{|{{z|zz|wxxwutvuvsrsrtsvsqrsrrqsurpsstqsrpqsrnoslljhihghijjifhjiijhhjiighhggiffcghfhfgegihggegghfhhihgheefeeddfdbcdcdbdcbdeccdeedaeedcccdedefccecfdcba_abeee`baacc`]]^\]^\\[ZZ[[][[UPJA>:78:JZlyЕРЫ£©Ѓ≥µЈєЇЅ…Ўзс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€югЮ{{yw{{}ЕЮЏе≠ЦРИАzqmЬд€€€€€€€€€€€€€€€€€€€€€ъбЋљїЄµ≤™£°ЮЩФМГ|xqlf`XWVVQOPKMLKNOSVY\_adgfiopppqstspmkhfc`]a]\[Z[[Z\]\`_`bfhjllpoonqtwy}|АВЖНФЬ°°§®ЂЂ™≠іґѓ•£ЯЪХРКЕ{y~Аa:..-+*)++*))(&&'((**+-(*+)-,,,.,---.-**,/,,--+/,..0.,--.-..2Jg]LLNJJGHLMJEEKO]mЩ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”Д}ЗТ£єЌяцтг∆ѓЬОВzФ№ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€эьэ€ьэю€€€чЈХСОНПОНННЙЙИКИЙЫћЅЛf`^_]]afghkkjnrsvxw{}}~АБАА|БЕГБГДЖЗГБВЕЕЗЗГДЖГГДЕДГВВА}~~|}~~z{z{|{yzyxzywwwwxwvutusuuusutttsqqortrpqqqqsssspoolnlkkkjighhhkljhjjjjkgiijfihghhdfehhghhgegjihgffhgeiighjgdfddfefgcbaadfefedddddecccceeedacbdfedefcadced`_adddccdcabde^^^^_]]\\Z[[ZZYTPIB<<9<@=@K`q|ЙФЭ•™≥≥ЈїЇ«ћЎжэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь“Ч{|zyvv|Мµжя•ТМДyrmpЯо€€€€€€€€€€€€€€€€€€€€€€€€€кў…ЅЊЄ∞Ђ®•†ЮЩРЛГ|rld][ZWSQKIIFBEA?<;:=974345468;<=@FIOPNSWY]addeffifbcc_\\Z[\\^babehkklmsw|ВЗЛУШЫ•©©ѓѓЃµєѓІ£†ЯЪХНД~x}А_7,-*+)(+,)'('')),+++,+++-,-,.,-,-,--.+.,,,-.,,+/,,-.//-..09L[fВѕя°ЕБ}xvvo]UYG4872665:<;9:988<:=@>>=><964661.1/11116698:==?KeYOQQNJJLJMQKIKMT]П€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чСv}ЙЩЈ‘иэьчЏ±ЭРЗВЫ№ъ€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ю€€ю€ю€э€эю€€€€шЇЧСНОМКЗЖИЛЗЛЙЗИЩ— Мga_`a_abdghlpostvwxz{||ААГДГДКЗЖЗИЖИЗЖЗЖЖДДЖЕЕДЕДЕГДББВАГА}|{z|А|zzyxyywxxwwuuuvvttrsuutuuuuuqpqstsqrsrrsqnnnmikmlmjhjiiikfgijkjikhhiihfgehighhhefgfddfebefcdbffiifhhhgddeefefebddcbacceed`bdddccddcddc`cdeedegdfdc`_cca_`bd_^_^^ajd^[[[ZXWUSOIEDCI^pБНШЮ©±≥µґєЊ»”ёдн€€€€€€€€€€€€€€€эп€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ€€€€€€ь–ПswwutxВЪ—оƒЧРМГwrkl•х€€€€€€€€€€€€€€€€€€€€€€€€€€€€кў∆√јЄґѓ®•£ЪТОКВ~xrmd`]VRLJIDE@????>:95663151002241255465678:<=>@BFKOQVX[\^b`einqprtnmkkmsyАЙЛСШЮ¶©©ѓЄјљґ©І§ЯЬХЛД{zБ~Q2+,+*)'(&()'&(+.-++--+-.-/.-.//./../.-..-./-,.../-,-/-/0;<=<>JbXNPPOOMLLMLNNNPR`Ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э xyДР™Ћдь€экЊ§ФКГОЋцю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€ю€€юю€€€ю€€€€€юэюю€ю€€€€€€€чґФОООНКИЗИЙЗКЛЙКЭ‘…Иg`aa``cddhklpntuuw{yz}||~БАЕВГЗИЗДЕЕЗЕЖЖЕЖЕДДЖДБДЖГЖЕАГЕВАБББА}}}y|~}||yyxywwwyxxwxwvutqrtsssttqoprsrrqsstrrqsrnmljlkjnkiiijjiegikkkkljhgghljhhihikgffigeecffeedeceeggeghhgehgegecddcdaabcbedgeddeedefffgedbbbdfddgdcdddaca``ccb`b``^^fe_]\ZYVUPIGDBHTnАПХЭЂ±µґЈєњ ÷ды€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€щ€€€ьЌКruvvuzД°ўлїЦНЙГytjn®ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эџ”»ƒЅї∞ђ™£ЭЫЦМЙВ{wpid\XTQMHHDCA?A?;;7778842023542244223279:89:;<=BCGKOPRTSNORY]cku}wojkqwАЕЕМСЬ•®ѓєЇљ√ЄЃђІ•ЯЦКГ}ДyJ0+,*)&(()'('(+,+,----./0//.///..0.///.-,.//./../////./2=P]gЗ‘я§ЗДВАyrrm\UXE457:87588788;:<;;<9:=::GaXNMMNMLJMNLNOSOQ_Ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чЗvКҐ√ёц€ющ‘ЃЪОГДЈнэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€ююю€€€цґТОННМЙЗЗИККЙКЙЛЯ÷«Дc`bc`beefjinnotvvvxy{~~~БВВБДГДЖЖЖЕЖЖИКИЕЖЕЕЕЕЕЗЗБДЕДЕВДЗГГВДАББ~}}{}}|{{yz{zxyyzvxzwywuuuuuutrttpoostqqssttttsrrqolmnkllljjkkikigjfgjkkjihhgmihhhhhiifhihggefiheggeeefgedefgdigdddbchccebcccddjeacddccdfeffdeebcdebcdaddc`a`^a``abc``^^^_]^\WWRMIFCDO^xМШ§®∞іґЄЄЅ „вы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€€€ь€€€€€€€€€€€€€€€юм€€€€€€€€€€€€€€€€ъ€€€€€€€€€€€€€€€€€€€€€€€щч…Мtxwvv{Е®гзЈХНИБysjmђ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€п№“ћ∆ЇЄ≤Ђ¶ҐЭТОЙДВzsle`]XTPKGJE=B@==<:999414124511211/213896889:===BHKHPRPRNHILNUYgs~wojjrz{ГЛТЬ†©іЈє¬ƒЄ≤∞ђ¶†ХМДz}ОxD+.,(+(')''*)+---,-,,/00/0/0-0012-.00./--./.././01/-..2?W[gЖ„д§ИЕД~xtul]UWE5325655967889:;;8;99<;;FaWKJKKNJJPMMLLQNQYН€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЭxzЕЪЈ„нэюэгЄЮПА~£дь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€юю€ю€€€цґУППМЛКЙИЙНМЙЛИЙ†Ў«Жdaaa`cgdglinnqstwwx{}~АВДБВГГДЕЕЖЖЖЖИЙЕИЙДЕЖЖЕЖЖДДЖЕВЕДЕГБЕГАББ~}|}~|{zyz}|zxyyxxyxwwxutuwvutsuursprqsttqttsttroookkmjmllnljijjjjigghhhhgggjhgggfffhifghgfkhdgjgeghggfhfefefdgedcdcgfddfeddddddcdfdddbdceeeacgecdb``aceedcbbbb`__ba__]]^]\[VSNKHD@IXm}П†™≤іґіЇњ«Ўеъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юж€€€€€€€€€€€€€€€ъш€€€€€€€€€€€€€€€€€€€€€€€щсћНx{utwzИ∞йе≤ЦМЗАwqhjђу€€€€€€€€€€€€€€€€€€€эщ€€€€€€€€€€€€л„ √Ѕї≥ђ®¶ЭШСНЙВ}upjd_\UOLJE@B@>>>;<9854301131/0221101643559:=<?@>==977232141/.201/0131256788;:<>?AGJOTUSQMHFEDGGR[pБriiryАИМФҐђ≥ґїЅјЇґЇјµ†СЙВ}ГЗ\4++()(%('&)***)*-+--1/000/.12///001/0/--/-0//..-/,-00DW\fД—’ЩЕГ{wtsk]SXF32125415647589748998<;8DcTEGGFMLKHNMKIKORWЗ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юнВuН¶Ћбоь€ы‘®ПГzМ…ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€юэюю€€юююьююээ€€€ч≤ШФРПСМММИЙКЛЛИК©а‘Нda__bdcfjmnqrssuxwz}}~ГГЖЕГЕЖЕЗЗЖЖЖЗКЛЛМЙЗЖГЕЕДВГВЕДВГБ~АВВГАБ~~~~|}}{zyzz{zvuvy}yvwxssvvtsssrsqrrtqrqsvvtooomqookmjlkgggiiffhigjjjhgigfggijgfifggghhghffehgfdddgfeegedefegcbgefgccegcaaddgddfgefdcacddc`bdefecdeec`cb`b``ccbaa`ab_\YWXULEFCK_rВР†™≥ЇЈµњќ„в€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э Мwwxut}Ф∆н £ТЛЕvqfn∞ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€я“»≈ЅЉ±≠®£ЯЩСКЗ|vsnf_ZUQMIFD@A@@=@><8752221/.0.//200215425489;>=ABELOPSVTNIGEDBEJRbwД}ljowzВЛШ£©Ѓ≤ЇњјЊїƒЋµЬСЗ|{ЖR2**)('((*((++)+,-,,.0../1//1/..1010.//1..../0/-0,,0/CS]gЖ’‘ШЕД{ussk\SYD34//0023244435847:<9:99CaTGFKHFGJIIKGIJMQVЖ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЩvzИЫ∆гечэюд≥ТyБµнэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€ю€€€э€€ю€ю€ьюээыюэ€ю€€€ц∞ЦУТППКИКЙЛИЙКЙЙ™я’Оga^acacfinqqqsuwxwz}}}ББДЕЖЕЕДЕЖЕЙКИЗИЙКЙЖИЗЖЖЕЕДДГЕЕГДББГАБ~}~~~}~Б}{z|zx{xvyyxxwvwusrtuttwsrsoqsrtsrsssrpqnnqolknmkmkhfhihfgifhgjihghhgghhhgfhihhhihhiefieghedffgfeecdghgcegeggfececaaccgccdfggbbbbbcdaacccecbcb_bcbaaaadc_`b``^\WVRPOHDMXoДУЬ©≤ЈєЇњЌџршэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч ЛvwwsvБЪ”н¬ЩОЛГ|vphpµ€ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€м”»…∆їіѓ™•†ЩТНД}xtofb[VTPMHAABA>?>?;982131001/11110205024639:=;<@BEDJSTUUQGDEDBAAHShВГtkoszБЛЫ§ђѓ±їƒ≈љ√“ќѓЪОВ~{ГqA,+)((&$*()-++,*.-./0.10001.///230/./01/0/--/...../.DT[eЖ’”ЧЖВ}wppjZS[F441.2021440/33435867723AeZIHEDBAFGGEEEGJPWАэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю√~vБТїбвфь€сЅЬГy{Ґею€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€€юю€€€€€ьэ€ю€эью€€€€ц±ФРСПОКЙЙКНИКМККђЏ“Оga_`aadejmqrrqvxxxx~~~БГВЕЕДДЖЖЗИИИЛИЙЙЗЙИИЙЖЗЗЗДГДЗЕЖДГДЕАББ~БДБГАААА}}|}|{zyxxxyvxvuvttuwvtutpspqssrrrtssqrrprpmnolnlkjiighgffhfhghijfffgigghgchkjhhgghjfeedefebcdggcbbcdifbedceghgddddca^cecddfdbcddccfdbccddceababddbca``^^^`_]ZWTRJFHMVh~ПЫ™±ЈЄЈЊѕа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щфщ€€€€€€€ю ЛsuusvВЮЁкіФПЛГ}wpgo≤ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фЎ≈«≈љЄ∞ђІ°ЫТКД{usmgaZYVTMFEIDA@=?=:96210132132343314224657:;::<=A@EKRTUWQHIDDA@AGJ^zЕqjnv|ВРЭІ≠ЃµЊ»√љЋџ«¶ХНЖ}|~_6+()&$#('),*+--.-/.11221101202220//03.-10./0/--.///ETZfЕ“–ТДБА~xqqj\UYF522.1022132452312467874A^UHGDDFCEGEFFDEGOV|ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пЖv{КЃейръ€ъ–ЮИ|zЦўы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€э€€€€€€€юэ€юю€€€ю€э€€ююююью€€€т∞ХСПОПЛЙЖЙЛИЛМЙМѓўЌОfba`_cghjkpsuquxwyy}БАВВБДЕЕЕЕЗИМЛИЗИИЙКЖЗККЙЖЕЗЖДЕЗЙИИЕВЖДДГГГБВГВББ~{||||}|}{z{ywwvxuutvuxvtrtrtssrrtwssstrsrrqrooqolklliiiffffigehhiifgggkjeghhhigfggegheedffggcbeeecdcbacdbccabefggedeigbacaedccebegeggfdcehe`bbbbcfcde`^``]^]ZZWSOJGDQbvКШ£ђґєЈї«Ўч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€ц€€€€€€€€€€€€€ъ€€€€€€€€€€€€€юшю€€€€€€€ш«ЙuutqvД©геѓТПЗД}wqhn≤ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЁЋ≈ƒ√Їµ∞©°ЧСИАzuqnhba[VSQMMHGECB><99842123121222120131236778:8;?@CFMQTWWUQDDDB@AEJYuЕqjnu{ЖТЭІѓ≤є√∆Ѕ√’ўєЮХКАz}uL-+)&%%'(*,,,,-..0020233//01/1/0.//35.-10//00.....1GV\fВ“—УГАА|wsrj]TWC3031//23345355324674677A[SGC@DDCCCCGDBDEMT{х€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юХvyЕ£жпнхьэЎ•М~{Мћх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€э€€ююэю€ю€ыьюэю€€€€нѓЦТРОЛКИЗЛМЛЙККМ∞„…Пgdccbcfghlprsrvxyx{|~АВБДЖЗЗИИЙЗНПИИЙИЖККЙЙЖЖЙЖЖЖЕЙЛИКЗЗЗЖЖДДВДДБАА}||z{z{{zyz|xwyuvvutuwvvutqtsustqrusrstrprspqoopmkjikkihfhfdfdfihhhihhgijgghihheefhghgfcdghfegddddceecdbabcedbccefeddfhdbbabededddheeeffbchdab`abacbbea^_^^_\YWTLHIPYl}РЯ™≤µЈє√÷юьъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€ь€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€ц€€€€€€€€€€€€€юъ€€€€€€€€€€€€€ю€€€€€€€€юƒДtuttwЗґнёІРОКБ{unfpіч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йѕ…ЋƒЊєѓІ†ЩПИВ}wuqnh_\[XTQLJGEB?=;<896720361022/21231325868879<>@BHMSVYXUOHCABCEAETqЕrhmu~ЛШЮ©≤ґљЅЅЊЌЁ…©ЩПЖ~z|g9*)'%&((**.-....1/0/242/1/0231121032020/....0000-2HW\cВѕ–ЦЖ~{wsqh[SXC1020///4453162124834624BdXEBBB@BEJDHCCEFKTzх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э•{|ДЬётпуъыаЃТА{Гњощ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рцю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€ю€€€€€€€ю€€ю€эы€€€€€рЃФТРНМЙИЙНЛИЙМЙП≤„ƒМhedcbbfiipoqrtvzyz|}|БГВДЖИИИЙИЗМНЙЙЙИЗЗЛОКДИЛЗЖЗЖЙИЕЖЖЕЗЕДДЕДГБВВББ~ББ~|{y|yyy{xxxwvuvurruttusrsttsrqqsprsqqrrsqplmmkljhhjhghgecdehgfdgihfffgfghiffeefhgdghedgddefcaedegfced`cehgdbbbbcecbcddbbdeeeedbbbbgedbbeedcaabadbacaa\[[XVTPLKLXgwЗЩ£ѓґЈЄњ—с€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€тƒЖtttt}ПїмЏ•РМЛАytpjrЄ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€о”…««¬Єѓ®°ЪСМЙВyvnfea\YVPKHEDA>==969:236534630112/23308465789=@BCINSXXYVLD@ABD@CCPqДpgqwВЛЦ§ђ∞µї√¬ ‘—єҐХМВ|{xR-)('&'*+(.,//.//21233/23211342;8/2002/0./..0000/0HV[cДќѕЪИБА|vsqgZTXC000//0/3343000224943643DiYCADC??GPEECAEHLT{х€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю∆ЕАФќрночынЉЧБw{ѓзч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юшь€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€эю€€€ьюэ€юэ€€€ю€€€€зЂХПООМКИИМКИЙЙКСЈЏ≈Кhcbbabhkkqoqrruz{||~АДЕГГЕЗЗЖИЖЙКИЗЙЙЙКЖКМЛИКЛКЗЙГАЕЗЖИЖДЖГЖГДЖЗГДАГБ}Б~}}||yyzzwwyxxwvvsuvutvtuutstrsttqqqtstqrqponljhjjihjikjhfghhffbbcgfgdeifhhedccfgfcehhffdegdccfefigcccbddhfdcdbbdcb`cfffbcdccgdcabcebdfdbeedcaabd`bcba][WUTOLMO]pАСЯЂ∞ґЈЉ Ё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э≈Кuvvv†«н“ҐУНЛЖzvqhqЄ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пб–ћ«јє≤™£ЪХСМЗАytpof`^YTPOJIGE?<<7<8597373443101102314333324<=<@EJORVXWVQEEEC@A@CRrГqiqyВНЭ®Ђ∞їƒ»» ÷∆ђЯТЗА{xkC*)((('+(,+-,,.13064222420.1319901//1021.///00./2HW[cД”’ЬИГzspqg[TY@../1//1//110/4232434944BdTCDAA@ABECDB@CELSwо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сН~{МЊоибпьуЅЪЕvvЬёчюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€эю€ююю€€€€ыю€эю€€€€кЂХОНЛЙМЙИЙИККЙЙСїя…Кiecabfgkmmmqqquy{|{БЕДЕГЕЕЕЖЛКИЗИЙЛККИЖКЛККМЛМИИГАЖЙИЖЗДЕЗЗДВДЖВГББА~~}z{}|yyxxxxwvvwvvvvuttvssutrqtqqrsrrtrssqpqpnlhgjkkhhhhjecdhjhffbcefhiehhhiifdbdffddhfffgeddfeeedffdcddeccffdebaeeadefeddccccfccdaeghhgecfeacaacaabaa_[WSSNLNWi{ЛЪ¶±ЄЄЉ≈ўн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ€€€€€€€€€€€€€€∆ЗsuwwВЯЌл≈ЭТМЙЕyuofpґъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€п—«¬ƒЊ±©ҐЭШТКЖwuqmed]XUTRPKFD@=;=687733/250//.2-00242214658:;@ABHPQTXWWSKDAB=>=DRpikt{ДС†®∞µЉ…Ќ»”—ґҐЩСЗ~zw]4('('#&(,-,,+-0007303/221021//221/02111../01/-.2HVZbЕўЎЪЕА|ztpof[SYA./00./.-..0005142106834?_TFEBA?C?BBBA?DFHSuо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ФyyЗілд’ещч«ЭЗxrН–фю€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€ююю€€€€ю€эююю€€€ээьюэю€€€н≠ЧРНКЙИЙИЙЖККЙКРЇв Кhcc`cggjllmqqtvyx{|БВГЕЖЕЗЖЗИЛЛЖЗКЛМКККИЛЛЛЙМККЗЖЕЕЗКЙЗЗДГЗЕДДЕЕГГБААБ~}|y{{xxy{wxvwzvtuusutrtuvussrusssvsrrtstqqpqmlgihikigiihfeeffgfecgeegiedihhhfffefecdfcgjhdbdfffcbcdddeddcchieea`bcbdecddcefegcccb`eiikgeeffcbcdbbecb`ZXSQQMQatИФ°ЂіЈЈЅ’м€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гд€€€€€€€€€€€€ь€€€€€€€€€€€€€э€€€ы€€ь€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€м€€€€€€€€€ъ≈КqsuyБ•ёдµЭТЛЗ~ysjfrї€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лў«Ћ«ЄЃ©¶†ЩПКД}xsqnje_[YVSPGFBA@>:87451130/12./-.//01214337:9:<=EMOSWWXXTJDB?@?>BPryjpv}ЗЦ£Ђµґјќ  “Њ™†ФМВ}xnF*&(((&*---..-0.17201233323301125/112300/./0/-/0JW[dЕЎ„ЪВ|~|urnf[SYC1/1.-.,../0/42121/26416A^TGAB@@B?BBA?@BBHOrк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЬyxД≠би—Ёцшќ†ЗztЕ…сью€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€ю€ю€€€€€э€€€€ююэ€юэээъэ€€€€€мђФОПЛКЗККЙЗЖККЙОЇд–Кgab`ceijlnoqsuwxz|АГДДЖЖЖИЗЙИЗДЕИМЛКЗЙКЛЛКНКЛКИИКЙЗИИЗЖЗЕДЖЖДДДИДВА~А~А~zy{y{~|zyzyx|xuvtuxvtsvutrsrssststsqturqonnmkhghhighhhhjfghfegccdcbcddffggcdeigecddb`cigfdbeeeedfccfdbbbdggedba`bcceceebdegeedccefgehffcgfcdgifbca_]VRQOOWjАРЮІіµґЇ…„ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€ь€€€ц€€€ы€€ш€€ь€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€щ€€€€€уƒКsuv{ЖЃигѓЪПЙД}xukbpєщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъё—…ЅЄ≤ђ•ЯХТЛЕ}wtqoqg_\YUTLIIEA@><:97510/12///1/1-0/011134:758=DFGNRUVVWSIC@@@?>?S|shnt~КЬ£ђµјѕќЋ”«±£ЪСЛГzs]4((*(()-,,.///.2342232351012532300.12000.././/2JY]cД÷‘ЪБ}Б|rqpgYSYD0./.,--/./2/422/.227625@]RFB?<>?@?A?BACEIRpб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ђ~wВ£№н—÷пфѕ•К|uјою€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€€€€€ю€€ю€€€€€€€€€юэю€€€эю€ююэь€€€€€€€€лЂТОНОЛКИЙЙЗЕЖЗКРЉг‘Нgcbdcfjkmnqssuvy||ГДЕЖЖЖЗИИЕЖГЕЖКИКЖЖИКМКЛЙКЙЖЗЛИЕЕЖЕЕЖЕЖЖИЕГГИВБВАГ}~zz{{~~zxwzxvxyvvtwvvutuutrsrqnrqstrrttspnnmlmigjjkihggijfegefeeeeecedghffecbdffbccbacafeddcccaeifdbgcab`abccaaaabacegdbaadededcegddcdeihdcddffc``]\XQMMS`qЙЧҐ≠ЈЇї¬Ўф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€сь€ы€€€ьы€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щƒЗuuv}Пљжџ©ХПЛВ|xsl_qЄх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щиѕ«¬љіЂ£ЭЩТОЖ|wqrslc^][WROMKFD?===99200320/.000*/0/011044469;?CBIKUWUWVSLBA?@=<@f~lipvВРЯ¶≥њЋ‘’Џ÷їІ†ШПЕ}vlE*)(((***+..11/103443253212231112/01011/./.0106JY^dД÷—ЧА|~{trndXT\D/../+.....102110/304763?ZMCA?>?=>=?>A??ELQlћю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µАwЖ†’с‘…ёт‘™РБrw≥мью€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€ю€€€€€€€€юю€€ю€ююэющ€€€€€€€€€€€к®ХСЙЙМЛЙЗЗДДДЖЙС¬г”Нhdcechjmnlpsrtv{z}~ГДЖЕДИЗКИИЙЙЙЗИИЙЖДЖЙМЛЙЙИИЗЗЙЖЗЗЕЖЕЕДЖЗЗДЕЕГАВАБВВА|}{{{{{zyvtwwwvvvuqvvxvuvtqqrqpqpsutpotstrqoonmjimkjgfhigjhffedbcegefdchifdcdfddddcabadedfbbeccbcfeededba`^`bbabbbcbcdfcb`cdddcdgceecdcehidceacda_\YVSQRZj~СЮ®∞ЄЇњЌд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьь€€€€щььы€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ€€€щщ€€€€€€€€€€€€€ф≈Кuwx~ТЉжЎђУМКГzvqkaqґш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€н»∆∆¬Ј≠£ЯШТОИ}wusphbb_XVUONJFB?<<:71232120.../-/0//0//3146887=>DMSUUWZXSJBA?@=AEOSUY[XWTMEBA=:=Vxqfqx~КЫІі»џвЎ”ќє©ЮФНЕ}wjD+)'(),-,--//0232311031223140/041002034/--..-1KZ]cВ”–ЦА||{vrqiYR[B0//.-,,/.///.//./1/.223==<;A=><>=@FKi„ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лМr¶“тўЅ я√ШНГwoУўуэ€ю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€ю€€€€€€€€€€ю€€€€ю€ю€€ю€ю€€€юю€ююююэы€€€€€€€€€€€к®СОККММЗЕДЗЗЗЛКЧќж“Нgfecehikloqoqtxx{}АВЕДДЖИЗИИЗЙММЙИЗЙЗИКЙИНЙЕЖЛЛЗЖИЗЖЖЕДГГДДЕЖЖББАБ~}zvyyv|{xxvwywuutuusttrtsqpssrruurqprrrrqnoomkihihhhhfgigkigdhdedeegfcbfehedbdeeged`bededgddddbcbcceeegdccacbbbc`abefcdccabda`cfecddgdehgfcaa`_^ZVUQSYg{НЮІ≤єєњЌвю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€ы€€ыш€€€€€€€хщ€€€€€€€€€€€€ъ€€€€€€€€€€€€€€€€€€€€€щ€€€€€€€€€€€€€€€€€€€€ Нtuu~Ь÷п∆ЬРМЛГzsrlbpґш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иќƒ¬њї±®†ЪЦТЛЕ~vrmhea^ZWUPKIFB@=<:8864.-//00-,0///1204574479>?BJOSVUXXWWNEA?;:Ba{iltzБФ§ѓЉ—ийў÷ЅЃ°ЪСЙyqX3((*,+--././1134152221/..14601100/11/0/--.-.1KX[cБ÷‘ХА}|xvrpfYOXA0/-.,+.//.////./0...1109XM?@==<:>A=<;;=>::982/.020-./10.//0/2674427=>CJPORTVWVVOB>>;;;<@=;;<<<@CJcєэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€†syЬћуёЇї»Ѕ£ТГvn∆сьь€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€ю€€эюююэю€€€ээ€€€€€€€€€ю€€€и•РМКММКИЙКЖЕЗЙЗЫќи’Кhcbfgfhllmorsuw{{|~АБВГЖЕЖЕДИИКЛКЛИЙЛМЛЛКЛЙЛНЛМНКЙИЕЖЕЙКЖИЗЕЕВГДГВБА~{xy{|{zzxxvvuvywuuttutrppttrrrsqouuqprqpqnlnmiijihkefgeffhidfdbeheeedeggffgddeefeebbceeefcdbcedbeeab`cbd`bbbdba_^`aabbbdacc`cdejifdfedcgdda_\\XVTTYdvКЩ•∞ґґј’эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€хю€€€€€€€€€€€€€€€€щыы€щ€€€€€€€€€€€э€€€€€€€€€€€€€€€чю€ч€€€€€€€€€€€€€€€€€€€€€≈ЕrtwЖ¶бзµФЛЙЖ}zsolcrЄэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т„ƒ¬Њїґђ£ЮЦУЛД{trmga\ZWSMKHBA@><:;97/.12002/100/0//1345714<;;CJNTUTTVVVPC>=<:PwphnyГП•µјџспЁ–ЊЃ¶ЭРЙБzpT2()(++*,-/2402454757545324314600/00-////./38LX\`~ЋѕШГ{{xqpqj\TWB3//-/.-01-/.--/..017/.-5VG=;;::8==;<<<;>AI`їь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃuxХƒтяїЈњƒђФДwoxґлээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€ю€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€€€€€€€ю€€эьь€ьююю€€€€ю€€€€€€€€з¶ХНЛНКЙЙИЗЖЖЖЙИШћи’Мke`cfiijjknrtvvx{{}БВЖЖЖДЖЙЕЗИЛЛИКЙЙММЛЙЗКЛЛЛКМККККЕЕЖКМКИЗГДДВГВ~}|~}}z{|xxzxxvxvuuuvurtutrrrrtussqpquuspqoprplnnkkjhfiddhghjigfecddeghfggefgeeeedbdggddbdbddcbddddcbb`beedd``abeeb``__abdbbbbabbdgkhgfdfefgb``]ZVRTU_l|ПЭІЃ≥Є»зсю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€чю€€€€эшь€€€€€€€€€€ьь€€€€€€€€€€€€€€€€€€ъ€€€€€€€€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€ћНtt{Й≥кг≠ТМКЕ~ztoj_sЈч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щЏ≈јЊљ≥ѓ•†ЩСНЖВ|tolhb]XUSPLIGAA>;=9;4.0/011340//2/0125440189<@CIOSSUUTVULA=;;;]vlku}М†≥Ј–офзЏ іІ°УЛЕ}rb?+)***)-.-/00241155474341141242...,.0.../136LZ[_z…«ЦГ{zxtrrh[RU?2/./0.../../...0/05A-..8VH<:::888;;==<;=9:9340..1131.1///03402/048>:99872./2010/01///01110246;;>>BKSVTSTVVUE?89:SxnkrП°≥Љўтцрд ≤£ЪТЗВyq^9-++.,.-/243035575572112573532133441200///5Q\]b} ѕХ{zxtpncXOUA/10-..0.--/0.0/0000..0/7PD9;9;<:::;<<=B??D[ђы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ї{uПЊсмљЂЃЄ™ШДyot≥нщю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€юэюью€€€ю€юэю€€€€€€€€€€€п®ТНЙЙИЖДЖЕВДВЖЕЪ…я–Нhfdefcilmnoprtvz|~}ЕДЕЙЗЗЕЖКЛЙЖИЛЗКМЛКИЗИИИЙКИЛЙЙИККЙЗЖЗЖЖЕВГЖЕА~ВБ||{{}}{zyxwxxyyuuwvsvvuxtqoppoqpqtqqrqrqqnsooolnkihjhghddeheffeecefiihhdabeddcdeebedceceffehga`adeedecdddbaabcbbcbb_abba]`aa``bfghhbadabaa`]WQSV_m}ОЮ•™ѓњ“ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€ш€€€€€€€€€€€€€€€€€€€€€€€€ыъ€€€€€€€€€€€€€€€€уэ€шыю€€€ю€€€€€€€€€€€€€€€€”Фqv}ЮЎс ЭТЛЕЕ~wtpmjЗƒь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кћ∆¬Љіђ¶ЯЬХМЕАzupkge`[WSOLKG@?=;9;8820212/1020....1/122558;<>CLPQRTVTSMF=88Chtlp{ИЬЃµ»лшцоўЉ©ЮУКВ{tjH/-,/-./.321123235351/1422111633112242/0216P^\b{… ПАy{ytnmcWPUA1000.//,..-/,--/0//02/05PD8;79;;:<:=:9D?@AW©ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЉzuОЄорƒЂ±Ј™ЧЕ|rqђиэ€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€ю€€€ээюю€юю€ююююэ€€€€€€€€€€€п®СОНКЙЖЖЖЕДГЕЕДЫ аќЛieeecehjlonrrtvz{}}АГВДЕБЕЗИЛККЛЙИИММЛЙИЖЖИКИКНЛЗЙМЙИЖЕЗЖГГЖЙДВВ~}|z{}}}{{|wwwwxvvvvtuvstspqsuoprptsrsrsppnrrpnnpljggikieedhgeddbbafifhgcccdbedfcaaecdccebeefcaa`ceddfegda`abaabbacb`accb_aacabaegeedcd`__^\XSUYarДФ†¶≠Ј»„÷ч€€€€€€€мю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш€€€€€€ь€€€€ь€€€€€€€€ъю€€€ыы€€€€ыы€€ышю€€€€€€€€€€€€€€€€ь€€юую€€€€€€€€€€€€€€€щ€€€€”Уru}ЭџрјЬСЙЗГ{spmg~Њх€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€н—∆¬Ї±ЃІҐЬУКЖzuple_\ZTQMJFDB@<::5655432.30/../.,./2/010349=ACGNQSRTSQOH<:9StnlsАУ¶≥Љёшцтй ±£ЪРЕ~wpY6-+,,-/-0//32212412//011210/53/1/0322.0216S_[`z»√МБ}}ytlme[SXF2.11-0/.....,.--110/0--4QD8977:768:<:9>=?D[™ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЇzwНѓзу√¶±ґ™ЦЖ}vnЩащ€€€ю€€€€юэ€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€юю€€€€€ю€€€€€юююьъю€€ээюэ€€€€€€€€€€€н®СННМЙЕЕЖИЙЖЖЖЕЦ жЋЙjccecdjijoostux|}}БВДДБz~ЗКККМОНЖЗКММЛКЛЙЖИККЛМЛКНОЙЙЗЗЖГГЕЖЖЕДДЕВА}~~||}zxyzyxxwvvttwwusutrurrrpsqprqrrtoppoqqommkkjfiigdddffcdecabdfdedceec`ddeccbddca`bbcdcaaaabcehhgeedcddbeccba`_aaaf`acb_dbdfeeeb`^_\YWUS\jyЙЦ°™ЃЇ“ътпю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€ьы€€€€€€€€ы€€€€фю€€€ьь€€€€шэ€ыьэчъ€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€“Уru}Ъ„с¬ЦНИЕВБzqogc|љс€ъ€€€ьы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€с„ƒЅљЄ±®ҐЮТМЖАytrha_^ZWRQLLF@=>;968540303//.../0.././04436<=@DIPRTTRSSMA;7BhrgpzЗЮѓЇ„фщфмЎї™†ФЛАyre@,++,-..//12212/012-01132101422222101//029V`]`} ∆СА|}xplpf\U[I4//020/0-.--0/./011/.,)6UD;558;9:8;:68::=G[®ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ї|wМ©№р»§І±©ХЕytoОЎцю€€€€ю€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€ь€€юю€юэ€эю€юэщъэ€ю€€€€€€€€€€ж•ЦОММЙЗЖИКЙЖЖЕЗЪЋз…Жieeeddjijoqrtvy}~~АВЕЖДБДЙЙКЙЛОМЗИКЛНМЛЙЙКЛЙЛЛММКЙМИЛЛКЖЕДЕЕДИИДБГДБ}{||{xv|yxxywvtuvvusrsuuqostqponoqqsqrroppllmjighigfedfgceeec`caddbddebb`dbadddddca``cdedac`acadheddecbecefccba_a__aeaaca`adfedaca^[ZWTUV[j}КЪ£Ґ≠јпьщюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€ь€€€ы€€€€ы€€€€€€€€€€эы€ш€€ць€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘Уst£ЁоЅЦКЗДВysph_yЉт€€€€€гзэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ц÷ƒ≈јЇ∞®§ЫУНЖ}xsnhc`\ZVURRKA??>;897311111/-,.,././..144349<;86971210//..-.-.122005977=?@EKONRSSTSOG=UupqyЗЭґ≈Ўрщчщи»±°ЦРКАshD////133/10245421132243035231011/51.//117U[[a{≈«Х}}xsnpg[STC50./.+./.01,.-/0-.,-/,*3JC7477554989<;;<<@S°ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ї}vМ™÷тиґЂђ¶ЪИ{up~≈сэ€€€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€ю€ю€€€€€€ююю€юэ€юэээ€ээю€€€€€€€€€€юю€€’†СМИЗЙИЖЕЖЕЗЖДДШƒ№«Дieccceilmmoswwy~ГГГГЖЗЖИМКММКЙКМККИМОЛМКЙККЙИЙЗИНЗЖЖЖИЛИГЗЙИВДДВАВ}{|zyyx{{uvuxtttvwrrssqrpoqroqopppoqrrqmkmnmjffhlljgdecffbcdabdddca`bbabb`bcddb```bddcdaaaaecadcbbaba``a```aabbc`a`]``cb_`a_`b`_]YWQPXeq{ИЪ°ІЊоы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€ычю€€€€€€€€€€€€э€€ыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъю€€€€€€€€€÷ШtwДїпнЄХЙЖЖД~xrnhZyїф€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пЋ∆√њЄ∞¶ЯЧМЕxumifa]YXTRMHEC?::9886311./..1-....132054139<=>EKJORQROQRHIkqnuАФ∞ ’лщъъхЏґҐШТПГtkO31+.2542111012631322423241/0/13/30.//138X]Za{≈√Ф~}|wqkof[SUB4./..,-.-..-0-.-/0..0.*3PA65349759:9967;:>S†ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ї{vМ®—поїђѓ®ЪЗztn{Ѕтю€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€ю€€юэю€ю€€€ыэююыьь€€€€€€€€€€€юю€€я£СЛКЙЗЖЖЕЕЗЖЖЕЕЯƒ„≈Жhdedbdgkmmqtvwv~ГВДЕЕЗЖЗЙКМНМКИКЛЛКНПЛЛКЙИЗКИКЙЗЛЗЕЖИКЗВГЖЕИЗЖВАБА~~~|~А|yyyz{zuuwusrtttststusrplnpqoopppqpqnmlonljgfgghebeccefccc`acbege_aa^aaaacdca`a`bcebcbbccebbbbabccbaab_^^a`bba_`a___bca_ba``][YTTV\jvДСШ§Ї÷хю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыю€€€€€€€€€€€€€ыыыю€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€”ЧrtМ¬ои∞СЛИЙВ~yqoh^zїрю€€€€€€€€€€€ъю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€нЋ√¬љµЃ•ЮЦНИwqnjha]XVSRJEFC>;<;97433//1.:6././/1/-/4256<;>BFKJPSSOQSPM_qlqxОІ»‘бхыъшдЅЂЬЧУЙznY92,-/10300202342/134110/411.0/0000//103:ZbZ`∆ЅУА~ysloeZSWC4-0...-.,,1.0/.....-...2MC:754664:8442488=QЬч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Љ{uМ• мсЊ©Ѓ©ЫЙ}tjyљню€€ыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€ьэ€э€ююээы€эю€€юю€ююю€€€€€€€€€€€€ЁҐОЛЙИЙЗЖДЕИЖЕЖЖ†¬‘¬Дieeeeggjlnrswyy}ГЕЕЖЖЕИИЗЙКЙИИЗИЙИЛЛМЛЛКИИЙЙЙККККЛЗЖИИДГЖЖЖКЖДББББ~|}}||yyyyzwuwwwttsruvuwtstspopqonnprnnprrpnmmmkgheccdcccdccdddbccccgeaa`ba_bbaa`bcdbcbd`acdddc``aba`abbaaa`_^``a__aadd_^eda_cab`YVUR\gpyЗФЬ°Ѕуы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъэ€€€€€€€€€€€€€€€€шщь€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъю€€€€€€€€€€€€€€€€€÷ЧqtП…сг©ФМЛЙЕ|vrpg]{Їх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мћјњїґЃ•ЮХОЗАxtpne`\XUTMJEEA=:;;8445101042//.002.,-225577=BDFINQSRPONN\xppzЙЬЅ—„сыъыр–µЯУНПВsd?/.-/01102863410433621/.1230220/00/010.9Ya\`≈ЅСБ|ysmmeZSYE4//-+../-,1././/..-,..-1IB;83344686675479=QЬч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ј}rМ•¬итЅ®≠®ЩЛ~wkvЄмы€€э€€€€ю€€€€€€€ю€€€€€€€€€€ю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ю€€€ю€ээююэыю€€€€€ьь€€€€€€€€€€€€€€џЯРНЛИЖЕДГЕЕЕЕЖЖ†∆ўƒГhgbdeggilnotuwz~ДЕЕЖЖЕЗЗЗЖИЕДЖЗЛЙЗЛКИМЛЙИИКИКИМЙИЙЙИЙИГЗЗЗЖЖЕВВААА~|}|}}{vvw{yzwvwutttuvtvupqqqqonollnpoopopookmmlffgfcfdcbcbaedbcdcd`ba`babbaa````bccbbababbdcedb_`aa``a```b_]``b_]^bbbb`cbda`a]\ZUSTYhr}ЙЦЮ®јйю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ€€€чхы€€€ью€€€€€€ью€€чы€эью€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыэ€€€€€€€€€€€€€€€€€€’ФsuЛЅрг∞СЛКЖЕ~vqnl]Њрю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сћЊїЇіЂ§ЬХНЖ~wtogb_^[TPNJGB?=<<952652/21.3//0//.,../10134:=AHORQOQOPQYttoyДЪЉ’‘лцщьчЏЉ¶ШОПЙxhF/--./220153121251410220033/03101.121/-6T^]^y≈«УБ}|xsllcXSXE30/--.-.///-....----,.,/IB6:8442359763589:745563/11140./0./-,./.01208<>EJMPPQOPRThskrАЦµџ„яущъъе≈ђЪСОМwjP3-.0/000041/0/05221/11001/-0012//040017T_]_z∆ ЧА}}xtmlcXSWB200./..../-.././-.,,,.+2ID9>9454258836687>KХх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€√vЙҐ¬зкЉ©ІІЮЛzsmq∞лээ€€€€€€€€€€€€€€€ю€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€ю€€€юю€€€€€€€€€€ю€€€€€€€юь€€€€ыэ€ююэ€ьэ€€€€€€€€€юю€€€€€€€€€€ў°РЛКЙИЕЗЕЕДЕДДЗ¶Ќе‘Нhffccdhjknptst{}}АГЖЖДЕЗЖЖГЕЗЖИЛЛЙЙИИЛМЛЛЛЗЙЙЗММЖЙМЙМИДЕГЖИЖВЕЖВБАБАБz{z{xxy|yvvyxuvuuvvtwuqqssppmlnnonnpppoqpponiecfd`bec`dcdcb`_cdb`cdb_a_bcaaab`ababbabb^_cb^`ba^`_bacaaaaa___^ab_`ca`abeca`[VTPS[jvАОХЫ≥ќдэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыю€€€э€€€€€€€€ь€€эъю€€ээ€€€€ью€€€€€€€ыю€€€€€€€€€€€€€€€€€€€€€€ыъц€€€€€€€€€€€€€€€€€‘НrtМ∆ра©УМЗИВxtrkf]}Љщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хќЊЇіѓђІЮЧНЗ~vrpha\ZWSQMFB@A@<4677651243/////0/--/..10188;BGHPNLNPSS_vnpzН™”Ў÷пшъыоЋ±†УПН{lU80/0//2224302./2323010/10//0/0//0.0/038W\[a|»ƒУБ~ytljbVMSA20/.-1//-,-././..--..-+1NC:86486346762147=MПф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ј~wК•∆йлњђЂІЮМ}tlj™мю€€€€€€ююю€€€€€€юэ€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€ю€€ю€€€€ю€€€€ю€€€€€€€€€€€юю€ю€ъэ€эю€юю€€€€€€€€€€эьюю€€€€€€€€Џ°ОЛКИЗЖЖДГДВВГД§–д“Кgccddefikorussz}}~ГЖЕЕДЕДЕБДИИИМННМЛИКНКЛМЙКЛЙКЛЖИКИИЗДГЕГЕЕГДЖДВБА}}|yzxzzxyxxvwxvvuvwusttrrropqomnknnnmooopnnnmjgeeeeceacdbcec`_ddd_bba``__`aabaa`abbaa`a]_`]^_a`\]_``a```a`^]__`b`^a_a`bfd_\VSSV`l|ЕНФ†Їажщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эь€э€€э€шю€€€€€€€ь€€ъщю€€€€€€€€€€€€€€€€€э€ыю€€€€€€€€€€€€€€€€€ы€ыюющъю€€€€€€€€€€€€€€€’СquЛ√па™РЛИЖБ{spmh\~Њф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЋЊґіѓЂ£ЪФОЖ{usmf`^YVSNLGBAB>98858741330.0..011..-../0567>AFMLKLRPQXutoxЗЯ я—жцшъф“≥ЯРЛМАl[:0..0/2213101023330/00.01001..,//.//.28UYZb{∆јУВБ{slk_VLR@3-.0//..,,./0///0/..-+*1PE844356356632347;LСф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€њ~wЛІ…нр¬ђ≠¶ШМ}vmj®о€€€€€ю€€юэ€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€ю€€€€€€€€€юъъюю€эьэ€€€€€€€€€€ьшээ€€€€€€€€‘†НМКЙЖДВААБАВВВ§ѕдѕЙfbabcdfhlpqsuwzz|}БЕДДДБГЕЗЗЗИКНЛННЛЙЙЛЙМНЛЙКЙЙММЗИЙЗЙИЕДЕБГЕДГБАА~А||~|z|{}zzz{wuvvutuvvuqttrrrmpnommhlnomlloponmllihfefdebcba_bba`aab_`a`_```_`aa^`__aca_aa__`^^^__]^`_aaa_`b__`a``a`__a`____\XQQYcq~КСФ§Ѕапы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыю€€€€ыъ€ыю€ш€ы€€€ь€€€€€э€ъь€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€ыю€€€€€ъыъю€юю€€€€€€€€€€€€€€€€’ЦruМ«пЁІРЛЙД|sood[Ајщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сћїєµЃІ°ЫЦНВyuqke_]WTSQKGCB><;;7345111/.20.2110/-.../126=ACGJLMONMTmvouГШ∆ж÷№сщычўґҐТИМВobC2/////12431015410/0/././/01//.00/20./7T\Zb{љЅШГГ|qkkbWOR?4-000.-.--//0././..--+*0HA762530677723776::86776550./0.33//-,-..-/059=AEONNLOPQdtmq~Рєжя‘ихъъаЉ¶ЧМНЕpeM62210/2026421340010//33.//-/./0011/0/6S^[c{їЅШДБЗ|qkkdVPTC5/...--...--.-0/.,.-,,*0F=88:65234565245:=HПт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€¬~tЖЮ¬кр≈®§ҐЩЖ{tjh°р€€€€€€€€€€€€€€юю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ююэюэ€€э€юээ€€€€€€€€€€€€€юю€ю€€ю€ю€€”†РМЛКДГЕДГВЖДБД£ћа≈Вhca`_eiinpssvwxz~БВДЖЖДДЖКЗЗЗКЗЕИЗЙКИИКЙЙКИИЙИЙИЖИИЖИЙЕЖЖЕДДЕАБГБ}z{|yz{~}yyxzzxwvutvwvsqsuuoopmijmoljmnlmnlnonnnieffdfgfecdgfeca__`a`aab``_aabaac_ccaa_^_bbaba`a_aaa`aa```aaa`aaacbaabb_`^ZWRPWfwВЗТЫ≤ быю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€эыю€щыю€шю€€€эъь€ъю€€€€€€€€€€€€€€€€€€€шээ€€€€€€ьъэ€€€ю€€€юю€€€€ъю€€€€€€ъ€ъю€€€€„ОoyУ»сЎ¶УКИЕzsnmeY~њш€€€€€€€€€€€€€€чэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€у…љЄ≤ђІ†ЬРЕ}zwqgb\WVSQKFFF><;97568946210//--,,.,,,*-/-6;@N[SOJJMP]vop}ОЂажЌятшъз∆™ЪНЙЕthT542001311533210001/..58/..-.-.//0/.107S^\c{їЇЦЗГДzpkiaUQXD1.-.,--.-,.,00/-,.---+)0HA::975114246223::GРт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Њ{uЗЯ≈кр»©°ЯХДzuliЮйю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€€€юэююыюьэьююю€€€ю€€€€€€€ю€ьюю€€€€€€€€“ЯЛМКЗГЕВБВ~ГЗВГ£ћ№љ|ca_a`dhimprtuwyz|~БГГДЖЖЕЖЛЙЗЖЗЙЖЗЖЖЙЗЙЛЗККЖИЙКИЙЗЗМКИДДДЖЖИЖГГГББА|}|{}}}|yzwyzxwuttvtstruuqqppmkkmnkkklomlnpqpnoliecdeedfffiffebba`aaaec__abbcb_babcac`^_a`abaaaaba^^_````aaa`_abcb``a_^\XTSU\ivАЗНЫЈ÷пъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыющю€эцщ€€ьь€€€€ъыю€€€€€€€ь€ью€€€€€ы€€€ыыю€€€€€€€юэ€ы€ыю€ъю€€ъю€€ю€ъю€цэ€ю€€€€€ъ€„СrxЦЌтЎҐОЛИГztolg]Вњш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€с…ЉЈ≤ђ§°ШОЗ|xtke`ZWSTNKHF@<;:9767554/1023/-,-0-,,*./.4:>ScSJJKOPWsqnyИ£ўм–÷луъкЌЃ†СЗДwn\930-.012113410.0/0///.20--//-./.--.1/6T\Z`yЈґХЙД~yqih`VPXC1./11/..,-./1/----,+-+)2E@;:864203454/016:85333010/../00/*+)+*4X[TUQG:?FKMVrsozЛ∞впЏ’ялт„≥†ТЗ}uleT:21466343223310042//././-/10./21//024LVTZmЂµФ{zslee^ULSC0.00/.---,,..,+,.-.+,+*/HE;96555441/0.1413BЙп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€«}pЖЮ√от Ђ§£ЬНАxogЗЏю€€€€юю€€€€€ю€эю€€€€€€€€€€ю€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€ю€ьъюьэюэюэюэ€€€€€€€€€€€€€€эю€эъююю€€€€€ ЦЙЕЕЖЕЕГА~~АД°≈џ»Гb`bbbekmnrrswwxyz}~БВДДБЕДИЗЖИИЙИДЖЕЗИКИЛЛЙЖЗЕЗЖЗЗЗЗДЕИЗЕЖЕЕГЖЕБВБАА}}||А~|zwwvuuvxwrsrpsutsrpmnmmmqnlmnknnkmnkkjknjefiheddbafgdfdfdcdecc`_bbceddfdcbddc`cccdbaa`a``aa``abacb`ab_^_ZWSSZjwБВЕЬЇаыью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыю€€€эю€€€€€€€€€€ыю€€€€€шъю€€€€€€€ыю€эщю€€€€€ью€€€€€э€€€€€€€€€ць€€€€э€€€€€€€€€€€€€ююю€€€€€€€€€€ъю€—КmwШ”о–•РТОЖАvqkg^ZЕƒпю€€€€€€€€€€ю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€ыяјі∞®£ЫСЖ~wohb_[XUPLFFDA><;83131/10/..10/++++,A\WSUOF;=92/2500...-//0/-+.5N[SQSJD:9CFLPgokuЖ•ЎрибяжсЁє§ХКvkfX>4157545335444221211//0-/-/0//0/10.05LUTUi£≠ЦГ|ztmfc]SLWG4041//,,-/-+,,++,-+,,+(/>><>745531001.1027BГм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ ФuЩ¬исЌЂ£°ЫОБwmc}’э€ю€€€юю€ю€€€эю€€€€€€€€€€€€€€€€ю€€€ю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€€€€€€€€юю€€€€€€юю€ъэ€€€€€€€€€€€€€€€€€€€юю€€€€€€€€«ФЛЖГГДБ~|||В†»ЁњБfebbbcdilnqqtvx{|~}БГБЕЗЕЕЖЕЕЖЛИЕЕДЗЖЕКИЗЙИИККККЗЗЖЖИЖИЕЕДЕИДВВДВАВА|}~~}{x}{yyxvttttrrttsqssqqlonkljiijkijjjlnijhigghedfefefcccefdeegfeccccb_]^a_aa`_```bace`acacdb`aba___abcc_\_[URRapx~ВЙҐƒзэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъэ€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€ыэ€щэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эщ€€€€€€€€€€€€€€€€€€ъъю€€€€€€€€€€€€€€€€€€€€€ыю€€€€ы€€€€€€€€€€€“Лnx§яфѕ†ПНИДvoni_YД¬ч€€€€€€€€€€€ью€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЌЇ±™£ЧНИ~xrmh`[YUROJEB?><:62110.,--......,+4VWOSOEA94=FIMfqmtВЯ‘укяўялЏЇ£ЧКАwng[B7/343376552153/2001/././-,.-0.-/0..3IQQSf§©ОА{zujdc]RKUC3/41/-,--+,+-*),*+,-+*+09:9:866893./10333:CВм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∆ДrАЩји𖙥†ЧЛБzoaz÷ю€ю€€€€ю€ю€€€€€€€€€ю€€€ю€€€€€€€€€€€ыю€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ю€€€€€€€€€€€юю€ююъээю€€€€€€€€€€€€€€€ююю€ю€€€€€€€€€∆ХИЗГДБА}}~~}{~БҐ…яЅ~fec``bgijmosvuwz{|}АБВГЗЗЕЗЕЕЖИИЕГЕЗЖЗЙИЖЗИИМЙИИЖЗЕЕЗИЕЕЕЖЖЕВВЕЖЕБ}|}||xx~zvwvtuwuussvrrqrrpnlkljijjkljjkkikllkjjhecccfefgffefgfddeffecacbaabacabb^`b_abbcdabebdecbcca_aaabdca]\VQTas{ВК®«еы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йтю€€€€€юыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эщэ€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€ю€€€€€юхпцфщю€€€€€”ЛoxҐёф…ЫЛИИДvnoh^\К√ч€ыю€€€€€€€€€€€ыю€€€€€€€€€ью€€€€€€€€€€€€ыю€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€ьыхЌЄ∞ІЭУОИ}wtmfb]WSPNJEA@;964121/---/-..-+++=844011...-//-+,+IaUSRJB>51-*2>E\ros|Чћтићјї∆»іҐФОДzqd[C67755563531254/0/./.0./--//..///01/1CHBMXyГytspnkdb]PIRB4../2//-.-,,(,0.++,,,+*-=?54342/0//././35=:862.//.-./.,0PaVSQHB<73.)%%0DQeprpp}{k`^YSFPC104452..--1-,-/,*-,+-,*-984442/./0/..-2278EВз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЌnxНЊнућ£ЬЭФЗ~vpelљш€€€€€€€€€€ю€€€€€€эю€€юэю€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€ю€€€€€€эюэыыюээю€€€€€€€€€ю€юю€€юю€€€€€€€€€чЇПЗДАА}~ВААБББДЯєЋЄ{a_^a`dijknnqtuuy{|}АБДВ}~ГГВДДДЕЗЕЗЗЖЖДДЖЖЗИИККЙЕЕДДЕЕЕЕЖЖЗЕААБББ|}~zz{zxzxwwtttttrrttroqropmkihihehjkjiijkjijkhfcabddebbdeeggfghfhhggfhghgefhfeeggfghdceghdbbceeffeedaa]TOWerЗХТ°њвъыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъэ€€€€€€€€€€€€€€€€€€€€€€€ыэ€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€эю€€эю€€€€€€€€€€€€€€€€€€€€ьэ€€€€€€€€€€€€€€ыэ€€€€€€€€€€€€€€€€€€ ~jx°ЁојЩРОРИ|tmijaZК∆т€€€€€€€€€€€€€€€€€€€ъы€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€эю€€€эю€эю€€€€€€€€€€€€€€€€ьшЎ≥£ЮЬЧОЕАzqfb`]VRLGB>;96720././31.;Y[SSPG?960**%!(8Vrpq}Х…тгЉ≤∞µљ∞ҐЦИyoe^L92465544653231/./0000110.//.00/13100>C=BNckmmlpoha^ZQGQE534;6/--../.+,,*-.-++,+.687620/.////.-.138A|ж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћ}luКЉмцќ§ЮЮУЗ}vpekЄч€€€€€€€€ю€эю€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€ю€ю€ээ€€€юю€ю€€ю€€юэ€€€ь€ьъююююэю€€€€€€€€€ю€€€ю€€€€€€€€€€€хєРИВВБА~БББББЬЈ«≥{a][_bdfilmnqsuux}}БАБГА~ВГВДЖЕЕЖЕЖЕЗДГЕЕЕЖИМКЙЗЖЖЗЗЗЖЕЖЖИЙДАБВАА}zxy{zyxzzywttuussrsrrporqolihijhggjhgjihljhhjjgecghfgdccihfefhhgjhegfghhhgiihigfgefiedegifccbeecfddeb^VOWmyЙФІјаы€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€ю€€€€€€€€€€ю€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€ыэ€€€€€ю€€€€€€€€€€€€€€€€€€€»|mzЮ„йљШЧШЧКzuplh^ZО»оъю€€€€€€€€€ю€ю€€эю€шшю€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€юют–∞°ЯЫФМЕ|voie_WSPIDC>::72211/0402J^VRSMD:73.''&#%3Upqq|У≈няє™Ђ±Ј™†ЦЛАyqf]K:657743555754200/////010-/0./31110/1AC>CM[`fkmqog`_ZNFPF73142/-..---,+,*21,+**)/78940/0/...//,0425>tг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќkwНґжу…£ЯЯХИ}vobmµф€€€€ю€€€ьэ€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€эю€€€€ю€ююю€€€€€ююю€ю€ю€юю€€€€€ю€€ээ€€€ьэ€€€ьью€€€€€€€€€€€юю€€ююююю€ю€€€€€цЄПЗДГГА}~}~АА|Яї ≥z`]\^aefhkmmptvwx}}~~АВБВДДЕЖЕЖЗЖЖЙЗДДЖЕЕДЖЙИЗЕЖИЛКЗЕЕЖЕДЕГВВА~В~{y||yvxzxxwussurrrrqqqoqqkjjgfhfeeddijhhjijjgfhfcfghfcdfggfdfkkhgfggfhgdegihikjggffhecdeffdfbceefaaa^XRWkАЗОТ§≈бш€€€€€€€€€€€ьщэ€€€€€€ъю€€€€€€€€€€€€€€€€€€€€€€€€€€ъэ€€€€€€€€€€€€€€€€€€€ъэ€€€€ю€€€ъэю€€€€€€€€ыюыэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€∆xlw†ЁмЇХУЩСЕ{tpmi]YП»ню€€€ю€€ю€€€ыюыэ€шью€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€ьъю€€€юцЌ™†ЭЧРИАzvqg^ZWROHD@<<:44420..-9W]SSRJA<5/+'$$ -Tplo~ТЅмгєЂ≠±≤©°ЦМВysd]K9635975777:65544000.111/./0-041//1/1AAsг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–hxОЈдтЋ§ЭЮФЗ~wm_k±т€€€€€€ю€ю€€€€€€ю€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€юю€ю€€€€€€€€ююю€€€€ю€€ю€ю€€€€€€€€€юююю€эыю€€€€€€€€€€€ююююю€€€€юю€€€€€цЄПЖДГБ~||}||~~{Б£¬“ґz_^^^^dhfhkkosuvx|~|{}}А~А~АДЖЕЕЕЕЕДЕИЖЕЖЗИЕГЕЖЗИЕЕЗЛДВЕВБГГДДАББ~АГА}}||{xxz|xvustrruvtrnnmpqlkkjihghjgeijlkkjkkgefc``acdadhdafegljfggfgiifdcfefiiiihiiigfeeedfhdbcfhc`\XRXj|ЗНЬѓ–кщ€€€€€€€€€€€€юэю€€€€€€юъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъэ€€€€€€€шхэ€€€€ъэ€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€ьээю€€ъэ€эю€эю€€€€€€€€€€€€€€€€€€€€€€€€ююьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒwlxЮ№мЈРЛНЙЖ~uonh]ZРЋнчщюьхь€ыэ€€€€€€€€ъщэ€эю€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€ью€€ьэ€€€€€€юэ€€€€€ю𫮆ЫФМД~yskc\ZWTOIC?<965113/..D^YRTPF@:2/,("! 'Onlo{УЊлеЇ™™±µ®ЪСИБzre_L9647:66778746414110/1/./...-130//000>@;=EWafiknka_^ZPGQG7323011/00-*,+),,*+(*-*.8701/./0.../2002/2=oя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–}gwНєйфћ£ЬЯЦИ~xn^i∞т€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€ю€€эю€€ююэ€€ю€ю€эю€ю€€ю€€€€€ююююююю€€€€€€€€€€€эю€юю€€€€€€€€ю€€хЄРЗЕВАА}{||}|}|БҐ∆ЏЈz`^a`^bghiknpqstvz}{|}ВБ~ААГГЕДГВВВЕЗЖЖЗЕЗЖЕЗЗЖЖЗЗЖЖДВДГДЕГВБ}}БДБ~~}y{}{yxzywuussrsturpnlinplijjljhhknlhijjhhlggedb`aaccbefdcffhjgegigghhijgecfihihjjhgfffefeeifccehf^VQQgИМЭЈ—оэ€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€ъэ€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€мнь€€€€€€€€€€€€€€€€€€€€€€ъщэ€€€€€€€€€€€€€эюыээю€€ъэышэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€јun}°№нЇРЙЙИЕ}uqnh\\ТќёЎкцщю€юыэ€€юю€€€€шэьюцщ€€€€€€€€€€ьэ€€€€€€€€€эю€€€€€€€ью€€€€€€€€ью€€€€€€€€эю€€эю€€€€€€€€€€€€€€юоњ°ЬЩУЙВ~woha_[USMDA><<94132/6R^WUWOB<70-*(! Hlmp|РЊквЉ≠ђђ∞®ЬТИБ{qd]N<67787767987630552110-,//...110.011/:@<=IV_dhhlh_[]ZQGPH86433110/..+,++-+**')*)-78530..-+,-.0.0244820,(&  >fnpzКЄибї±ЃЂ©•ЮТЙЕ}qc[N>9754687669:7425312000/.-./-01../21/7=;>LV[_cfkkbY][QGQI:5743420-...---,++,,+*&,78300//+,......036=rб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ќ{iuКµдс«§ЯЮЦЛwn`g∞у€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ьэ€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€ю€ю€€ьэ€ьью€ю€ю€€€€€€€€€€€ююьью€€€€€эю€€€€юю€€€€€€€€€€€€€цµОЗГГВАА~}|~А|zИІ√Ўєw\\]]_cgijnnorsuy||~~~ВААГВАААБДЗЕГДЖЕЕЕЗЗЖЖЕЖЗЕЕДГЕЖЖДДГВГГГБ~ГБ}}|}~zzyzzxwtsrqspnqpnnnkknmjijkkggjkljhefgfggfeec_``aaaabddfhgfikigghhkifijfehjijhhihghihghihggfe`ZSRavЖРЭіўъ€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€ыэ€€€€€€€€€€€ъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€ьэ€ъь€ьэ€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хЄvkw†вйґТЗЖЖВ{tlkh\YУќЁующшщюэщэ€€€€ьыщэю€€€ь€ьчь€€€€€€€€€€€эю€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€фЌ¶ЪЧУЛЕxpic\WVRLDB@<997635R_UWVND>90-+&%#=cmpwЙіегЊ≠©©™ІЯХИДsc^P?8777776889865010141020/,./.00.//0017;:;FUY^cdimg\]\RHSK:5764320-.-..,+*+**,,+*.7<8520./.-,,/0//355/,(&&7`km{НЇйдЊ≤ЃІ•§ЬУКБyob]VE;;:669<95345625412001/..-../1/.130/8=:;L`\VWUNC;50+''&!8alnzПїзгјЂ©І•ҐЮФЖ|rb\YI<;96689:5566796201121./.,--.00121217;9=DNU]ccdie]]XOGRI888563//.-+*+*+*,,+)*)&+2520////0/-.../147;jџ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕ|fsИ≥гп∆°ЫШУЙ~xobgЂт€€€€€€€€ююю€€€€ю€€юю€€ю€€€€€ээээ€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€юэю€€€€ю€€€€€€€€€€ю€€€юю€эю€€юэюю€€€€€ыыю€€€ьэ€€€€ююю€ю€€€€ю€€юю€юю€€€€€€у±ЛЖБ||{{{{zz||zГ®Ќ’≠s]^\[^`dfgjlonptxwyyz{zz||}~АБАБББВДДДЕДДЖЗЗЕЖЕЕДДДЕЕЕЕЕЕДВГГБААА~~}|{y{zxxussqpolnkiiihggilljkkiffkmopmlomiifegheca^^][_`bccbcgihigjmlkkjhjjjkljkkhkjehhikjgge`[TP\yРЪЯѓћт€€€€€€€€€€€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цъ€€€€€€€€€€€€€€€€€€ыь€€€€€юю€€€€€щы€€€€€ью€€€€щь€ью€€€€€€ююью€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЇtgxҐџмЉУНКЕАwspmgZ]Ы—иьщыыэ€€€шы€юыю€€ээимэюю€€€€€ьщэ€€€€€€€€€ыъью€€€эю€€€€эыю€€€€€ъь€эю€эю€€€€€€эю€€€€€€€€€€€€€€€ьэ€€€щыдљ†ХНДzunf`^[VQMKFA<=T_VTVTJ?83/*'#!7_kp}РЄил≈ђ©®І£ЬТЖБ~rc^]OB<::9:988666863440152/10-.--//34122367>CLU_cachd\[YOHRJ79:6420/./+*,,+,,-)')*'+332111/..01/....36:k№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕ|gsЗµзр≈ЯЧЧТИ}woad©т€€€€€€€эыю€€€€€€€€€юю€ю€€€€€ю€ю€€€€ююю€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ю€€€€€€€€€€€ююю€€€€€€€€€€ю€€€€€эю€€€€€€€€€€€ю€€€ююю€€€€€€€€ю€€€€€ююью€ыь€€€€€€ююю€€ю€€€€€ю€€€€€€€€€л≠МЖА|{{{|}|z{{yБІ—џ™o\]\]^_befkooppswy{z{|{z|{{}}|}{}ББГГЕДДЗЖДДЖЕДГЕЖЖВВЕВГББАБААА}z||||zzxvvtpmmnnlkjfikfdhijjikjhijklmmkjjiigfggcab`^]\]]^aaabffgjhjoomkiijkkjkkjihkljjhijiffd]RP]yУЭ£±»гы€€€€€€€€€€ьъэ€эю€€€€€€ьь€€€€ыь€€€ыь€€€€€€€€€€€ышэ€ыь€€€€€ыь€ыь€€€€€€€ыэыь€€€€€€€€€€€€€€€€юыь€€€€€€€€€€€€€€ю€€ьшь€€€€€€€€ющэ€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€з©sh{ІџзЉЩПЙГ~uplkfY`Ю—зхщшщью€€€€€щь€€€€ээьюьэ€€€€€€ью€€€€€€€€€ыээю€эюью€€€€ью€€€€ыъ€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€юю€€€эыт№Њ°УНЗvsnga\WVRMICAN\ZUUUSF;40,(&$# 7^fkzЛЄллƒ≠І•§§ЯФЙБ{rc_^VOD=:78;9425884465212110//0.,/0/21012559@KT\a_aec\YXRHPI75764220..,+,**+-.+'')))240/../.,./-,---158gў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“|cpЗµем√ЮЩЬЦМvpbf¶о€€€€€€€юэ€ю€€€€€€€эыю€ю€€эю€ю€юю€€€эю€ююю€ю€юю€€€юэ€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€ю€€юю€ююююю€€ю€€юэю€€€€€€€€€€€€€€€€€€€€€€€ю€€ююээ€юэю€€€€€ю€€€€ю€ю€ююю€€€€€€€йЂМЕА{||{{}|||{БІ—ў®p^^^^^`cfjmmkoqsvy{{|{{||z{}~~|z||}АГГГГГГВГГВВДЕЖВБВББВААББАА~{||{zyxxvtqmlmnomkjgfhecdhjhijihgilkkjjkhihdeddc`^^]]\\]^``bccfhhgjlkkloljlkikmljiikljihihgd^UN[yФ†§і”ехю€€€€€€€€€€эью€€€ьщэ€€€юю€€€€юю€€€юю€€€€€€€€€€€€ю€ышэ€€€€€ыь€€€€€€€€€ышэ€€€€€€€€€€€€ыь€€€€ыэ€€€€€€€€€€€€€юэъььщю€€€€€€€€€эыю€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чіqgv¶азЇХЙЖГxnklh\^Щ”яЁџмъччэ€€€€€ю€€€€€юю€€€€юю€юю€€€€€€€€€€€ью€€€ью€€€€эю€эю€€€ыыю€€€€€€ью€€ью€€€€€€€€€эыью€€€€ыю€€ыэ€юэи÷ЉЮТНД{vqlf^ZXRPNFI[]UUVVPE;2-)'%$!6^fmzОЇкл∆≠®¶І•†ЧМВzoa`_YRH@=88::75654432302641/./0/./0/1/1/2665?MUZ__`b`Z[XOHPJ<8656551..-,++++,-+)))'+24.-/...,--,-,--.2:kў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–{anЖґжкЅЭЫЬФЛuobg¶о€€€€€€€€€€€€€€€€€€ююю€€€€ю€€ьь€€€ьь€€€€€ю€€€юю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€юю€€€€€ю€€€€€€€эюю€€€€ю€€юьэ€€€€€€€€€€€€€€€€€€€€€€€эью€ю€€€€юэю€€€€ююээ€€€эюю€ю€€€€€€€лѓЛЕГА}}}{|}}|}Д©ќ„©p`]\^^_dhkkklmprvyxz{yy{|z|АА}{}}}|}~АБВББГГБВГВДЕЕДГБ~~}~АВГА}{{yxxywtrppmkjiknlfdddbbeihhihdchjkkkkhhkhcbbaa_]\\\\^`aa`cfeiliimllmnnmklkjilmkkjkmmkhghd]UQ`|Ц°™ї–йш€€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€ьь€ыь€€€ыь€€€€€€€€€€€€€€€€€€€ышэ€€€€€€€€€€€€€€€€€€€€€€€€€€€юээьыыыцшю€€€€€€€€€€€€юыэюыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш≥rerҐяйЈТЗГАzpkkhZ\Ш“ЁЁтьюэщэ€€€€ьъэ€€€ьъъээээщэ€ьэ€€€€€€эыю€€€€€€€€€эю€€ьюэььюэю€€эю€€€€€эю€€юыю€€€€€€€эъшэ€€€€€юыю€ю€€€€жў–™ТРКwspj`ZXVRNKS_XTVURL?72-(&$$!8_jpzПЉкм«≥≠І¶£ЮШОБzqb_^ZVOB><:9::9532553316741/..0/0//21/1/3658@MV[_cdc^Y[XMGQK<:8665310.,+-,--*)***)&).000.///-,,,--..058267432110111/.//,-0120234:@MX]`acd]YZWOISL=;97882..-.,+*)***)(**((./..//.-..,+++,.369jЏ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–zbk~≠ай∆†УРМБysmbc†м€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€ээ€ээ€ю€юю€€€€юю€юю€€юю€€ююю€€€€€€€€€€€€юю€€ээ€€ээ€эююю€юэюььююю€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыщшы€€€€€€ю€€ю€€€юю€€€€€€€€€€€€з™ЖА~|}}{|}}~}yГ™–÷•jY\\\^_chgilmoqtuwyxxzyzywx}|}~|z{}~~}}~~}|Б~~БА~~~~~}АБАА}|}{z{z{yxvttrqyymhlkcee^]^^``_`eefedgggikigggdba`aba__^\[\\\[]cedilkmpnkljilnljijkllmmmoonmkd]UQbБЭІ≠ј№ц€€€€€€€€€€ьэ€ьэ€ээьэ€€€€€€€€€€€шщ€ъъ€€€ьэъы€ъь€щы€€€€€€€€€€€€€€€€€€€€€€€€€€ыэ€шъ€€€€€€€€€€€€€€€€€€€€€ьъэ€€ыы€€эъю€€€€€€€€€€€€€€€€€эью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сѓpesЬ№жѓМЕБВ~wqmkdW_Ь–жты€ьщэ€€€ьью€€€€€€€€€€€€€€€ььэьэюээъщъэ€€€€эюэююьэээ€юьэъъю€€€ьщыэюыь€€€€€юю€€€€юнеззжжду€ф№ћ∆¬ґ∞ѓІ°Ґ≠∞ђЮОЗИД|wpjhc^YV]aXX[WRG=92.+)&$$ 7^hoАСєкл«ѓ©®©¶°ЩМЕ~qd_^[XXVMC@>96889964213343100//00,,/1020/269ANWX\`aa\WXVLDPM><:77751-,..-+**+*+))'%(./-./--.--,--,,.039f’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—w^i{Іўи °СПЙБvtobbЮл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юэююээ€юю€€€юю€€€€€€€€€€юю€юю€€€эююю€ю€€ююю€ю€ээю€€ю€€ьэ€эью€€€юю€юю€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€ьыэыэ€€юю€юю€€ююю€юю€€€€€€€€€€€€з™ЗБ~|}}|{|}|~~yЕѓ‘Ў©mZ\]^^_begknoqqtvwxwx{zz{z{|{}||||}}}}~||~АА~~А~}АБА~ВДБ~~}||{||{ywtrqpqsnhhga_a`_``aa_afgfcbdhljihfedba``ca^]^^\[[]][]`cejmllonkmmlnoljiijjkmpppojfc]USaБЫІЃљўуыэ€€€€€€€€€эыээычщюэю€€€€€€ьэ€€ьчы€€€ьэыы€ю€ыь€ыь€€€€€€€€€€€€€€€€€€€€€€€€€€ьэьь€€€€€€€€€€€€€€€€€€€€€€€€€€€юьъьющы€€€€€€€€€€€€юююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€л©qfsЬџб©ИГБА~vpmkfZaЭ‘якшющы€€€€ьчщэю€€€€€€€€€€€€юыь€ьшэ€€эьыю€€€€€€€€€ьшчцъю€юьюээ€€€юыъющыээ€€€€€€€€э€и„№яя№„“ЌЉ§ТНМЕАГВААВНШ†ЦКГxpmife`Z[faVY[WMB=8/,+&#%$!7_il}СЇзи∆±™®®§ЭХЛД|pd_]YXYYSIA=:;;767520035551../10/-021.0.-379@KTWZ^`]ZXYWJCOL=9896420-*+,,,)*,+,('(&*---..,-,--,--,,/138d‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—v]j{£’йЋ°СОКВwtqdaЯо€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ю€€эььююэю€ююю€€€юю€€€€€€юю€€€юю€€€ю€юю€€€€€ээ€€€€€€ююю€эююю€€э€€юю€юю€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€ъщю€€€€ээ€€юю€€юю€€юю€€€€€€€€€€€з™ЗА~}~~{yz|}}}zЗ±÷№ђp[\\^_`cdhlmmqsrtwwvwzz{{{{z{{z|~~}|}~|{{}~~~~~Б~АББ~{АВ~~{z|{{yyxusrrrqmjhhfa`a_^^^`aabedceffgiigfeeeb`^\]_]\\]]ZZ]]]]_aglmmnnmmnnmnmlmllkjkmtsmkg`]VQ]Э©∞њёхььэ€€€€€€€ьэ€эю€юъэ€€€€€€€€€ъь€€юэюэъъшьюю€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щыьь€€ю€€€€€€€€€€€€€€€€€€€€€€ьэ€эь€€€€€юэю€юээю€эюээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€и§nduҐаб©З}}}yqkjfZb†÷яЏдщ€€€€€ьыыыыщь€€юэ€€€€€€€ьъю€эыю€€€€€€€€€€€€€ьъщчшцшю€€€€юю€€€юъыююююю€€€€€€юыютаЁ№’ЋљЂЪРООКЗЕЕЙОУВX7;s±∆їЫГ{ytmgec]_g^WYYUMD94/,($##!! 8_hl|РЈей≈Ѓ®І©¶ЮТЖБ{rd]\ZYZYWOD=;:98994345543531110.0121000--26=DJRXZ\^]XVYVJENI;879851.-++,+,*,-+,+*('+/1..-++)),,+,---/38b”€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–w^j{†’кЋЯПРКБytpcaЮм€€€€€€€€€€€€€€€€€€€юю€€€€юю€€€€€€юю€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€ю€э€юююю€эью€€€€€€€€€юююю€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€юю€€ю€юю€€эээюю€€€€€€€€€€€€з©ЗВ~}~||}~~~{{{ЗЃ‘№≠p\[\^^befhkkmpsqsuuuuwyzyy{{|zyz|z{|}}{{||}}|}}}Б~}АА~}|АА|z}{||yxxxwspnoommlifb_a`[[]\_a`bdb`dghigfgfffhf`][[]]Z[][\]\[]_`beimllllmmkklllnlkkklmrohgc]WR\yЩ™±Њ№ь€ю€€€€€€€€€эю€€€€€€€€€€€€€€€€юю€€€€€ыьъы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьщэ€€€€ьщэ€щчэ€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€юьъьюэъщю€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€з†jgwЭ№я™КВ}{{xqlkfYc£÷ёё÷о€€€€€€€€юьыъэюшцэ€€юю€€€€€€€€€€€€€€€€юэю€€€ышюю€ыы€€€€€юьюэюьъю€€€€€€€€€€€ьйждЏ—є§ЫХСПРШ††ЫХСЦЪЮТj8-i±ћњЕKARdwГЕ}ski`\][ZRF:2.+(''$" 8_hmzТЉзй≈Ђ¶¶•ҐЮУЕ|td]YWWXYXRH@=869:7535520023432//131/111/,/5;CKSXY[^\WVWVKANL=;;=:520-+,++,,.-)(*)%&*22.-..,*)+,,,,--,/6c‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“y^k|ЬќйЋЪЛНИwtnc`Цз€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€юю€€€€€эю€€€€€юю€ю€юю€€€€€€€€€€€€€€€€юьээээю€юю€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьъэ€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€е¶ЗГ~}z{}~|z{{ДЂ–ўђo[\[[\_cdfjknnnqtvtsttuwyyxyyyywwx{{{zy{|||{{{|~}{{||}~||}|xy{zzxvuxyurrnjjlmmlf`__]ZYZ^a^[_ca`dijedhgghijbZ[\Z[\ZYZYYY\[\^dcaiolhiknkklkllllkkkjmoidd^UPZ{Ь®∞њЁщ€ьыэ€€ьэ€€ьэ€€€€€€€ьэ€€ьэ€€€€€€€€€€€€€€ьщщэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьь€€€€€€€€ьъщэю€€€€€€€€€€€€€€€€€€€€€ьь€€€юю€ээ€ээ€ээ€€€€€€ыы€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€и°jfvЩ’÷ІОВ}}upkieZb†„бёџн€€€ьь€€€€€ьэ€ьыъэ€юььэ€€€€€€€€€€€€€€€эщэ€€€€юэ€€юю€€€€€эъьэьью€€€€€€€€€€€э€рўћ≥ЮУРФЩЯ°•Ђѓ≤∞•ЩЪЫЩЧЛq`pШЈ≠e!)G~®©ЭЦРЖzx{|wl_RD4*(+("! 9ako|РЇии∆≤Ђ§£†ЬФЙБ~vd\YTUWXWUOG?98975533210/012332000/0311.+.37@JSXYZYZXUVVJ?NM=9:;982/+*+,,.,)*+)&('&*11.-...,+++++,,+-06b—€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘x\jzЫћећЫКНЕ}xupd^Фз€€€€€€€€€€€€€€€€€€юю€€€€€€€€эю€€€€€€€ю€юю€€€€юю€€€€€€€€€€€€€юю€€€€юю€€ю€юю€€ю€юю€€€€€€€€€€€юю€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэюю€€€€€юююю€€юю€€€€€€€€€€€€€€€€€кЂЙД~|{}}~~}|}}Е≠“Ў™mY[Z[\_cdgijlmorsuuqsvwvxwwwwxzyxyzyzyy{{||{||||{z||{z{{{z{zwxxxxuutuurrqonlmmkiea^]][ZY\_`_accghhhefiihgjj`XXXY[ZZ[YWXXZ[Z_ddelmmkkllkklmlllmmljiqtg_]WPWwЬ≠±ЊЁы€эыыэ€€ээ€€ээ€€€€€€€эю€€эыъэ€€€€€€€€€ьъюьыыь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьщэ€€€€€€€€ьэъцэ€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€юю€€€€€€€€€€юэ€€€€€€€€ээ€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€ьь€€€€€€€€€€€й†kftХ–Ў©МВ|~~xpjjeYcЬж€€€ыэээьь€€€€эыэюю€€€€ьююыээю€ээю€€€€€€€юююю€€юю€€€€€€€€€€€€юю€юю€€€€€€€€€€€€€щ“іЭПМУШЬ°£•¶І©Ѓ≤∞•ЯЮЪФОД{zДЬЫb,9J?UКЂі∞Ѓ™°†ЭВechmqpeQ<+# "!=cjmzРЊлл»≥≠®¶£ЯЦКДrc\[WUVXWWXOC=;:756774320111451//002310-+.29AHRX[\Z\[UVTJCPM<;=;::3-+,++,.,)*++())(+00..----+,..-+--/16a–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘xZguЪќг«ЯПНЗyvqe_Уж€€€€€€€€€€€€€€€€€юю€€€€€€€€€ээ€€€€€€€€€юю€€€€€юэ€€€€€€€€€€€€€€€€€€€€€юю€€€€€юю€€юэю€€€€€€€€€€€€€€€€€юююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юшъ€€€€€юю€юю€€€€€юю€€€€€€€€€€€€€€й≠ИВБ~||~}|{{|}{ЖЃ”ЎІjY\]]\]begiklnpqruurswwuvwyxxyy{zwuw{|zz{{zz|zyz||z{{yzyz{xyxzxvxwutsssrpnopmhdee`]^][ZZ[_``chiklmljlmnjgjha\WVXZZXWWUVX[ZY^abimlmmpomlmmlllmmlllmvwg[XOVuЩЃ≤љ÷ц€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€ьь€€€€ючцэю€ю€€€€€€€ьь€€€€€€ьь€€€€€€€€€€€€€€ьщэ€€€€€ьь€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€ьэ€€€€€€€€€€€€€€эю€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иЭiftЩ÷ў¶И|}}woigcYdЭй€щъ€€€ьь€€€€€€€эъщэ€юю€€€€ыъэыъыьэъы€юююыь€ью€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЏЈЭФПСХЬЬЬЯЯЮЯ°°°¶Ђђ™®¶ҐЪРОКЖГ}pi}НЙ¶¶•Ѓ∞Ђ≠ѓЖC$$(2;H\mn]D/%" ?eko}УЅнм…≥∞Ѓ™°ЭЧКДqe_\VVXXYZZUI>;:88656653320131/033/1211.*,2:@FOW[_`]ZXVTKDMJ>==><82..,*)),/-++*()(%)00--/.**-.-,,-,-.15_ѕ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”vYetЩЌв∆†ТМЗАxvpd^Сг€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€юю€€€€€€€€€юю€€€€€€€юю€€€€€€€€€юю€€€€ю€€ю€€юююю€€юююю€€€€€€€€юю€€€€€€юэ€€ююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эыю€€€€€юю€юю€€€€€€€€€€€€€€€€€€€€€зђЗВА~}}|zyyz|||Зђ–‘°hZ[]]\]chgijnpootwttvvttvxxwxzyxyvuuwz{{|zyyyyyy{|zyyx{yxzwvwz|ywxwxwsttrnknkhffa]__`^ZYY]_^djkklnomknpkghhd_ZUUXZXVVUUVXZ[\^cjnnnorroomlkjknomlmnqmcYRSqШ≠іљ“рью€€€€€€€€€€€€€€€€€€€€эъэ€€€ьэ€€€юю€€€€€эь€€€€€€€€€€€€€€€€ьь€ьь€€€€€€фц€€€€€€€щщ€€€€€€€€€ьь€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щщ€€€€€€€€€€€€€€€ээ€€€ыщю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зЬheuЭ№№¶ЗВБ~|xpkg`Xg§м€€ьщэ€€€€€ьь€€€ьюэээъэ€€юьы€юъю€€ъшщььэюьэьыюю€€€€€€€€€€€€€€€€€€€€ыь€€€€€€€т¬ЮМСШЪЪЫЭЬЭ†ЮЭЮЯ†ЬЮҐ¶™Ђђ©®§ҐЭРДДОТЗwxЧѓ§ШЯ•®іЯN$6K]leK2#"@cjo~СЉлиƒ∞ђ™™•ЯЦЛГ}tf`[TUWWZ[ZYOB=<:855575352/0./11430/001/*+29>ENSX]^[ZYXSHBNK=:;><83/.+**)..,+)()))'(/0/0/,,-,,-,,++,..5c–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€’xYcrՎ⫆ПКЙАvsod^Ог€€€€€€€€€€€€€ю€юю€€юю€€€€€€€€€€юю€€€юю€ю€€ю€€€€€€юью€€€€€€€€€юю€€€€€€€€€юэ€€ээ€ю€€ююю€€€€€€€€€€€€€€ю€€€€€ююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€еІИЕБ~}|zzyy||{{ЙЃѕ—Яh[]\]^_ehhghlooptwvuvvttvxwuvwxxyywttvy}}wuxvwwvvxywvwzyyzwvxyywyywwvsrtsnjjjifdcaba^][ZY\]\fjiosomonpppmmmib^ZSVXWWVUTUXY\\]flonmoqpnmlopnnqusqmfca[SRkХ≠µљ–нэ€€€€€€€€€€€€€€€€€ьэ€€€юью€ьээю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щщ€€€€€€€€€€€€€€€ьь€€€юыь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€ээ€€€юью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зЫgguЮёё¶ЕБВ~upmid[n¬ю€€ьъыыэ€€€€€€€€€€€€€€€€€ьэ€€€€€юыы€эщэ€€€ээ€€эээю€€€€€€€€ээ€€€€€€ющъю€€€€€м≤УТФЪЮЯЮЮЮЭЯЯЯ†ЮЯЯЬЭ†°Ґ§§•І©§ЩУЩЧБgQNeМ°†ЬЮ©ѓ™p' "+?[miN- &B`ipСєие¬≤≠™ЂІЯФКД~vg_]WUVVX[ZXVL@<=86668736622003101//10/.,-3:>GOSVZ[ZYXXSE@OK;:<::92--+,*+.+**(()+($(.0-/-++++-,+,+*+/05aЌ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎzYbpУ б…•ТРЛВxrne`Рд€€€€€€€€€€€€€ю€€ю€€ю€€€€€€€€€€€€€€ээюю€€€€€юю€€ю€€€€€€€€€€€€€€€€€€€€€€юю€ю€€эю€ю€эь€€€€€€€€€€€€€юю€€€€€€€€эю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€эюээюююю€€€€юю€€€€€€€€€€€€дІИЕВ}||zyxzzyyzИ≠ќѕЬf[^]]`bceeghjmopruvvvtuvuwwuuvvwxwutuvxzywuvwvuttvvwvwwwxwvvvxvwzxwwtqssqojkjhededb`_\ZZ[\^begjorplmqstxvkgkc_`YVWUVVUTTWXYZ_gknponpqooqrttppwwria^ZTSfЛ©іљ÷рюээ€€€€€€€€€€€€€€€€эю€€€€€€€ъы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьъэ€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иЪedsЫџџҐВ~АА}umkkf[w≈ы€€€ьь€€€€€€€€€€€€€€€€юю€€€ю€€ыыыщю€юыьэьэ€€€€€эщэ€эю€€€€€юэююыь€€юээю€ю€ъ÷≠ТЦЫЭЭЭЯЯЮЮЯЮЯ†ЯЮЯ†Я††°°ЯЯ°°°ЭЬЮПpN7.9QpО°І©≠®О[0':WldD,(Baho~РЇки≈±ЂђЂ•ЯЦНДufa^WUUVWXXYZTF??957876467322131-///11//,-3:?FNTY]]\ZXYUE?ML<<<9782--,++-+*)&(+**)&(/0-+--,,--+,*(+-.06`Ќ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎyV`nС«б–ЂЦУЛГzsmd^Пв€€€€€€€€€€€€€ээ€€€€юю€€€€€€€€€€€ээю€€ю€€юю€€€€юю€ээ€€€€€€ю€€ю€€€ю€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€юю€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ююю€€юю€€€€€€€€€€€€€€€€€€б•ЖГ}}|{zywwwwxЗ≠ћќЪdZ^]]_adghiiknpqrtttutvwuvvvwwvuvuttvyxwuwvstuuutsvwvvwwutuvuuuuwxwvutspollmkkigeedb`^\[]_aadilllnnnnowxtomqicc[VVUTUSSTVWW[bhmruussqnqurssoopomd]]XRcЗ§±ї‘х€€ьь€€€€€€€€€€€€€€€€€€€€ьэ€€€юю€€€€€€€€€€€€€€€€€€€€€€€€эь€€€€€ьь€€€эщэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зЪfetШ’ЎҐДБ{yurnicYlЈч€€€€ьь€€€€€ьью€€юю€€юыь€€ьыю€ычь€€юээыъщэюю€€€ьыюъчэ€€€€€юыэыцы€€€€€€ю€мЅЭПЦЬЯЮЬЬЮЮЭЬЮЭЮ°†Ю††°°†°ҐҐ†ЮЬ°§ЦzbZUNNS]hzСЭЯЬФЗwfTJB>:<=81' "&,Cfr]AHdkn|Пєйз«Ј∞©®£ЭШПЕ}rc_^WUVWWVXZZXOC=:88776554212330/021/22/+,19?EPW[]]][XZWH@NL=;;9653/--+,-+,*),,*'&&(/1.--,+,--+,,+,,-/2\ћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€„yU^lО∆б–™ТРЛВysmb`Сг€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€юю€€€€ю€€ю€€€€€€€ээ€ьь€€€€юю€€€€€€€€юю€€юю€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€юю€€€€€юю€€€€€€€€€€г•ЗВ|{|}|zwvwxxИ≠ќѕЪcZ]\]^`ehihjmooqsutstuvvvvuwxwwustvtvxvvuuurrvxvstvvuuwwuuvvuvvvwyyvtuusroommlhecba^^__]\_`^flknqqoprstw|ztqnf]VTRSUUSQQSVX\bgmvx{}xussqopqprojf_WWT_Д£≤Љћп€€€€€€€€€€€€€€€€€€€€€€€€€ышэ€€€€€€€€€€€€€€€€€€€€€€€€€€€ющэ€€€€€€€€ьь€€€€€€€€€€ьь€€€ьь€€€€€€€€€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иЫhesЯў“ЮГББ|wrkgaYd§о€€€€€€€€€€€€ьь€€ьь€€ъъ€€юьъэ€€ььэээъэюэьююю€€€эю€шцю€юю€€эь€ышь€эью€€€еђФЧШЩЬЮЮЭЬЭЭЬЭЮЮЭЬЯ††††Ю†°°†ЬЩҐ†ЖgZ^dhmtz~ЕМУХОЕ|z|yqjfa_`^YUOG@=<98E`sj`ejp}РЇйи√≤≥≠ђ®°ЩПГ{qc^^WVXZYWZ\[ZTG=;976764542212312012012.++09?GPVZZY[ZVYUFANK=;99;93/,,+-.+,,*++(('#&/0.-..,+,-++,,++-.3`ќ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷wW^lР∆г”ђФРЛГwsnb_Фе€€€€€€€€€€€€€€€юю€€€€€€€€юю€€юэюююэь€€эю€€€€юю€€€€€€€ю€€ю€€€€€юю€€€юю€€€юю€€ююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€ююююю€€€€€юю€€€ю€€ю€€€€€€€€б†ЕГА~}|{zyxwxz|КЃѕ–ЪcZ\[[]`cdffhlmknruutrtstxxuuvuvwuuuvyvssttsrruvttuvvttuvvttustux|zvuvtsutrnmnlgec_]\\\^___]]emmmnputrqrz}uljkfXSRQSRPOQQRVWX_howzЖБzywrppqrrme`YRP[£∞Є…аш€€€эыэ€€€€€€€€€€€€€€€€€€€юьюэцъ€€€€€€€€€€€€€€€€€€€€€ьь€щш€€€€€€€€€ьь€€€€€ьь€€€€эщэ€€эъъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жЧfftЮ№‘Ъ~}Б{vnki`Yh¶о€€€€€€€€€€€€€€€€€€€€ээ€€эъю€юю€€€€€ээээ€€€€€€€юэюэью€юю€€€€€юэю€эью€ъўЂСХЮЭЬЮЯЭЭЭЬЬЭЮЭЭЮЫЬЮЮЭЭЯ†°ЭШЫ°Фt^Z`mux|БЗНУШСИБ{xvwwurnkiihc_][XWTUSQT\dlmjqТїиз≈∞ђ≠≠©ҐЧНЖ~qd^[WWWVVXZZ[[XL@=99:8558664//134211110.*,28@HNSWZY\YVZTGAKH<<:;=:2-,,-..+)*+++*)'$'.0/----++,++-,*+,.5bѕ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎyU[nОја‘ЃЦЦОБvrod_Пв€€€€€€€ю№№€€€€€юю€ю€€€€€юю€€€€€юьэю€€€€€€€€ээ€€юю€€€€юю€ю€ю€юю€€€€ююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€юююю€€ю€€юю€€€€€€€€€€€€€€€аЮЖГ}}|{}|xxvux|ТЇ‘—ЪbZZZ[\]bdffhkkjortutrqsuxwuttsvvuvuxxusstsrqqttsstuttuuttstuttuxzywuuuvusppmlljhea__^]]``__`hopoquvonvvuvuqtvfVRRTTSRNNQSTSV\gs|ВЕЗГ|{zzxsqsof`\UNVwЮ∞ґ–ирь€€€эыэ€€€€€€€€€€€€€€эъэ€€€€€юыь€€€€€€€€€€€€€€€€€€€€€юэщью€€€€ьь€€эщэ€€€€€€€€€€€€€€€€€ьь€€€€€€€€€€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жЩgesЬ„ЌЦ}||wtmjibZi™п€€€ээ€€€€€€€€€юю€ю€€€€юю€€€€ьь€€€€€ьь€€€€€€€€€юыююыь€€€€€€юэ€€€€€€€ч»†УШЭ†ЬЭЯЯЭЬЭЭЫЫЫЪЪЬЩЩЭЭЫЬЮ†ЫЦЭҐОl]^ftАЕЖЗНУФШЬЧТПЙЗЕ|{xsrrrpmlkgedbbcb__^fontАУљкл»∞Ђђ®•°ЦИГ|qe]YWWWVVXWXZZ[TFA=97587455211124422200-)*18@HNTYZ\^YUXUI@JI=<;::93.-,.-++*),+)(('%*20,-/,)+*++*./+-.04\…€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№zQ\nЛЊя–ЂЦШПВxsqg_Ка€€€€€€€ьйо€€€€€€юю€€€€€€€€€€€€€эээююэ€€€€€€юю€€юю€ю€€€€€€юэ€€€€€€€эьюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€юю€€€€€€€€€€€€€€€€€я†ЕБ||yxБГxuuuwzУљ÷ћХa[[Z[]^bghhiiknrtutssttuustvustuuvvutuutsqoortsusqsqsuuutsuvtssuvwwvuvuonqpmlkkigeabcb`_```cinmnqspkpvts{В}tqbTRRQQSSNJPSRTW[crЙМЕБАА~~}vpni`\VOUtЩѓґЌх€ээ€€€€€€€€€€€€€€€€€ъъ€юъы€€€€€€€€€€€€€€€€€€€€€€ьь€€эъь€€ю€€€€€€€€€€€€€€€€эъъь€€€€€ьь€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зЪfdvЭ‘ћЧА|~}xsmheaYhµщ€€€эь€€€€€€€€€ььэь€€€€ьь€€€€€€€€€€€ээ€€€€€€€€юю€€юью€€€€€€юэ€€€€€€сјЬХЪЯ†°ЮЬЮЯЮЬЬЬЫЪЬЬЪЩЪЩЩЩЫЭЭЫЪЮЮЖg[alyДКРФЧЩЧЩ•∞≤∞ЃЂ®ҐЮЩСНЖА~{vvwusqqpqpoomnrsosАУЉлк…іѓ©¶¶†ЧЙ~zqc]ZWXWVXXVX[[\XNE>;9589233145113624401/(&.7?FMUZY\^[VVTG?KK=;89:93/,*+,***,,+*()'$*1/,-.,,,)*,,-,+./04Z«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№yQ]lЙјб–ЂШЪСВytqe[Ка€€€€€эююэю€€€€€€€€€€€€€€€€€€€€€€€юю€€юю€€€юю€€€юю€€€€€€€€€€€эю€ю€юю€ээ€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€юю€юю€€€€€€€€€€€€€€€€€€б†ГБ~|yxz}xuuuuwСљ“∆О]ZZYZ\`cdehihkprstutuuttutsvurqrtttrssrpopporqrrqpqpststttvuvutuwwvuvwwrorrmjjifefc_`b`]`a_bhnppotxw{|y}ГИГtlgWRQPONNLHMRQSU[cp|ДКЙЕЕГВД~wpfb^YQRnЦђ≥Ћф€€€€ээ€€€ээ€€€€€юэ€€€ьь€€юю€€€€€€€€€€€€€€€€€€€€€€юю€€€юю€€€€€€€€€€€€€€€€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жЦdcrЪ÷ќЦБ}zzzumgc`Yg≈€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€юю€€€€€€€€€€€ыы€€€€€€€€€€€€€€€€€эв≤ФЧЫЯ£°†ЯЭЭЬЭЭЭЬЬЭЬЫЪЩЩЩЩЩЭЮШЩ°Шz`\gr~ЖМТЩЮЯЯЯ•∞ЈЄЈєїЉЇЄґ≤∞™ҐЮЧОЛЗВБ~}~~zxyxyxsotБФЊйй»±ЃЂђ™ҐЦКВzqc\][[WVXXWZ\[ZZVJ?=;8797545<:2246532131)'.6>FMV\ZZ\[XXSF>KL=:89=;3-,+,,++,,+,+'''%(.20..,+-+++*+*++,03Y«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏxPYiЗЉЁѕЃЩЩРАwtpe]Йя€€€€юю€€€€€€€€ююю€€€€€€€€€€€€€€€€ээ€€юю€€€€€€€эыю€€юю€€€€€€€юю€эю€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€юю€€€€€€€€€€€€€€€€€€дҐДВ|zzwvvxwvtvСЇќјЗ[YZZ[\`bcdghikmpqrutuvtssttuttrqrrssssqooqqooopooponprrsqrvuuuuwwuvuuvusttpljhjjeddb__]Z\`dgkquqkntЕЕДЛРИГvliYQNNKJKJIMPRSTYcp}ГНУЛКЕ~Вzqia\YSRhТЃ≤…у€€€€€юь€€€ээ€€€€€щш€€€юыэ€эь€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еФfhtЪ” У|{|{ytnifbXe√€€€€€€€€€€€ьь€€€€юю€эщь€€€€€€€€€€ээ€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€лІНХЭ†Ґ§£ЯЭ†ЯЮЫЪЫЬЭЪЩШЪЬЫЫЫЪЫШЫҐХs^^n}ЕНТЦЭ£Ґ°££§®ђ™≠≤≥±µєєєЇЇЄЈЈ≤™£°ЯЧСОНММКЛНЖwouБХїжз∆µ∞ђЃ™°ЦКБwpe_abb^]\ZY[YYYYXQC>=::88986;94223542021**28=CKV\ZYZ[YWTH@NM<;:8<<2,,++-.,+*+**(%'((,11/-,,--++,+()*,36Z«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№yOXfЗЉЏќ≠ШЧНuqof^ИЁ€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€юю€€€€€€€юэюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€юю€€€€аЮГБ}z{zwvwxxwuvН±«їДZY[ZZ\_bdegikmnnrssstvvtrstvuuutqqrqprsqqppqpopqrrqononooossruuuttuutstrqsokmkhhfffeb][]\\aimptoklvГЕДИОНИИqhYPKEJPMGGJMPQRUaq|ЕМПККЗ|{tke^WSPbМђµ«с€€€€€ьь€€€€€€€€€€€щш€€€юью€юэ€€ющхы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€гСfiwЭ”«Р{{}|zumheaYf√€€€€€€ьь€€€€€€€€€ьь€ьэ€€€€€€€€€€€€€€юююю€€€€€€юю€€€ээ€€€€€€€€€€€йіФФЭ°£££§†ЭЯЯЯЫЩЪЬЬЪШШЫЪЪЭЪШШЭҐТq_cuЕНТЦЬҐ§§•••££§••¶І¶І®Ђѓѓѓ≤ґЈґµ≥µЈі±ѓЂІ•†ЪЦФМzpwГХЉиг√іѓЂ≠™°ФЙАypb`koonlhdb_Z[ZXVSH@?=<9:;97423455454121**18?DLUYZZZYXWSH@NM::;:;5.-+++,*))*+,+('*&(.1...,,-,++++**+-04W¬€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁzOWeДЇџѕ≠ШХИ{uqpf^ЖЁ€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€юю€€€€€€€€€€€€€€€€€€€Џ§МАzyzzxwwvwwuwР∞√ЇГZZ[[[Z^bcfijjlmorrrqruusruuvwusrrssqsssrsqqrqprsspqqpmloqprsrttrttvvuusqooojlmjifb_bc`^^`[\cgkkjnptДЖПХСПРЖtbUPKHGGHFDILJMSV_n|ВЗЗЗЙД{vngaYRO[Д®іјо€€€€€юцуь€€€€€€€€€€юэ€эьюэюъэ€€€€эхц€€€€€€€€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€сёт€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€еСcft°÷ƒР~{{||sjhhc[gљ€€€€€€€ьь€ьь€€€€€€€€€€€€€€€€€€юэ€€€€ээээ€€€€€€ьь€€€ээ€€€€€€€€€€мЃСЪЯ£•§£££ҐЯЯЯЮЭЪЪЫЫЩЩЪЫЫЫЭЫХЬҐОj[h{ЙУЩЬ°•І•§¶®І•І¶І••¶••£•І•¶©©®І®ђ±≥≥ґЄЄєґ≥≤±≠ЭouБФЇжд√≥ЂЂ∞©ЮФИwl_c}ЛЛЙЕА}ysmjgda]WSPKGCDDA=:6488667443/()/7?GOTXYXYXVUTIALK=;:993/.*))*++**,,,*)*%(010/...--,+*++*+.02W¬€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ё{PXeВЇ№ЌЂУРГwsrmc[Ж№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€ађРzzwwyxvwvwwyФЈ«їВYYYZZZ\acgihjlloqprrsrrrtuvussqqqprrsrqqrrrroprrpnmnoooqrqrsqrqstttsssqonnmmmnlkha^]\__^_[]bafjiottyВКХЩШФНЕvdSOLDDDCEDEILNSW`ku~~ГГzsqi_\UNWzҐ≤їё€€€€€€юыух€€€€€€€€€€€€€ээюэюью€€€€€эь€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€л“п€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еСces†Ў…Т~{xzyrlgfc\hЅ€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€ъщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЈУШ†§¶¶£§•§°†ЮЮЭЭЮЭЫЪЩЪЩЪЭЫЪЩЫЮИdWfМФЪЯ§™Ђ™®¶І™™©ђ™©І¶©©¶•ІІ¶¶•§§££••¶®™™ђѓѓ±ЈєЄІВms~ТЇед¬ѓ™©≠ІЭХЙysj]lЧ≠Ђђ©£ЭЧФСЛЗБ{vqnke`\ZVPMKGABA=<97641*(/8@GOTXZZYXVWUIAKL>778951-+*)+,,**+))++*&'.21/,-.-++-,*+++-.2Vњ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бАQWdБЈ№ћ¶ОКupok`[Еџ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€я†А}{ywwxwwutvvyЦљЌЉД[XYXX[]`bdhhijkmopprrppqrttsqoprqnpoqroopqqoqqpqqpnnnqqqppoooqqstqqusqqpnmmnplhghe_\Z]_^_^^^`fihlrwyАИПХЪШТЙwk\LGCBEEDDEHNPQV]irtsuyxoljb\XRTtЭ±Є”ц€€€юьъыырсэю€€€€€€юьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€ыць€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гОcfsЭ”∆С|{|{xrlifbZjЅ€€€€€€€€€€€€€€€юю€€€€€€€€€€юююьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЈЧЪЯҐ•ІІ§§•§Ґ†ЮЫЫЬЭЭЫЩЪЫШЦЩЩЦЩЯКbTgВСЧЪЮІЃђ©©©™Ђ≠™®™™®•І™©¶®™®®®І®®¶І¶••§••§•І¶©™≠Я~mr}Тїжвј∞ђ™≠™ЯХЖ{tj^iМЮ†©Ђ™Ђ©™ЂЂ©£ЭЧЦЦФСКБ{wqmke]YVQKGFB?>959>CKQTV[]ZXVYWIAKK;566861-*),,*))+*''**('(/21022/,--+*+,,+,.2Tј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гЖRWeВЈџЌ¶МЗxrnkb\Дџ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€ю€ю€€€€€€€€€€€€€€€€€€€яЭ~}zwwxxxwututxШЉћЊД\YZYY\a`adffhkjkopooppprrrrsqnpqqpqqrrnnnnnnrsoorqqononnoommnoprrqstrrpoljjkmljffe\[^\Z]^^aehkliilu|~ЗМПУХХПykdQDABAEE@@EKOTX\cmpmpsqjidZWRRmЧѓµЋт€€€€ыщщщхлущы€€€€€€ъхь€€€€€€€€€€€€€€€€ыъ€€€ээ€€€€юю€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дН`crЮ“¬Р}||{wsnifaYi√€€€€€€€€€€€€€€€ьь€€€€€€€€€€ььээ€€€€€юю€€€€€€€€€€€€€€€€€€€€€€чЅЫЫ°£¶¶ІІ¶£§£Ґ†ЮЬЭЬЩЪЪЩЩЩЩЧШХЧ°ТdTgБРЧЭ°©ЃЃЂђЂ®І®≠ђЂ™™І¶®ЂЂ™™™™®®®™™©®¶¶®ІІІ¶І®•§§ІЬ~qu}СљивњЃ™ІЂ™ЯУЙ~th^gЖФУЧШЦШЪЭҐ¶І™Ђ™™Ѓ≤ґ≥Ђ£ЯЪЧЧФЛГ~voje^XVTONRX\_`ada[XVYXJ@JM:897542..,,-+)*++,+*))',242:P]ZG2,.,+)),-.2TЊ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вВPVeБµЏ—ЂНИВxqmkc[Е№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€юю€ю€€юю€€€€€€€€€€€€€€€€€€€№ЬА~xwwwwwvttuvyЩљѕ¬ГZ[ZZY\`cddddfkjjnqropppttqqqnpprqopqqommnooorsolpqpprpmnlkmnnoprqonoqpljjifegqsg`_]]`]Z]]]^cklllhkx~ГКОТХЦСЗykcTB?BDEECADKPV[\_ejjmokgd]TPRhУ∞ґ…с€€€€€ээ€€эшъьэээюэ€эшць€€€€€€€€€€€€€€€€эь€€€€ю€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вЛcgw¶„√Р}{|yvsmhfd[k≈€€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€ш»ЮЭ†£І©¶¶І¶§£§ҐЯЮЭЭЬЩЩЩЩШЩЪЫШЦЬЪsWfОХЬ£®ђ≠Ђ™Ђђ•ЮІ≤±ЃЂђ™™ЂЃЃђЂђЂЂ™©™ђђЂ©©™™©Ђ©ІІІ¶®™ЮАpu~СљибЊ∞∞Ђ™§ЯЧК~uj`hЛЬЫЫЬЬЫЩЩЫШХЦЩЪЪЫҐ®ѓ±™®®ђґЇіЃ©£ҐЬФНЖБ|tnmnnt{ЕНЖp`[YWLFNN<:<9651//-+,-+*,++,+*)&+13:XУ≥ѓДJ.,+)))*,-1TЇ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вБQWb~ґџЌ≠СЙБvnnl`ZИЁ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ээ€€€€€€юююююююю€€€€€€€€€€€€€€€€€€€аЪБwvvvxvuwtstzЫЊѕƒЖZ[[YX[_cbbfgghiknrspoqrttqpqoqqrsoprrnonnopoprpnoqsqpppolklmorpnonlnomklliegjnog`\Z\^]ZZ]^]^ekhhilwЖПОРЩЭТКЖyaNAADDBDEEGMRY]^\`dglmgc^YRL]КЃґ∆р€€€€€€€€юэ€€€€€эьюэ€эьыы€€€€€€€€€€€€юь€€€€€€ыщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еПdi{Ѓб»С}|{{xpjggc^q√€€€€€ю€€эь€€€€€€€€€€€€€€€€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€щ”ҐЬ°§•¶®®І¶•££ҐҐЯЭЫЪЩШЩЩЩЩЩЩЧХЬЪyZfБРХЪ§ЂЂІ™≠ђђђІІѓ≤±≠Ђ≠≠Ѓ≠ѓЃђ≠ѓЂђђ™ђЃ≠≠ђђђЂђЂ©©©™≠≠™ЮАmr~УїеёЇ≤ЄЈѓ¶ЯЩЛ}ul`kР£Ґ†ЯЯЮ††ЯЬЩХХЦУССТЧЩШШЪЮ®ђ≠ЃЂђі≥∞ѓѓ≠©•ЮЦИ||ЕЧђЈЂПyk_YWSOD@@<;7510.,,,-*+++++,-(+42=vЇ№ў≠g4,-,*++,-1UЉ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дЗRVbЈ№ ®ТЙ~snnl`YЕџ€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€ююэ€€€€€€€€€€€€€€€€€€€€€№ЩБ~zywxvuuwvtsyШїќ…КZZ[ZZ[_baaghhiimpqromprsspprrqqpsqqrrpqpnmnnnnonooqpnppplknnnoomnllnkjjjkhehmpib\\^^\[[YY[]\cheacmszКСОТЬЯХССzZKA@DCADBEKOT[]]\_abeih`WVOV~©ґ≈н€€€€€€€€€ыъ€€€€€€€€€€€€юэ€€€€€€€€€€€€эы€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дНcgvІџ√Н|{~}xrmihd^o√€€€€€€€€эы€€€€€€€€ю€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€е©Ъ†®®©ІІ™®І¶£Ґ††ЯЬЪЦЦЩЬЬЬЫЩЦФЫЬ}X]}СЩЬ°™Ѓ™ІЂ∞ѓѓЃЃђ≠±≤ѓ≠Ѓ≠ѓ≥≥∞∞∞ѓ≠ђ≠ѓ≠ђђђЃѓЂ©≠∞ђЂ≠≠∞ЃђЯБor}РїзЁєЃЃЂ≠®°ШЛ~wm`jС•££§§Ґ°ЯЭЮЬЪЫЩХУТФУСХТООТТТЦШЫ†°£©≠Ѓ∞≥≥≠£ЧМКОЮ≥јљ≤°Йvlb[XVSNIEE@;74110-,-,,*)**,24C{ї÷“≠l800/,,---/Tї€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дДOVcАіЎ…¶ТЛ~smml`XВў€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыь€€€€ю€€юю€€€ю€€€€€€€€€€€€€€€€€џЪА{|zxwuuutvxuwШїЌ…КYYZ]]]_aabehikjmopqnoqpqrpprsrpnrqponpnnonmmlloonnmmnmonlkmnmkmmmlijjighjhdjuwj]WZZYY[ZXVX]]\_ccaiij|ЙИНЧЫУЙ{dXOEDDCCBEFFPX]_^^_b_`gf[TQVu†іЅк€€€€€€€€€€ээюыэ€€€€€€€€€€€€€€€€€€€€€€€эъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гКbet£ЎЅЛ|}~yvrnkie^o≈€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чњЫЫ§™Ђ™™™©ІІ¶£°ЯЯЮЬЫЧЧЧЪЫЬЪЧСЦЮДZVtМХЬҐ©≠©©™ЂЃ≠ѓ∞±≤≤≤±±±ѓ±µ≥±≥µµ±±≥≠≠±і±∞∞±Ѓђѓѓѓѓ≠≠≠ђђЮ~nt}РЇзяїЂ•¶ЂІЯХЗxj]jТ®¶¶І®І¶£†°ЭЬЬШУТЦШТТХУОНРСМНПРСПУЦЦШЩЭЬЪЬЭЪЧПМТЯѓљ√їЂШЕxrsxypf`ZYYZ]_^_`_[OC91),37Arє„ЌҐa8//,)+-+,4WЅ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дВNUc~∞„ ®ХОАtmmkaY}÷€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€юыы€€€юэю€€ю€€€€€€€€€€€€€€€€€€€€€ЁЪ~zzyvvvurstvsvЧє…√ЕYY[]\\^_bdeghkjjloomoqpqoopqrpnnpnlmmnmlnomllmnnmmlmllmkkkkklkjjlljjihfehjgl|ye]YWWXWYXVUWZ]\^cgd`aflyАЕЛЖzjWSPHIDADDCELX]]]^_adcgi_TPRmШ≤їа€€€€€€€€€€€€€юъь€€€€€€€€€эь€€€€€€€€€€€€эъю€€€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гЙ`fv•џƒЛ}}{{wrqoje]p∆€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щћ°Э°І™ЂЂЂ≠™І§£ҐҐ†ЯЫЩЪЪЧУЧШЫЩРХЭН`TlЕФЩЭ¶ѓђ®©ђЃ∞Ѓ∞µііі≥≥≥±∞≥≥ґµі±±≤≤≤ѓ±µµ∞±і≥≤∞∞±±≤∞ѓѓЃЂЮmr|СњйџЇ≠®ІЂІЮУЖ}uj_kТ®®®©®¶І©¶£°°ЯЮЩЧЧШФППСООРОМНЛМНОППНОПОООМНРТОКЗЗНЧ£Ђ±ѓІ°ШРТЬЭТИЗОРФЫЭЬЮ†ЭЩРЖ{lVHB>QК≈яЎ≥wA/--,**,-5d…€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жЖQVb}ѓЎћ¶ФНvpmi_X}÷€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ююэююю€ююю€€€€€€€€€€€€€€€€юаЬ}zyyvuttrsttryШЈ»њБY[ZZXY\^adgefkkjjlopnnponnnmonmpomklmmllmmkjlnnpomnnmnmklhjmljjjhhjkjgedehihkmd]\XUVWWWTVWW[\[[]\Y\elmptv~|rfYQKGLFABDHLT\]Y[^_adimhZQOcПђЈќф€€€€€€€€€юэ€€€€€€€€€€€€€€ээ€€€€€€€€€€€€юьэ€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дИ_hy¶ў√К|~zyvssqkf^pƒ€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыЏІЯ†•©≠ЂђЃђ©¶¶¶•£†ЭЬЪЩЫШЦШШЪЦФЯХiQgГТЪЯ§≠∞™Ђђ≠Ѓ∞≤≤±≤і≤≥і≤∞іµієЄµ≤і≥≤≤≥≤≤іі≥±±≤≤≥≥µі∞Ѓ≤≤≠†Аmr}РЉйЁЉ≤≠І©ІЮХЗztkakТ©©®ЂЃ©І™©•ҐЯЯЯЭЭЫЪЪЧХУТУСННОЛЙММКЙЙЙМНОРНЛПСПОМЛИЖЗМФЩЬҐ•Я†¶•§©Ѓ≠≠≤µµііЈґі∞ЂІ£ЩМ~pВЄЁгўƒЪV2-,,,+-.4_√€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зИRUa|±Ў»ІСЙ|uplhaY~÷€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ь÷Щ}yxutuvtrrutzЬї…њБZ[ZXXZ\^bedcehkljmpqnmnnonnmmoppommlllmnmljklmnmnpponloolijkmllkihihgghgcdggdfa\XXVTUVWWWTTWY[XXZXWY_befgro`ZTNHEFEDDDHQX[\]^_`dini_UO]Зђі¬и€€€€€юыъю€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юы€эъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дЙciv£„њЙ||yuoosof_t«€€€€€€€эь€€€€эы€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€тµ°†£®ЂЃ≠Ѓ∞≠™І®©•§†ЭЬЬЩЩЧЧШШЧУЪШqRaАТЩЭ£Ѓ∞ЃђЃЃЃѓ±≤≥≥іµ≥і≥≤≤ЈЈґЈЄЈµ≥іµµі≤ііі≥і≥≥≥±±≥≥±≥і≥≤°~jq|РЉияєЂ®ІІҐЬТДxtl_mЦ≠Ђ®™Ђ™©™©®•Ґ†ЯЯЮЮЭЬЮЭЪЪЪШЧФРПМММЛЗЕЗЙММОООТЦЦЦЦЧФТПРРСРТШЪ°®®©ѓі±±µґґґґЇєїљЄі≥±ѓ¶ЪЯњвл’Њ§nC71-),016Wљ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иКQUb{ѓЎ ђСЕ|tmih_X~’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€ь’ЧА~zxvwxxtqqrt{ЮјЌƒДXZZXX[[^bddcehjljlomlmnnnoopmnpnllmmlmlmmlklmmkjmqomnmnnllmklljiihhgedefcdmlfc`[WWVRTUUVVUSTXYWVXVVX]`^ad`_`_^RHEEGFGFKRXZ[^`^_fpm^UPX~Іє∆дэ€€€€юьшчэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€ъы€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дЛbftЯ’ЊЙ}}ytokjkhav…€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шЌ£Я•®Ђ≠ЃѓѓЃђ≠©І¶•§°ЮЭЬШЦЦЩШЦРШЫ{U]|ПШЬ°™ѓЃЂЂђѓ≥≤≥іґґЈЈЈЈµґЄЈЈґЄЇЈµµґµґєЄЈЈґґЄµ≤≤≤≤і±±ґґґµ°}kp|РЇиџі©І§•ҐЪМАywl^nЫЃЂ≠™™Ђ™©©©І•Ґ°ЯЮ†ЯЮЭЬЬЫЩЩЫЩХФТРСТОООНООНОНОПУШЫЫЪЪЬЭЪЪЫЩЫ°§©Ђђ∞∞ЃЃ∞∞∞≤ґЄєЇЉїЄµіЄЄ∞¶ЃћўћґЂ•КsZC2/.5?ZЉ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йМPVc{Ђ‘Ћ¶ОД}rljg`Y}‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€э’ХА}zxvwvuttsrs|ЫЉќ¬БYYZZZ[[_abeeehiikkkklnnnoooonmnmjlllmnmlmomnnlkkmmljklkmljlonmkhghijigfgbcihffbZWWUSTTSUWWWVYYUSSORUV[a`^\amk_PHJHGIJLTXWXY]^`dhneXRSu•Јƒи€€€юю€ыш€€€€€юэ€€€€€€€€€€€€€€€€€€€€юэюь€юэьэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дИafu†—ЇИ}|zvsojikh`v…€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыў¶Я°І™ђѓ∞∞Ѓђ™™©І§•§†ЭЭЪШЩЪЫЧТЦЯИZXxОШЫЯІ≠ђ©ЂЃђЂ∞≥≤ієЄЈЈЈєЄЈЈЈЄЈєЉєЄЄєЇєЇЈґґЈЄЈґґЄЄЈЈ≥≥ґЈґµ°}or}СЉиЏі¶•£°ЭЦЙАzxm_kЧѓ≠ѓђЂ≠ЂђЂђ™І§Ґ†°†ЯЯЭЫЪЪЫЩЫЪЪЪШЩЧЦФХХХЧХХФТПТХШЫЪЧЩЯЯЭЬ†§®Ђ™©Ђѓѓ≠≠ЃЂђ±ѓђЃ±≥і≥≤±ѓЈ»ќ–”Ёа‘њ∞©©Ђ¶УsU?BEGIIJNQUXbsГ¶Ћбф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьїaFNYЛ√ƒ°xjgba^^ZSXЯо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€ю€€ю€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€щ ЦztssppllklknqМ≥±љѓzVRUTRUXY[^^]_acbfheilklljkjgfgjkijghhhjhggihghhijhgefdccdcbddecbbcdaaaa__^ceccec__`a^]]]]^]_\\`b]\\[\^VQlҐЇќ€€€€ю€€€€€€€щэ€€€€ы€ыч€€щ€€€€€€€€э€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь≥pbnЛј Ш~zxyvolfl||oЭ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ•ПТЩЬЭ†°Я††ЮЭЭЂїЉЉј√ј¬њ¬¬ЅјЊјјЅњњЊјњЊїЉЊљЄЈєі≠¶¶Ю§ђ≤Є≤Ґ¶І£••ҐҐЯ†°££¶Ђ©Ѓ≥єЉЉљ¬ƒЊ≥¬–‘„„’—ќЋ ѕЌћќќѕќѕЌЌЌЋЌ…≈°tmrК≤Ћ„¬І§§•ҐЪПГ{rkag£д’ќиъычкў њїЇєґґґґ≥≠™Ђ©™ђЂђіЉљ¬ЅЅƒ«… Ќќ–’№дмсфшъъэъук№—ƒЄ≤©Ђ™®™®І≠™™©ІІ•¶••¶ІІІ•§•§§•£І§•£Ґ¶••°§••££¶£§¶§°Я£°°§°Ґ††ЯЯЯЯЯЯЮЯХДoWB9410026=IMI<21657:@DKOTX_fjnksГ≥вщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э¬`GM\Л≈≈Юxhdb`]]YRXЯп€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€ю€ю€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЋШzstrpromklmmmК∞ѓј≥{VSTTSVVWZ]]\^_`bfiikkkkmjkighgjjijigfgffiihhigiiihgfbcbfdaacedbdcbc``_``___aaa`a_a__a]^[\`_]\\ac]ZZ[ZZR[Н≥≈ф€€€€ъ€ю€€€€€чцю€€€€€€ь€€ы€€€€€€€€ы€ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьѓlbnЙњћЧ}yyuvqoii|ypЮ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эҐОТХЪЩЮЮЬЭЬШЧЪ©Љљј…ѕѕЌ …»√ЅЅјЅ¬њЊњјјљїЉЊЉЄєЇЄµ≠™£Ѓ≥≥є±ҐІ®§ІІ§•£†Я§•®ЂЂђіЄЇњЉљ¬їі∆”÷ўЎЏ÷“ћћЋћЌќ–ѕќќѕЌЌЌ……ƒ£ujoКѓ–ЏјІ®§•£ЪУЕysjah§б—зхчцшшуд‘ƒљєЄЄґµ≤≠©І™ЂЂ©ЃЇњЊЅ√∆∆»  ѕћ“ўбжосхъыщыщсйўЋЊµѓЂ™©®®®®©ђ©™©•¶••§•І¶•¶•••§§§•¶¶§£••§§І•§£Ґ•§£•°Я°°ЯҐ†ЭЮЯЭЭЬЮ†ЯЮЩХ]C51.,,//51-./07BLZeebgs{ББvtszОЇЏи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эћaGL[МƒƒЮseda``^XQW†т€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шћЦ{vsqnqqnmnnmoЙ≠Ђ¬∞tVSSSTWUWY\_^]__cehikkklljkkjiihhkliggfghjjhghfhiiigeedcccabaceddbc````_`ba_`ba``aa`^`^^[]a_^][aa\Z\]XTUz™Љ÷€ю€€€€€ъ€€€€€€€ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы≠jaoР≈»Ф|wxvttpmmwtp†€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юоЬНРХШЧЫЪЪЩХУТХ®љЊ аикидбЁЎ‘“ћЋ…≈њЅЅ¬њїЇїЉєєЇєЄЈґ≤ЈЈіЈ≥£І©І¶£§£•£££¶ІІ™≠іґЈЊњњјіі ‘„џЏџЎ„’—ЌЋћѕ“ќќ–ќѕ–ћ …√£tioЖЂЌўЈ¶•£¶•ЮЧИxtlci•джрчщхчшщшсв“∆љЈµі≤ѓ™І©©™Ђ∞їљЊ¬∆«∆» Ќќќ‘Ёелтфшыьщщцог’∆єЃ≠ђЂ™®™Ђ©®™©І©••¶¶®¶ІІ•¶£••§Ґ£§••Ґ£І•••§Ґ££Ґ££††ЯЯ°°ЯЭЭЭЭЭЫЫЫЪЬЬЩЛpM6+)*+,2;JZTB4.,-+-1=0//4;DVkX<0+)%)*.BcГУРКЗ~zne`_egkmoqqtyytj]XcwzЖЎ€€€€€€€€€€€€€€€€€€€€€€€€€€ї`IHXТЋЋХmfhc_]ZYRVЮп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъэ€€€€€€€€€€€€€€€€€€юю€ыа∞vvrstronnmjpЧЇє∆¶mVUTSSSWXXZ\[^aaaeghhhhikilkijkjjihiikikhghgiihihfhebbcdececcadd`a__^^]_`_a^_^]_c__`]^^^]]\Z\ZY^]XNOq£ји€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э≠nfpЭ”єКЗ}vvslhgcilp¶€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь©МКНТХУТПРПРНЙК©љЅџсхфцфхтцццххччцхцхфхухчхшццчцфёЊєµЈ∞•І®®•£§§°†Ґ°•І®ђЂѓ≥µєїЈ©і —“’ў„Ў„÷’„„„‘””””–—“”Џяа„ђsiqОіѕ“≥¶ђ™©ҐЮФД{tndeЩѕѕ»ЄЃ≠≈љ†∞ІЬНpjМ”рЎѓ≠≠ЂѓЇЊЊ¬Ѕ√≈≈√∆∆Ќ“Ёдйршшщъыъхоя–√Јђ®©Ђ©©™ЂЂђЂ©®¶І•І®™©©™®§§¶£§¶•Ґ§І¶£°££°†Ю†ЭЬЪЧХФЩХПЙИЗЕЛЛЖГЖГВЖrF352057EUohC0/-,'*,:[ХРДБАyjdabhknporquxz||xqd]nxqЕг€€€€€€€€€€€€€€€€€€€€€€€€€јbHIVОљЅШmegc_]\YRWЯр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€э€€ьь€ьб≠|ttsssqqpookqУіґ≈©oVTTRQTVWY[\[]adbcggjjjjlklnmkikkiffjijkhiiijihhgefcdffdeccbd``baa^]^^^``aa`a`a_`_^a^^]^\^]Z\ZZ^]RL\ПґЌ€€€€€€€€€€€ю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЂhanЮ”ЊМВ{zvrlhedjln•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ©ЛЛРУЧФТППСПОИЛ®њ≈ЏрффхффуфххффцчфшчхфуффхцчхчцхуЁЊЄµґђ§®®І©§§£°Я°££¶І™™∞≥≥Јєі¶µ∆–”’„’÷„÷ЎЎ„’‘‘‘—””‘”’Џёгџ±yhoЗ™«ѕ≥ҐЂ±®°ЭТИ}rkbfЫ„дрргбнй»ЄЉїЦХіК†Ёпаґѓ™©ѓїЊњЅј∆ƒ√∆»«ћ”ёемцщщъыъцткџЌњіђЂђЂІ©©©®≠Ђ©©®•¶¶©®©І©®І¶•££¶•°Ґ•§¶§Ґ£°†ЮЩЪЦХФСОНСКЗЕДЕВБ~{~~Б}V710/-;EQmuN82/.-).MWtДZ?<9<=>I^ЖІ¶И}l^[`hdghlotsuvwyy|~~ЕЙМОБmoБЗКЯЩПМНЛ|s°ы€€€€€€€€€€€€€€€€€€€€њfDFQЙЄЄРjgc^\[ZWPTЩию€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ээющщЏ°ywvsrqmopqompФ™і«£mTRRSTRTVYZ[^^]accdehigiheilmjiifekjhefhgefeegdfeddeba`bcda`````]]]^]^`bb^^`da``_]_aaa]]]\UNaСµ∆ь€€€€€€€€€€€€€€€€€€€€€эсЇЧЙЙСШЪЪ†ђеу€€€€€€€€€€€€йш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ІmfyЃ“њЖxwtsrib_`fhp∞ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѓКЙМПСЦЩЪЭЬШУРЧ±ЅћвтхчцчччхцхцшхцфцхццхфцчххцчцфпѕєЈі≥°Я°†§ЮЬЪЬЬЪЩЪЪЭ†°°Ґ•®©£ЮђЄЅƒ∆∆≈«ƒ≈«∆ƒ∆«»…Ћ»……»«»»«∆¬ЩmelНЃЋЌ≤••£°ЬЫРДzrlco≤ктссрпогклжежклммяЉі≠ЃЈЉјƒ»»» Ћѕѕѕ”џднхчщщъщчсж„ЋЊ≤™ђђ™ђђ≠≠Ђ≠ЂђЂ≠≠≠∞ѓіі≤Ѓ©ЂђЂ≠™©©©©¶§Ґ°ЪСНЛКИГ{wsoj^YWSQHGCADb[4118;BO\{rG<<=?;>@BMcА¶ЂОВp^^bdjhinrsuwyx{|y}}~БЙОРСЗxtБКНМОООПЛv|√э€€€€€€€€€€€€€€€€€€€ЅjDDRТЊЇПgfe\[WYXPUЪжь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€ю€€€€€€€€€ыэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€э€юь€€ьыыэ€е†~ttqnpmllljjmЧ∞ґ»ЂoVTSRRUUVWXY\[]`acfggehhiieeiijkjfhhfhhefgfcghgghgdfddegcdacaac`^]\]_`a__a]^ba^__\_``[\\\TNiЯЉ’ь€€€€€€€€€€€€€€€€€€€€€€ЋШxsrt|ВКОССНЦ≠й€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€нэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€•kiz±—ЄИ{}В|riaa^_bl©ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЈМЗКРСШЫ†££°ЬЫ†ЈƒќзууфхххшцчухцхчххцфухфхххфццфхнЋєЈ≤∞ЬЫ†Э†ЯЫЬЫЪЧХЦЩЦЪЯ°Ґ£§¶†ЮђґЉ√√Ѕƒ∆≈ƒ√∆…∆∆∆…»… »…«»««≈ЄТlgpКђћЌ≥••††ЯЧРЕ{rlbfЧ√»«…ЋЋ∆»џаё”ќ”ў—„Ћѓ≠ЂѓїљЊЊƒ√ƒ  ћќ—Ўгксшщъъшчхнё–¬Јђђђ≠ђ≠≠±∞ђђЃѓЃђЃ≠≠≤≥≥≥∞∞±∞ѓ±≠≠∞ђђ™®Ґ§§Фxc\TTWXY[WTRPIDECCDT{k;15:>CO\r}RB?:?=CPjС≤°Е|j]`bgkgkoqutwy{{}}А||}ЗМПТПБv|ЖВИСПКННБyЫу€€€€€€€€€€€€€€€€€€€ЅjEAQСњєНhec^YUWVRRЩжю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юшююъ€€ющю€€н£zurqonnlmnkjlЧїї ЄxWVUUUUUXZY[]]`_`cfihfgihkifeghjhfgdciihijhdhfefhefededfcc`cdaa`__]]]__``baab````]`ca\[YWQWЙ≥«ы€€€€€€€€€€€€€€€€€€€€€€€’ЧojkmqwГЛКММЙОЯя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€£jh{≥—ЈЖ{Г|shaa^^`oЂъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љПИЛОСЫЯ°§§£ЯЪ†ґ√ќжутфцццчцххцхцчфууфуффхцхцчхфцнћЄґ±ѓЩЪЮЭЮЭЩЧШШЦЧЦУШЪЯЭ†°•§ЭЭђ≥ЊЅЅЅ¬ƒƒ√√ƒƒ≈¬∆»«∆«»»∆«≈∆≈ґПmhoИЂЋћ≤§Ґ°°ЮШПГwqh`jІбдяЏ“ƒіЊ‘ѕƒЄ±љ‘Ў№ЅЃ™ІѓЇљњјƒ…∆«Ћћѕ—џзптшчшщщшфм№ѕ¬ЈѓђђЂЂђ≠±≠ђѓѓ±≤Ѓђ≠ѓ≤≤іµ≥іµµґі∞∞∞≠Ђ™©≠ѓ•ЕgYUPQQOIFFECHD>??AC`~Z1-4=?IWb~rF?A??BH[xІЄЪГxc]`cjijlopttvz|~~АБ~|ЕЕНФТК}~ИЗЦЪЛЖМСДsЛдю€€€€€€€€€€€€€€€€€€јgECQОЄ≥Зhd_]ZXYTOSЩдю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€ъэ€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ю€€€ьь€€€к†ytqmmmmlmljjnХЉњ»µzVUUTVUXXY[Z\^``adgigghhighgediggfebdjhehjigjhgedbbegdbebbbaabba^]]\\^_^^_dea``_^__b^]]XRRpҐїбэ€€€€€€€€€€€€€€€€€€€€€€€ч°qfaegnwЕКОМЖЕУд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€£jh}≤—ЇЖvx~xqjc^]_]lЂъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»ТЙКЛРЩЮ†•Ґ°†Щ°Є√ѕзтфххццчцфхцффхфхфхцуутцтфшффцм єµ≤±ЪЩЯЬЧШЧФУШЧФЧЧШЭЮЬЬЮ°°ЭЫ®≥їЉљњјЊј¬√≈¬¬ƒ∆««√¬≈≈…∆≈«√≥ОkdmЛ®»ћ≥¶•Ґ†ЪХНВwogbnЃепучфг«»”√і∞©≠ї ‘Ј©©¶≤ґЉј¬∆Ћ« ЌЌћ—ўеотчшччщштм№Ќ¬ЄЃ™Ђ≠ђђ≠ЃЃѓ≤≥ѓ≤±∞±±±≥ґґґЄµґєЈґµ≥ѓ∞≤≤ї≥ЩАlf^ZVVRMD<31:<:;=975R~g9/03:GXeВЖ]LHDFJQbx•»†Гvbaeghilrrtss{|{||~БАББ~БИТЧЧНДЗНОЗЗОМПРz]Оч€€€€€€€€€€€€€€€€€€¬lCCPК≥µФjeb`]ZXVPTЬдэь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€лЯxpnmmmkjiiillЙЃїјЬnTQSRRTXWX\[]_^ecgebgkijhjlijjffgigcdehhihigbeigfeeeeca`_acc`_`_`_]]^^______^_`^`_^][XSN`ЧЄ…ъ€€€€€€€€€€€€€€€€€€€€€€€€€€≥s\XUTU\`hqz~~~~||К¶е€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ҐnjАї÷єЙvrpproe_^][iЂш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®ЖЕИСЦЫЬЬЪЬШЧҐєЅќйфххххффучцфццчфффуухццфухцххукЋЄ±∞ђЧЧЫЧЪЫФТУХТССФХХЫЫЮЬ°°ШЦ•∞ЄЉЊљљЊјјјЊњЊњ√ЅЊј¬јјј≈√јј∞ЛmfpС∞≈…≠††Ю°†ЦЙАwohdxјнутпиёЏйЁѕ”Ѕ≈≈Њџѕ®І¶™Єїїњ√≈…∆»ѕЌѕ—ёнтуцччшшунв‘ћљ≥ѓђЃђЃЃЃЂЃ≠ѓ≥µЄґґµєєґєєЇњЊјƒјЅЊЄЄїƒ≈≥£Я†ЪУУНЙЙКШРykeaYTLFDc}X715:AKYgГ{WIGLJMWmЛЇ«ЪВq_bejkjmrstsv{{{{}АА~А|~ЗТШШФККОНМУТКСХВWtп€€€€€€€€€€€€€€€€€€¬kAAOЗіЂЙgdc`]YXVNSЬгщю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€мЯxqnnomkkijjllЙіњ√ЪfTRRQRTYX[[\]ebbcdddgihhihiihhjihghdgggiigedefgeeegdedcaacab^]_^_^]\^`__a_^]^_]___][[ULPА∞Ѕт€€€€€€€€€€€€€€€€€€€€€€€€€€€Јv]UTSUXY^irx}|{{|yДЬвю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ґkh}їЎЄЗvsrrsnga^\Yjѓщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≤ЙЕЗПФЩЪЪШЪХТ°Ї√ѕкфухххффушцхтххххцсффффффххццфк…ЇіЃ™ХХЩЧЫШЦУРТПСУТУЧШЩЪЮ°ҐУС§∞ЄЇЇЇЊїљЊЉїЉЊЇЊЊјјЅјЅј¬ЊЊњ≠ЙleoХ≥Ќ«ђ††ЬЯЬУКГwnfd| схшцччххспсмйд÷з”І••ђЈїЇЊј»  ЋЌѕ–“яотфчццччсл№–∆Ї±ђ™ЃЃ≠ђ≠ђђ≠≤і≤ґґ≥ґЄєґЄЇљ√ЅƒƒЅ≈¬їЄњЋ«Ї≤∞ѓ®°ЯЭЦУЬ©ЧИВ}zsjgeavyK668?ITYlЙpQGLPJO^tЬЋљТБl`egjimoprtuw{|z{}~|||~АЖСЧЧЩСКПРТХРКРЩИ_b‘э€€€€€€€€€€€€€€€€€√lADMЕЄ©{cbd`^ZXTPRЩвэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€эью€€мЬvqtqonmjjjkklИ∞Љ√ЩdURRTTWXXZY[_b_^ccdfffihiihiggiihfijjhdgifdfggefdedcbddbcb`a^]^^]]_]``^^_a`_``^__][[XRMhЯљёэ€€€€€€€€€€€€€€€€€€€€€€€€€€€Љx]UQSTUUW]fpwxy{yxwФ’т€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Яgi{Ј”іДvrrppjg`_]Xj±щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЉМДЕКПУШЩШЦТОЬє√–йтуфхуфцфхчфуфххцххцусуфцццчхфй»Ї≥ѓ™ФХЩФФЦЦСПССФТТФЩЧЩЫЯ†£ФР°Ѓ≥ЄЇїЄїЇЉїЉЇљљЅљљњјљЅ¬њњљЇѓМidrЧЄ– ђ°°ЮЫЧРЙАvme`{ рхцчшшшчхцчцшчфф’Ђ®§ЂєЉљ¬≈   Ћћѕѕ—бнуфцццхфркёќ¬є∞Ђђ≠ђЂђ≠Ѓ≠ђ≥≥≥±µ≥ґµґЈєїљЅƒƒƒЅЅƒјЇƒѕќќћ ∆њїЈѓІ•ЃЃЯУНЙЕА{wywЖrC38>AMWZrЖgKILNJQb|≠÷≥Нxgfghijnostuuvwzz{|~||~}Б~ЕОЦЪЫХЛРХЦЦНКОФОh]∞ш€€€€€€€€€€€€€€€€€ƒi?AKГЄ≤|a``_]ZWUORЧжю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ыю€€€дЪvqsrqljjhfiklК≥љ¬ЩeRQRTSUWWXXZ]\]`aceefeiigikhhijhiggjigdfghcighfgfecccbdab``_b__\^\]]^_]^`_``a___^ZZ[TNUИ∞ƒщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€Њ|_UQSQQRQV[emrwwvxuuzЛЈи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€§kk{ґ“±Гtroonje`][Xi™ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈ОВДИНОТФУСПМ†ї√ѕитфтфуфхффчхцфххцццфттффххххттй»Єѓ±≠ЦЦЪХЦЧЦФССССРПТХФЪЬЯЮ°ЧС†ЂіЇЈЄєїЉЇЇЇЇЊљљЊЉЊљЉЅ«√ƒ¬Љ∞НkcpТЈЌќ±•§ЮЭЦРМule^{Ћсхччшшчшщщццчцчц„Ѓ©ҐЂґїїњƒ»…  Ћќќ’дпутфххххриЁЌјґѓ™ЂђђђЂЃ≠≠™ѓ∞∞ђ≥µ≥іЈґєєїїЅ¬¬ЉЊњЊї…‘яждяая№џ÷ћ»≈љ≠°ЩУПЛЙЙЕГКh@29BJRX_{ВZKJOLPVhЗ¬÷ІЖphiijlkmrwvskkjpxz}~ББ}~}ЕСХЪЫЦОПЧЧФМНПТСr[Фф€€€€€€€€€€€€€€€€€√i?=IЕЈѓxbdb]ZYVVNTШгь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€ью€€€€€€ю€иЬxpnpomiiiijllМЈ¬њФcRRRSQSUVXY[\]_`bceggeijikmihijjjfggghggfhgigeeehgfcdaa__aaab^`^\^]]\`^^^\^^`a]_^ZZXRNj°Љжэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€¬`VRRLLPRSW[ajsstvxsuxЗ§б€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ІokzіѕіГssrrqiec_^XhЂч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ ТБЙНООРОЛЛЛЯї√Ћгрфуутхуууффффххфхффтффххцффсфж√≥∞ѓ©ФХЫЪЧЧХУРОПННПССУЧЬЮЯҐЪР†©≤ЄєїєЉЇЇїЇєїЉЇїЉЉїїЅ∆…«∆ЅѓИifnРіћЌ≤¶£ЭЪЦСЛБxkd_}»ифцшчцшшщщшщщшшш’ђ•§∞ґєїЊƒ≈∆ћћЌѕ–џепттухххфржЎЋљ≤ђЂЂЂ™©®ђђ≠Ђђ≠Ѓ≠≤≥µЄµіµЄєєЉљЊЇїїЉї»–џжйнпсстснлзб–њі©¶§†ЩФПК^?:=FOU[eЗБVIKOQR]nУ“ЌУxkghilmmotuobWY^`kx|А}~}|{ДСТШЫШУТЦОЗМСТССvTВт€€€€€€€€€€€€€€€€€¬m?JT]csГ`GJFHQZi{іб≥Бqdfimilsvtjd^aggjontz|}~~ВГ~БЛЪЮЬЪХФЦЩФОМРХЦ{Rsд€€€€€€€€€€€€€€€€€ƒk@9FБ≠Ѓ~`__\XWWVLPЫўш€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€юю€€€€€€€€бЪrnpmljjkkkijmТ≤ЊЅЧbRPQSRTSVXYZ]\^ebccdfhefiiiikiiiehjihhfgjhedhjhfecabcb_`^^__]\``\[\]\]^^]\\]^\_]\ZTNlЬєЁы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ ЖbVUPKMLNKKJJPW^innsvttvuwЛЂб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€§igГЉќ™}qtsqoke^^]Xpњъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юіЖ~ГЕЗИЙИИВБФЄ∆  …… ћѕ–—’џЁаеклоруфуфуфуттффуфг¬іі±®ЦСХХСУОСХНЙЙООРТУЩЬЮ†ЮЦПЬІЃ≤ЈЇєєґЈєєЄЄєЄЄЇїљїЇЉїЊљЈ•ГicpО≠—ќ∞ЯЪЪЧСОЙ}xoh_iҐўв№ядадссфффцутф≈•Ґ§ѓґїњЅ¬ƒ∆ Ќ––ѕЎерсрссстпйё“«Љ∞™®©™™™І©®©І©ЂЂ≠∞ЃѓЃѓѓЃѓ∞≤∞Ѓ≠≠ђЂ©®≤ЃЮ§ЅЎлопррпптхцуфутуууйљvA25>LY]au}ZIJJNQ[mГЊя™ЕrehkjiovxzМВnfgdkronvz}~БББВЛЧЮЯЮЩЦЩЪУМОСУЧ}VmЎю€€€€€€€€€€€€€€€€≈mA9GВѓђ{a_^YXXVUOQШ№ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€ю€€€€€юю€€€€€€еЪtnnllkijikkimФЈЅЊОaSOQQRTUUUWW\]_bbdccedcgghkiigiihgjjgjhikigfeghkheabcc_`^`a^]^^^[[]^]`_^\\[\_\\][YPTФЇ√ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ КbVTQNNLLMLJJKRX^elouututswЕЯя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шэ€€€€€€€€€€€€€€€€€€€€€€€€¶nhЕЊ“ђ|qrqonjf_\ZWmљщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€√КАГЕИИЖДА~УЇ≈………  Ћћ««Ћ ћћ—’’„џябдкмпфттуфууёЊ≥і≤™СПХФРСОПОМКЛПМРУУЩЬЭЮЮЩПЧ•Ѓ±µµЄЇєЄєЄЇЇЈєєїЇЇєЄїљїїє§АiesН™Ќ…∞°ЫЩЪУМЖ{xph\eІджяявя№лмностпроЉ£§§ЃЈЇєЉјƒ»…ћќ—‘ўжртпррттои№ѕ∆Љ≠®®™©Ђ™©©І©®®™™Ђ™ЂЂ™≠ЃЃЃ∞ЃђЂ©©Ђ©¶•≠•НЙЮµћўгйкпсуфхфурппрсг≤n:05@MW`eyvRHJNRS^oН ”°Гoehjimtx}ХіПqfcforpkqx}А~ГМШ£¶§ЫЦЫЩТРУСУЪДasя€€€€€€€€€€€€€€€€€«m?:GЗѓ©z`a^[XVUTORЧЏъ€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€ъь€ю€€€€€€ыьюъэ€€€€€вЪwommokjijjlllКѓ√јМ]QNQQRTVUUXZ\]_^bfdefacggfhiijkjhfhiikjikjighilnljeddda`_``]\^^^]\[[\]\\\\\^]^\[YTLe≠џш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќОfVSPRMGIOMMLJOQV[dmnuuttvvwАЧў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€•pkИ¬÷Ђ}ppqqqme]ZYUpЌь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€∆М~~ГГЖЖДГА}УЇ∆»…… ……»∆»Ћ»   Ћ«ƒ∆ƒ»» –‘Џ№адйойќєі∞±ЂТТУРООННЙЖЗКНМНТЦЪЫЬЭЯЯРЩ£™≤і≤µЈЈєЈЈЇєЈєєґЈєЄЄЄЉЇєЈҐ~hdnР∞ќћЃЮШЦЦФСЗ}vng\aЪѕ— ќ÷„÷гегбвезкзґЯ§§Ђ±Јєїј¬∆∆ Ќќ“ЎгорропррнжЏѕ∆Ї≠®І®©®©¶¶©®ІІ¶®©¶®©™™Ђђ≠ђ™ђЂ™®™Ђ§ҐІЬ|rВФ†¶±Єљ≈ќ№аемстсопп÷£^41q£Эp\\^ZWVTQHNЦдю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шкны€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€‘РuomlonjmllnlmО±¬ЅУ_QQOKQTUVVW[[\\__acegeeefggefdgghigghjmpqquxxtvy{К~phdhha``ba_^_c_[\\`b]\\]]\ZPJeЪЇт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”ТfXUSPOPNMIJIGIDDGEILNQX^dgkkoqqrqopГґа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ†mmУƒќІАvuqonjf_\[Tv’э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аЩ|}ААБ~}Цє≈»∆∆∆  ћ»«∆ƒ≈«ƒ≈≈јњЊЇЇЈЄµґіµіі≤±∞∞ѓѓђ°ООНММНЗЗЙЙЗЙИНОПУХЫЭЭЮЮРЙХ°®Ђ≠ѓ≠Ѓ±≥≤≥≤≤µіµі±≤і±≥∞≤≤•~edtШµ»ƒ©Ґ°ЬШЧТЗ}um_WXhz}xwђ£СЯПВ{x}ЖЪЂЧСЪЫҐђ≠∞ЄЉЉЉњ¬њ√…ќўжкиклййзЏ” Ѕєђ•£Ґ£•££°ҐҐ§•¶ҐҐ§ҐҐ§•°†£Ґ§•¶§§°ЯЭЪМnUB21549<8;BTODADGBEDHeP33;AKW`OQR@?FIS]ohx™ѓПoehhmrw{СЂР|wsmШ’јБhffpx{}ЕГДРҐЄћ–љѓµѓҐШУУЮѓ†ВoУо€€€€€€€€€€€€€€€€…m82=mЭ†y][^[WTRRGLЧёь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чсь€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€юююэюью€€ю€€”ОqjlmkklmlmlkmЛђ√љН]PQONRTVWWXZY[\]`abfedfegeeefdffffghfhnqppussvuz~Гzokcffegiic_acgb_]^`b][\]\YSMTЗѓƒц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–РiZUTSQQOOLJJJJEFGGHIMNSY\`fjnmmpnnmo}Ш–ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю•rnНј–®utrojfd`\XSw÷э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€іГ|}А}}}ЦЄ≈»∆»…Ћ  …»ƒƒ∆≈»ƒ√њњЊЇєґі≥ґµ≥≥±±∞Ѓѓ∞ѓђҐННПНКЛЗЗИЗЗЗЖМННРЧЪЫЮЮЬРЙФЯ®ђѓ≠ђђѓ≥ѓЃ±±≤≤∞∞±ѓ±±ѓђ∞≥•АeduШґ…√Ђ°ЭЫЪХРЗ|tma[XlАzvђЃСЧЛДАywwО§ФРЧЩ°©ђѓµЈґЇЉЊњј≈ћЏжлйлкззгў—»јєЃІ•£Ґ§££Ґ§§••§£°°°£§£†§•£¶§§§§°ЮЭЩН|`?,'('-.++.:D;58:9<9>R>.09CNZ`BCG>CGMS`qf{ѓЂК}ngikmowwtБytpsЪЉ§zmlhq||БЖДЕХ•ї„џ¬ЈЇ≠ЭСНФҐµ°ВiГи€€€€€€€€€€€€€€€€Ћk81;o†§Г^[]XRQRPIOШёэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€ю€€€ю€€—НqlmljlmjlmkjlМѓ¬єЛ^PQPPQRUUVWYYZ\]`bdfeeedfffihgfgfbfhfeiomotstvtДТrjeihirwrqsjbdfbdecefd_]]_ZUPPt¶їк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕОi\WTSRRPNOJLLIFGGFGIIGKQSZ_cghhiiknnlsАіЏ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ§rnМЊ…£~ssspmhd^YYRt‘ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю¬М~~|А~}~Хє∆ ………  » »ƒƒƒ∆»≈√њЉљљєЄЈііµіµі≤ѓђЃѓђ≠ЯОПНОЛИЗИИЗЖЙКЛМОРХЩЬЭЮ†УЕРЬ£®ђ≠ђ≠∞∞ђ≠Ѓ∞ѓ±∞≠≠≠ђ±іЃђ∞Ґ~bcuЦµ √™Ґ°ЫЮТНЖ{qle[Vk|ГЖvФХГС}Вz}yЗЮТПЧШЮ•™Ѓ±≤ґЇїЇЉњЅ „взежзждаџ’ЋЅґЂ¶§§§£†££••£§§ҐҐ°§•§•Ґ£§£Ґ§§££†ЭЪХЛАpS3"%"$%)33-,.-..6C4,18ER\_74<IR\S('31&  (*-2>LUaP"!0=EKQZodAuЃ†Еwkijjlrtv`\pvpf__^[X[dqz|ДИМЛО§Ќирд‘ЏЌ®ЩФХЬЅ«ЬxUWЈщ€€€€€€€€€€€€€€€Ќn9,7m£©Б]XXVTSRRKOЧяь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эпъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ьъю€€€€эюьээ€€€€€€–ОsopmmomlljiijСЈ√ЇЛ\RNOOPRUUVVXXY\_aba`efgeedhgdfdgeadfcbdcba`_^\ZTC801AUbjnuГБ}|wtxwnqolf]TOYЗЈѕц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЋЖfYXWTUSOMQLJHIGFEFHHGB@?DEFMPQT[]_abdegijllxФќы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хҐrmЙ≈„¶}qmnmmkc][XPxџ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€ю€€э€ У|||zy{ШЈЅ∆ ……«∆»»…»…» »∆ƒјњЊЉїЈµіі±≥і≤≠≠ѓђЂђђЯМКЙЗЗИЖДДЖЙЛММНПРУЦЪЬЪЭЮУЙСЫҐ¶™©©™ђ©™©ЂІІ™ЂЂЂ≠Ѓђ©•®°|a_rТ≤Ћ»™°†ЭЧПЛГwmf^VShusАЕЖКzМЖrwqssuСЦОМОЧ†Ґ§™ђђ∞ііµєљ¬≈–џё№џ№Ё№Ўѕ∆Ѕµђ•£Ґ§£Ґ†°£°°Ґ°°£ҐҐ†££Я££°Ґ£Ґ£ҐЭЩУОДwoeYKA;/+("#*.4>LYaD0;EKQ`qY9rђЯВulhijortwf[r{qg_[][LNdvz}ВИНЛЗС©ќпфд‘Ё •ЩХХ£≈¬ХsMN°т€€€€€€€€€€€€€€€ќm5,7o§™З_VVTTSRSKNЦџшю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€ыыю€€€€€“ОtnmmnpnnljkklРі∆ЉН]OMNQQSUWVVWZ[^^^a`beeffedkjeddecbddcb`bca_]]\ZVMC7>MV_eiqywzuouwuzwqrsmaWQMjЮЉпю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»ГdZXURTSQQQNMIGIGGIGIHCBBCFGIHIOUY\``cdeehkkkrК√м€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хЮpnР»„©|pnmmlhb][XPxџ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шуь€€ь€а•Д{zzxu|ЬЄј≈… «ƒ≈««»…««…««≈јњЉЇЇґіµЈ∞≤µ≤∞ЃЂ≠ЃђђҐМЗЛЛЗЕЖЖИЗИИИЙЛПРТХЪЯЬЯ°ХЙНЩ†§¶©©І®™©¶®®™™©™®Ђђђ®©Ђ°{a_pР≥ЋЅ§ЫЬЫЪТЙvnh`WTgryҐЉ®ДvИЙxytqrrЛШПММЦЬ°Ґ®™Ђѓ≥≤≤ЈЄї¬ѕЎЏўЎЎџЏ”ћ≈ЊіЂІ¶••ҐҐЯ†Ґ§Ґ††Ґ§°Ґ°†Ґ†ҐҐЯ°Я°°ЯЮЪХОВwmbWK@7640+(!!).5ANZa9/=KQSfwQ/n¶ЪВwliiknoqtk`v|rf^[ZQ@Ki|ББГКЛКЗТ∞”пуаџж∆ҐШЧЦ®ћїОlBBМн€€€€€€€€€€€€€€€ќl3*5qЂ∞Н`TUSRRRQKPШгэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьыыэю€€€€€€–КqnmkknolkjjklПґ∆єЛ^KLQTSQSWUVWY\]]^aaddbdeddhfccffdccbbb`_ba_]]\[[\YTW\\`cafnkospppu|touuf\TOWЖ∞ћц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈bZVTTSRPONMMJJJGEEEEEEDCDEFFFHJOUZ]`bcdfgehkioБ∞Џ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЯrnР…‘£{qomnnhb_[UP{№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рмы€€€€ьЉЛzyyvt{Эї¬√ƒ«≈∆≈≈…»»∆∆∆«…∆ЅјЇЄЄЈіµі≥≤≤∞∞≠Ђ≠ЃЂ≠°КЗКИЖЕЕЖЗЖЖЖЖЙЛОППТШЬЮЯ°ЦЙКЧЯ£••І¶¶®•®©І®ІІ®І®©™®І®Юx^_qХі Љ£ЫЪЩЧПЗ|rni`WUgtvЬјЉРvЕЙtwsqusМЩРНМСШЯҐ•®™Ѓѓѓ≤µµЈ√–÷Ўўў„ўЎ”Ќ≈ЉµЂ®•££ҐҐ°Ґ†Ґ°†Ґ°£†Я†°°†°††°†ЮЯЯЬЩТЙБwlaVI>;641/+'" &+09BO[]3 1930351--'%! &*08ES]V*#5JQYpi4\ШЦАytnilrsr~|obcb_[VQTjГАГИЙЙЛР†»лк”»№“ЂЫЪЦЪЅќ•xM,/gЎ€€€€€€€€€€€€€€€—m2(/i®µЧeTUTTPONDNЧдэ€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юээю€€€€ээ€€ю€€€€€ѕЛspqpooompqlhlЪЊ…ЇЙ\ONNOORVUUWWYY\]^`adaaabeecdeedddcabcbbcd```^_`]][\]]^``]^^^ba`cdflold\VRQo°їр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш∞q]ZYYUSQRSSQOOPLJLJJLJLHCCCAECABEDGOSVY^a_acedgjhfnЖњс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џХpkОјјЦ}xwsrrmfa_ZQ}б€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€юю€€€€€€€€€€€шљСzrrpwХ®ЄњљЄљ«…«≈√√√≈ƒƒ√ЅњљЉїЇЈ≥±±≤≤∞≠±∞ѓ≠≠≠≠ЬЗДЖЗЕГДЕДГЕЗКЙЙОППТЧЩЭЯ†°ФЕЙУЩЮ†££°£¶§§ІІ¶ІІЂЂ¶¶™¶ІЬza^pХЉќєЭЩШРНД}zsmg^Sa†∆»√±†ЫХЛЫЫТЙАББНЬФПММХЫЬ†•©Ђ≠ђ≠Ѓ±µј ѕ”—“’’”ќЋ≈Љґ™§£££ҐҐ§£°†ЮЮЯ°Ґ†Ґ£†°£†°°†ЮЭЭЭЪФНЕ}sk_RD>97666301000,)$##$*3>MXcT(6ANR\q_)SХЦВyngjorqsvxz{sg`^ba]_k|ВБВЕЖЙНХІ–蹫ћё∆ҐЩЫШ†«ƒЧqF(+a’€€€€€€€€€€€€€€€ѕi/(,b™љЪdSUSQPMKFMУёь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€ю€€€€€ю€€€€€€€€€ѕКqppnmmnooomimЫјЋїЙ[NNMMLRUVVVWWZ[]`abeca`acbceeccbdcbaaba```_^_`^\\\\\^_^\Z[[_c_Z]`cdcb]XUOZК∞џы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пЂq][ZXVSSSRSROPPMLNJKLLIECDEBEGA?BCEIKPV[\]^_bbdhfffl|ѓзэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏХqkЙљљФБА{tsrlgc^[SБв€€€€€€€€€€€€€€€€€€€€€€€€€€ыэ€€€€ьэ€€€€€€€€€€€€ѕЮГuqoГ¶™¬ћ«љї∆  «ƒ√ƒƒ√√√јљїЉїєЄіі≤±±ѓ≠∞∞Ѓ≠™ђђЭЙЕЕЕДДЕЕЗГГДИЗЙМПСУШЪЭЭЮ°ЧИЗПФЪЭЮЯЯ°††°Ґ°†•§§¶®©®®ЂЭy`\lХЉѕєЩХУПМБzwrme\U]З¶≠ђ§ЩЦФЛЩІ¶ШЙИНХЮЧОИЙФЫЬЯҐІІ©™™ђ∞іљƒ…——“‘“–Ќ…¬ЉєЃ•§£ҐЯЯ°°°ЯЮЮЮЯ°†ЮЯ†°ҐҐ°††ЯЬЭЫХПМИ{qh]QC<:7456005302/-)&&'+2CPYeJ*8BLS_mV'RУФАvmhikortxyz}~{zxwurtpy~ААДЕИПЫђ–ёѕЅ“№ЄЭЩЩШЂЋЈНg>&(YЋ€€€€€€€€€€€€€€€Ќg/&+cђљШbQTRORRLCNЦ№ы€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэьэюю€€€юээ€€€€€ю€€ЌИponmlononnnjmШЉ єЙZMMMLNPRVWXXXY[]aabecbabcbecdecaabcd`_`^_`^\^\ZY[]\]__\ZYYZ\\[Z^_aa^^[USPo°їо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№Яq\XVUUUTPPSPPQQPQNJIMNMGDCGFCEA??ADEHKPTWZ\]`b`beegijvЂш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“НnmДµЈФВ~wssrkhe`\TАбээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€е∞ЛyspЗЈє√∆¬їЉ«…∆≈«∆«≈¬√ƒјљЇєєєЄµі≤∞±∞ѓЃ∞Ѓ™™©ђ†КДЕЕЕЗДДДВГДЕЗЛНПУФШЩЬЭЮ£ЪКГЛРХЩЬЭЫЫЭЭЬЬЯЮЭЯ°£°°Ґ••Ьy_`mТЇЌіШУПЛЙД}wplf^TYАЮ£ЯЭЧСПИР°І§ЯЬЯҐ°ЩПЖЖТЫЭЯ†£Ґ§•®≠ѓѓЄЅ»ѕѕѕ––ѕќ…ЅЉєЃ§£ҐҐ††ЯЯ††Я††ЯЮЯЯЮ†Ґ†°†††ЮЮЬЫФМКИ{pd[NA:532111256874/--*),:GQ[d@0=CLVamQ&MРУАwrojimstuxz||}АА}~~|vyАГГЗЗЗС†і —√їѕ–ђЪЩЩЩЈЌђВ]6%(P±ч€€€€€€€€€€€€€€“n1'-eђњЩaPRPOQNLENФ№ь€€€€€€€€€€€€€щлш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эщэ€€€€ээ€ћЗpomlmpppnnljnШЉ…ЊР]NLLORPRUVXZ[Z]^a``cedddececdidbacbb`^`_^_^]^\\[[\]]\]\[[Y[b_[[\[\_[ZYTN[Л≥’ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№Ыm\XUTVVRPPRRPPPNOOKJNPNLGBDFC@>@@ACDFEILQWZ\__^]bbcgif}Їь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—Лpmz≠ЈЩvtsqnjddaZTБ№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъ√Ф|so|™Љіђ≠ѓЉ«»≈≈««∆≈¬¬√ЅљїЄЄЈЄґ≥±≥≤∞∞≠Ѓѓ©©Ђ≠†ЙГДЗЖЗЗЖЖДЖЖЖЖКООУЦЩЪЫЬЬЯЪМВЖКРХШШЪЫЬЬЪЫЫЬЮЭЮ†ЮЮЮЭЯШxaboТЄ…±ЦРНИЖБ~zsle]SYЮ•£ҐҐ†ЭФУЬЯЮЭЮЮЯЮШСИИПШЫЭЯҐ£°£І™©Ђ≥њ» Ќќѕѕ–ќ…√Њµђ§Ґ£Ґ†°Ґ†°†Я†ҐЯЮ††Ю†£°†††°£°ЮЫТКЖД{qfZOB;6134226:7685131.+-:EQ\`: 2:AKVdlJ"AИЦГwuqkhjpsuy}}~А~|}~{{}ГЕЗЖДИТ®ЊЋƒєє…Ѕ¶ШЦЧЮїƒ†xS0#'FЧн€€€€€ью€€€€€€€‘p1',fђЉС\NNKMPNNFLУж€€€€€€€€€€€€€€юью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€юю€€€€ю€€ ЗpoolknqrmmnjmЦЉЌћЪ]MMMQSSVVUXYY\\]`^`deccdcaddchfdcbabba`_^__]]\]]\\\[^`]ZYY[cb]\[[\[YXVRRt°љпю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўХm^XVTUTTSRTSOKNPNMJMROKNKECFEAA@@@@?ABCGKSVZ[Z\^a`abdejx≥и€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘НrpvҐґЬtsrrpica`ZTАд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю“£ЗtnqЛ™§Ъ†Ѓњ≈∆»»∆≈∆«∆ЅњњЊЉїєґЈґі≥і≥±≤Ѓ™®™™ђЃЭЙЕЕЖИИЖЕЖЖЕДЖЙЛНМРФЦФХЧШЪФЙАЕПУСХШФЧЪЩЫШШЫЩЫЪЬЮЭЬЮФv_`oФЇ»≤ШФСЛЕА}xtjb]UYyФЪЬЭ††£ЫУЫҐЯЮЭЬЬЬЫУКИОФЦЪЮЯҐҐ£¶•©©ѓЇ√≈ЋЌќѕЌ »ƒљґЃ¶£§°†°°†°°†††ЯЯ°Я°§£†ЯЭЯ•®•†ЪУЙЕГypeZPF;931644:;31356>3)*0;GR\Z/49>IUeg>8ГШЕzrkkkmswvx|АВА}}~{БДВДЖВВОЫ±»«Є≤њ∆±ЮЦФЧІ¬ЇСnJ+!%=Зй€€€€€эю€€€€€€€“n1&+g™ґЗXOUPKMNNELХм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эьюъы€€€€€€€юэюћЗonnllmppnpnknСЈћѕЪ]KKOQPQTTVXXX\[[]^bcdedcbbecaehgfcacca_^^^^^]\\]]\ZZab`[[[ZZZ[[\]\\ZXTN^Н±ию€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎТk]YVWWWUUTSSQLNQQPLRVQNOLFDGCCCAA@>@@A?BFMQVXY\`_`a`_cejuЯѕэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”НrouЯ≤ЭДwttqoheba[TБд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€лїЧ{mktПҐІ≠Ї¬ƒ∆≈»«≈∆««√јњЊЉЉєґііµµ≥≥ѓ™®®™∞іі±ЮЗГЕГЕЕГДБАББДЖЖЗМККМНППНМЙВА}ГОССХУРФЦЩЦХЦШЦЦХЧЪЩЪЭРr_bpЧЉ«≥ХОПКЕВ~wpjc\TaСЃђ•§ЯЭЭЩУЫҐ††††ЮЯЯХКЖМУЧЪЬЭ°§§§¶™©∞Єњ« « ќќ…»ƒЉЄ∞•ҐҐ£°ҐЯЮ††ЯЯ†ҐҐ†Э†£Ґ†ЮЬҐ•¶¶£ЩФРМЗznbZPB9544567775669EC2+*/;JW`S$ !5;CMUec7 /{ЩЗ{lejlpwwvxz|z{}|{А|ГЕВАВБЙЧ£ґ«ЅґЈ∆Ѕ•ЩЦЧЪ≠ƒђГeA("#8~ж€€€€€€€€€€€€€€”m0&,i©≥ЗXOXSKMMKEKТз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыью€ююьью€юьь€€€€€€юэ ЖnmmllloppqomoУЈ«»Щ_MILOOQRTVWXYZZ\]`b`dgfddfifcefgfdccb`_]_^___][^\[[\]^_]\[ZXY[[\]\ZYURRrҐЉп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€’Нi]XWWXYTUVSRRPNPQQQaj[SQOHCEEECAAA>BCB@?@FKRWY[\\^__`bdikqМјъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€’ПqmtЮіЬЖztqolhb^^ZUДе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъэ€€€€€€€€€€э€”¶ЗohgvХ©≥їј≈ƒ√∆∆ƒ√¬¬¬јљљљљЇЄµ≥±±±ѓ™Ђ£™њ∆∆јµЬЕАБВДБ|}}~{}АГГАВВ~|{y}zvАЛОПТСПТЧХТСХФСОТЧШШЧЩОq_bqШњ»ЂУПНЗДА~ypjd\Rd®“„‘Ќ≈љґѓ™≠≠©•§£°Ґ°ЧМЖКТШЩЬЮЯ§£†§Іђ∞Јњ∆…≈« Ћ Ћ≈ЉЄ∞І£°£ҐҐЮЬЯ†Я†°££Ґ†Ґ£°Ґ£Ґ§••¶ҐЫФСОЖyle[J=:96652344468=>92,+4DQZ`K$2:DNXj]2)mУКzqmljlpsvxy|{{{yzББ}ВВБ~}ДРЪ§Є¬ї≥µ¬ґЯЧЦШЬѓЄЬzZ6&#"4vг€€€€€€€€€€€€€€“m0%+j¶∞ЙZORONMLLBJСз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эфцэ€ююю€€€€ычэ€€€€€€€ЋИollnnnopqpnlnЧљ…≈Ш`LKLMPQRVWWXZYY^^`a`cgfceiiheffdbbcda`__```a^]]]\XZ^^^^\ZZZ[[\\]\[ZYUP_Нѓзэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“Кg]YYZWVTSUTSSPMOQSUj~gTPOIAADCDC@A@BDCB??CGMSVY[[]]^``bfhgnВµф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€’ПontЭ≥ЩЗ|sqojgd][XUЗв€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€эю€€€€эю€ыю÷∞ЦyigitВНХЮ©Ѓ≤µЇњ¬¬ј¬ЅЊїєєЈґґ≤±≤≤Ђ£±ѓІ¬ЌЊґ±ШГАААА}|ywxwstwxvusqnlkjgdiupn~КОПРСООУТСТУТТСТСУФУУМp]`qЧљ«ЃФНКЕГБА{qic[Qf®“Џў„Џё№ўЏ÷ѕ»√Ї≥∞ђ¶ЫОЕЗТФФЩЬЬ°†ЯҐ¶¶™іЊƒ«∆……∆… ≈Њє≥™£Ґ°Ґ°ЮЮ†††°Я†°°Ґ££†°ҐҐ°°•І£ЫРКИБvmg[L>99963/.4821587:7.,3CT]`>+8;CLWlW, _НК|usqihmsuvz{{}{z{АА}Б}~ЙХЮ™ЇљЈіґЄ®ЬШХЩ°≤ђМqM,"!"1lџ€€€€€€€€€€€€€€’o0$-gҐ±КZNROMMLL@GПж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€ю€ээ€€€€€ю€…ЕqoonmoppmnplpХЄ»ЊКZKLMNOOQVWWWYY\^^`babedbdefgfffaadddc`^]_a_``^^\[X^cbc_Xjp^Z[]`^[ZYXTQu£≈ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЌДe\XZ[YXUSSSSRPNORTY]kcTPME@@@?CC??BDBBC?@BCGKNUX[]]__^`deefkx™ж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”Пpmt°ґЫКsomigb^]ZWИг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€ыю€€ы笥Иpfffdeinv~ГЖЛУЭ•©±Јїєґµі≤≤ѓ∞∞ѓ©ЮІ≥™ђ®°£©Ц|z{xvvuomokffiged`[XUUPMS`jir~ЗЙМНПОМПРНООРСУРНСФТСКp^]mЧљћµФМКЕДБ{wrhc\Qe≠÷„„џёёЏ№зйиж㹄—…њ©УЗЕОСРХЪЭЮЮЯ£•Ґ¶∞єЅ≈∆…»««∆ƒњєі™£Ґ††††ЯЯЯҐ°††ЮЮҐ°Ґ£°†°††§¶°ШСЛЖtkaXPB86400111325524<>AC@AB>?ABCEHOSX[[]\]```cghjtЭћэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷ФrmuЮ≠ЩЗ{qmmje`]]ZVЗб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€э€зµЦ}gaba^^]]]_`^^abepwВКРЩ°ҐҐ®ђђђ©°Ю°ЮУМУЬ®Уsnkihhc]]]ZWZ[ZXSMGFDGGJTcmu{АЖЖЗЙКМНОНРСРОНММНТТПСКr_]mЦљќґФОМЗГ~ztnga[Sm≤ЎЎ„Ёга№ЎяжйкизижёЎјЬЙДЙСТХЩЭЭЭЭЯ£§ІѓЄЊ√∆»∆≈∆≈¬ЊЇ≤©§†ЮЮЯЯЯ††°£°ЯЯЮ°°†•£°Ґ°°§•ЮФРЛЖuj]WPD<622000/277679<7/29ES\`<,4;ENYkF @}ОБxqljglrvvvyzzyz{|}~А}БОЫ£ѓЉЇі∞ґґ¶ЪХХЧЭ≥ґШyP( %"$(Xјь€€€€€€€€€€€€€’q1$(f©ґН[MOLILMKEIТй€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€ъщээююю€ъшэ€€щчэ€€ыƒДomnoommmklllqФґ∆Є|SKLMOPRSTVVWY[\]_^_bbbdccefcadfdaaa````_]]^aa_]]\X[^gb\[_c^ZZ[^]\YXUSu§Љо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈{b\ZZXWWWVWUTSPOQQPQPFELJE@=BDDDA>?A@@@><423:FMT\`eo~МФЬЭЫХНЖМЩ§Ґ~`[XTSTQPPLKKPTSQLFDGHKPS]lv|БВЕЗЗЛМОСРУТОННМННОРСПЖo^_mХЊ«ЃСЛКИЕ}xsmhaYQpЇвижжгяЁЎёжйиииижбЁ∆ЫДЗППУЪЪЪЫЭЯ°£¶ђЈљЅ√≈∆≈≈ƒјљЇ≥©•†ЮЯЯЯ†°Я†Ґ†ЮЯЮ†°††Ґ†††°Ґ°ЫУОКЕth]WOC;643330055457981-09IT\\0-5 %$$%NЈы€€€€€€€€€€€€€‘r1"(fІіМZLOOKIKLCIСй€€ю€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ью€юэю€ю€€ъъю€€€≈БnlllmoollkkkqЩЄ»¬ЖUMMMNNPTUTVWW[\]^^_^]cdbdffdceeda^`bb____^^__][^\XY_gc^^][ZZ[\\[[XUS`Піжэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€…y`]ZYYXXVSUUTROOPOPQPK@;:;;=BFFCA@AB??@@<:<=@A@CMOSVXZY\^^^^_acdn{Ђр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“Йrr}І≠О}wsokif`\[Z[Ог€€€€€€€€€€€чцююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€ыЋЯВmb_^[YWURNOLF=0% &,,'!!)6BN_kvБИФЫУwSC@><@?=;?B>?CIJMQTWX\^\]^^__bhnv§Ё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ляч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“Йrs|Ґ©Лzwtqmkg`\][[Оз€€€€€€€€€€€€ьэыь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююеЈХye\YYYVTRJGE@80)  &29EP]ikZ?-*)*+.7???=@CA@EMHGHMRSW_lu|А||БВЕЖЛФХРПСТПЛЙКЛОНММГm]]nЩљ»±ЧСНЙВ|xtmf_YRn≠ћЏйжћЊ“еиеггвбвгдёЇКxxАИКНТФЧЩЫЭЭЮ†§≠ґЇњƒ«∆√¬Ѕњїі≠®£†ЮЯЮЭЭЯЮЮ°°ЯЭЮЯЯЮЭҐ£†ЮЪЪЩФОЙГ~rc]YSK?94334110454561--6>HT\O! 1;?CNcd7 XДДwhjvrkmqtvzxy|{{{z|БИОЩ°І∞≥≠©ЃЃ£ЫШХФХ°∞™ПrK$&%$<Лй€€€€€€€€€€€€€÷r1"(`Ґ≤ЙWKQKGJLLCHМяюю€€€€ъы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€ю€€ююю€юю€€€€€€ю€э€€√АommlloomkjjhnУі«»ХXKPOPSTTUVXZYZ\^a````_`abbdcbdfgcacca`^_c`_^[]]]ZYYjn`[\\\\\ZZ[ZXVQ^М±зю€€€€€€€€щь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сѓs^[[ZYXWXVSSSROQRQRSQQRMFHLFCEECABB@@@?@@???>>@ADFFJOQU[\[]]\]^`ejkoУЅч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лвш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“ЙsqyЭ£Еutspnlg`[[ZYНз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эьщгіЙk[YYWVTQHDA:0+% !$+3881'$*3;FIGGJQUV\cotv|}{y}ВБАЕМСФТНПСЛЖЕЗЛКЙКДn^_rЫ¬Ћ∞ХСОЛЙБwplf^YQfЫЋгиж“Їƒў№‘““—„яваЌ°Бzy}ДКМОСХЧЩЫЬЫЭҐЂ≤Јљј¬≈¬ј¬њїґ∞Ђ§†ЯЯ†ЭЭЯЯ†°ЮЭЮЯ††ЮЬ†£°ЯЭЬШТЛЙЕ{ob[YRGCA<7420/.275420/.4@KRZG*;BEGQha1 FuВximwoimpsx{z{|}{z|ГЛСХЬҐ™∞Ѓ™™Ѓ®ЮЪЦФШЪ§ЂЬБd7#%$$9Гж€€€€€€€€€€€€€„r1$'_§≤ЖWLOMLLKKBIПб€€ю€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъь€€ээю€€€€€€€€ю€€ƒВnnmmlmmkijkjqЩї≈»ФXLNMOSSSSTWYY\]^`a```_`a`affddcccbcdca_`ba`]\\\\ZZZ]__]\\[\[Z\\ZWRQq°љн€€€€€як€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€г†m[[[ZXVUUVTSTRRSRRSQOOONMLMHGFCCDDA>>>?@?>A>;=??@CDGJJNV[[[[\\_`_bfgnЕ≥у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“ЗpszЬ•Дstsrnkgb^[Y[Пж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€жЂy_YWWXUNGB>70*"  #(*+)$'.8=ABCCDBACFHMQU\agptvwyyy{}|}БЕЙМННЛЛИЕЕЕЖДВДАl^^pЬ¬ ѓХПНЙЗБyrme^WPeТѓ¬–ё„Ѕ«„ќ√√≈∆Ћ”‘»ІЕyywwАЙЙЛОТСУХЧШЫ†ІЃіЇљњƒ¬јјїЄґ±™ҐЮЮ†°††ЮЯҐЯЭЮ†Э†°ЮЭ°£°ЮЭЫЦПМЛЕymaZWL==?:436303434221/06@LSZ@0?EFITj[,# 2`xxuoklnouvwy{||{|~ДКСЧЫ£ЂЂ™™®≠ђ†ЪЫЦФЩЮ®¶МrN##%&&5{в€€€€€€€€€€€€€Џt0%)^°ѓВULONLKJIAIРг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€юю€€ю€€€€€€€€ю€ю€€њ~qpomlnljkiikrЬј √КULMLKNQSVWWZZZY\^a`_aaa`bcfhgebcaabba`aa`__\[[]\\[[\]b_\]]\[[\[ZWR]Л≥гэ€€€€€йр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аШgZYYXTVWUTTRSRSRQRRPPQNJKMKJJHDDDCB@?>>==>@>;:?ACGHJQXZZZ[\]`^^bdfm|¶а€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕЗsr{ЭІИwvsqlhgc^\XZОж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€юъ€яШfXVVWWPIB<93,$   ('),+(# "+4;AA@@DDBDKOPRW[aglprtuuwwwx}~}ВГДДДЕЕЕГГВГГm]^rЫЊ»∞ЧЦХНИА{ule`XM]ЛФФѓќў–Ћћ∆ЅЊЉґ∞Ђ•ХВyvurp{ЕЗИМПОПРСЧЪЭ§ђіЄїЊ¬ЅјњїєЄµЃ•ЮЭЯЯ†£†ЮЯЭЭЯ°ЯЮЮЭЯҐҐ††ЬЧФОЗЕБxj]WVH;;;62133435611430/9CLUZ92ELMMXkS**# $Mrzyogoyvtxyy|~~ГЙНСЧЫЯ¶≠™¶¶¶І¶ЭФУУЧЪ£®Ц|c9 %&'%0sя€€€€€€€€€€€€€Џu1#(a£ѓRJMMHGIH@IСз€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€ьью€€€€€€€€€ю€€€€ј~sqmlllmjhjjkpШЅѕЇ}SMNOLORTWWVYXXX[^_^_a```cdeddccca____ab_^_][[\^\\][\aa]]]]]\]\[XTQp£≈р€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁУgZYZYTTWUSSSSRRRQSQOPQOKIMLKJJIEDEDB@??>>?>?=;;>A?=?BDFLQTYYY[[\]_bbbfksЩ“€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–Кun~®ђКyxvsmkf`^]XZП№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щы€€€ью€€€€€€€€€эшю€љs^ZXWURJ@:95-&! ##%(+*'%'1:@@@ADDBBHMPUY[_flnqrsttssuxy{|{{~АВВВВВ~~m]`sЪљ ЄЫУУОЖ|xrjd^XQUpЕН°≥Ј≥ђ§ЮЩТОЙБ~}zwutrppwВДГИЛМННПФШЫЯ®±ґЄЉЊњјјљЉЇµ±®°Я†Я°§°ЮЮЭЭЮ†ЭЬЭЭЮЯЯЯЯЭЧСКЕБ~ue[VPG>;74310004423100019EQXS+ 9FPST\jI'.*Cl{wsouzutyГДДИКМТЦЦЪЮҐ§§§§І¶††ЭСОСШ°®ЭЕsO" &)'#.jЏ€€€€€€€€€€€€€џu1"(_£≥ИUJMKJIJH@KСи€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€ьюююыыыыью€€€€€€€€€€€€€€¬АpokjjjkjhijimШ√“љ}TMMOMMPSTUVXXXY\^]]^_`a`acbbcbaba^`baaaa^^][\^][\\YZ][Z\]]\\]\ZWPZЗ≤жэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷ЖaZYYYVUVURSTTUSQPRRNMPOMKLNMIJJEFDCCA@??@====<<=CB=?@??EJMSWY[ZZ[^a``cffpОЇх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќЗro™≤Рyvwupmg_^_Y\ТЏь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пф€€€€€€€€€€€€€€€€€€ѕЕwyysh]TMH?6.'##%%(**'"$+5;>@BCBCCEJRXY[_ejnrrpqstttvvw{{x{{|~}}{k_arЪЊ…ЈЫУОИЖvqlc]XQUmЕМОФТЙГВ}|zzxwywuttqppt~ГВДЗЙКМПРФЧЫ£Ђ≤µЄїЊњЊЉљїµЃ®£††ЯҐ£†ЯЯЬЫЭЮЮЮЯ†ЮЭ†°ҐЮЩУЙЕА}uh\UPE<;7574102234540-.2>?=>==;;>AA=>?==?FHKTYZZZZ[]]]^`cgmАЃр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–ДqqА¶ЃУ|wwtpld_]\XZРг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€э Ґ±ЇїЈ©Пyyu]=/+%!  $%$(++' '-7=>@@BEFGLSXZ[^emstsrsrrtxxxz}{xxz||}}~||~{j_aqЦї…іЧСМКЗ|vqke^XNRpЕЖИММД~~}zz{xvvtssqponzГВГЖИЗКНОРХЩЯ•ђ≥ЈљЅ¬√√√њЄ±Ђ¶†ЮЯ†°†ЯЮЬЫЮЮЯ†††ЮЯ°°†ЮЪУМЖАysh[TNC<94385212676772++4BPX[M!+CNTXZdg=(==$)Jq}ywvqsvwzЕЛРРСХЩШЪЮЭЪЫЯ°†ЪХХФППЩ¶≠ЭАrP #'$"'NЄю€€€€€€€€€€€€№t.!)`•єМVINJHLHJGKОг€€юю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эыю€€€ээ€€€€€€€€€€юю€€¬pplijjijhihhlТ≈Ў∆ВRMNOPQQSVVVWXY[_a`__`bbdgffeddaccbcbbcb`a``^]\^^[Z[ZYZ]_^]\[\[VPXГ≠дю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю«x]YWWWVTUUTTUURRRQPROMPPQPMLLHFIIHGDEDB@@@@@=>=<>>>===>=>BFIRUVXZ[\\]^^_afimy†а€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—ЕsuД®ЃРzwxwojf`\\X[Тз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь»ЉёзжжбƒҐЬЫyG/,*& !#&(**'!#*09>>BEFGJOSWZ`fltuuutvwtuxyy{zwwxy{||~~{|{zzl]^oЦЉ ≥ЦТОЗЖ~xqif_WJOnВДГЖЙД|{~~|yxyvssrqpnmllwА~БДЖЕЗМНОТЦЬІ∞Ї¬»Ќќ—ѕЋ∆љµЃ¶ЮЭЯЮ†ЯЬЬЭЭЯ°ЯЯЮЭЭ†£†ЭЬШСЛД}vpdXSG>=<7561/0024421-),4BPWZE+@NSUXdb9-A@,6a{{xqlqwutyАЗЛМНСШЧФФЧЩЬЭЬЫЦТУТПФ†™§Лxd3 &&"%H™ч€€€€€€€€€€€€№u-!*aІЄИTJLIHJJIBJОа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эьэюююыэ€€€€€€€€ю€юю€ю€юњ~poljigijhhijmСј’¬~QLMNNNOSUVVYYY[_```^_``ceedcedaba`bcaa^]]_^\[[]]ZZ[ZZ\\\\]]\\ZSPmЭ¬р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т≤r\XXVUXWVVTTURRRRNNPNOQNMPNLNKGJIHEDGFBCB@AA>>=>@?>><<=<>@EKLOSWY[\[\]_^]ceegoХ ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щнч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—ЗstГ™≤Тyuxupmga]\W\Фз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аћгнннл”≥®•АF,,+& #%*,(#%,4=>AFEELTZ^bgmsvwwutvyxwxxvxxwyzwy|{||zzyzyi\\oЧї«≤ШХСМЗ}wqlg^VIOl}АБВЖВ{y{{zxvusrpppnllllq{}~БГДЕЙМЛПХШ£ѓЈњ»“’‘—Ћƒї≥І††ЯЭЮ†ЮЭЭЭЭЭЯЮЬЭЬЭ†Ґ†ЭЫЦРЙД}tndZPFA><83651/143430-,18CPWY>.>JPRWdY0.EE3"*Mryxuqsuuwx{БЖЗЗЙМНЛНХЩЦХХФСРТТУЩ§®ЧqO ''%%@Тл€€€€€€€€€€€€я{2!']•ЄОXJMLIGIJCLПб€€€€€€€€€€€€€€юю€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьъэ€ьээю€€юью€€€€ээ€€ю€юњ}qpmjjkkhggijkНљ’Ѕ}RMJKLNPRSUWYYZZ[]___`aaaabcdedb_`abcb`\^_^^][\\[ZZZZ\]]^]]\[[XRYГЃвэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€д†kZ[ZXWWYXTTUSPPSUTPMQQPNMNMNONHGKHFHFDBDA?AA?>>>@?>=<;<==>BHHKPSUX[Z[\]\Z^`bdgmЗ≥с€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жґя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–ЖtrҐ™Оystvsnga\\X_Чи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€ээ€€о’анллл‘≤ҐЦsA+*)$  "%')(%" !'/:=@CBGPXaghkpttuvusvz{yvwwwyz{|zz{{{yy{{|zj\]pХЄ∆≥ЩФПЛЖ}uonj_UINj|~}~~{zywwwvuussqrpmllmkmx}z|~БДЖИКНСТЦЬ†¶∞≈÷‘Ћ√Љ≥™ЮЫҐ°ЭЭ†ЮЫЮ†ЯЫЬЯЭЬЬ†•£ЯЬЩЧРЙЗ~uneYL@>>>923556632265/-4?EOXY=/=DKRXeU(&EL=,"$:cyxvuttwx{|}ГЕЗЙКЙКСХЧСНСТРТТТШ†§ЫЗxa8  !'&('9б€€€€€€€€€€€€а}3")]§ЈНYJNOJFGIBLСе€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эью€€€€€€€ю€юыэ€ю€юю€€€ЉyomkjjihjihggiЗЇ’√БQLNNLLPSSTWXXWYZ\___``aaaabedbbbdc`aba__b`_^]][\[Z[\\]]]^^[ZYTSmЬїл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ёТg\[XWXVUWUTUTPORSUSQQPONMLMPNKJGIGGHEEDDC@?@A?>>>=>>=<<==>@DFGHMPSX[[\[ZZ\]]`cdjzҐз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€р–й€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“Жut|°™Иvvvvvpha^_Y^Уе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€ээ€€хЁ”ЁжйяјЦyfQ9.+(#!  #%&('&"!)/5<@CHU_dgkmquvwvvxxyyzzyzz{zz|}{{|~{y{z{|m[\pЩЊ…іЪУПЙД|vrlf_VMPj{||}{xvvutusrsssrqommkjjlt{yy{ВГЕИЙМППТФЧЪІњћ∆Љ≥®ЫЦЮ§ҐЮЬЯЮЭЯ°ЮЪЭЯЭЭЬЬ££ЮЬЧЦУКД~ulbWOC@>:767845533231-/9@EPYW43>BDN\eO&4IG8) "+Mryxxssvw{}|АДДЖКМОСУСОНТХУРСХЭҐЬИzmK&   '(((4uЁ€€€€€€€€€€€€а|2"*^ҐґНUGLLLIGG=GПг€€€€€€ю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€юю€€€€€€€€€€ээ€юю€€€€€эљznljikighigffgГґ‘≈ГPMSPMNQSRTVWWWX[\^_`a``aabbdcaadfdc``ba``a_]^\[][Z[^]ZZ\]][ZYRXБђёь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏКe][YXXVUUTSSTSQRONPQPQQOLJLPNJMLHHFFHGHGEC?@CA>>>>>?<;<==>@AEBCJNQUZXXZ[\[\\]^`acoШќь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќАvv~®ЃЗtx{xuohda`Y_Хж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю⬬џкўѓyQ=51-*'$   !$%%#"! #+19AFNY`cfimqstuvwyzz{}~zxxzz{}}{{}~~}|~{i\^pЫњ…≤ЫЦПКЖ~yrme]XNPixyxzzxvusrqrqpoqpnmkjigijoyzxy}АГГЕЗЙМНРСУФЧҐіњґ©ЬРХ£¶£ЯЭЮЮЯ††ЭЫЭЭЬЫЫЪЮЯЭЪЩФРЙАzul_UOC==;73343550/373,.59DRZT-1:?HR\eH4IC3&! #6^yzzwttwy{}АВДЕДИНЛКМНПФЦФРФЭ°ЫМ|pT3  %)(%1qџ€€€€€€€€€€€€а{1")YЯµНWGKJKIEFAKПяю€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ююэьюю€юю€€€юЊ{nkhilhfhiffghГµ‘«ГOKOMLPQQSUVWVXXZ]_^`aa``aacddcbabcca`aaa`_`]]\[\\Z[[\\\]\\[YURjЪЇи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷Жb\[[XWXWTSSRTTRQQONQQRSQOLMOMLONKJIJJGIJFD@@BA?=@A@@<;=<;<>>A@AFILQVVVX[\Z[]]]^^`dkИір€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕАttД≥ЃГswzxtnhe`]X^Ыл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€ш„Є≥—йбґyG1.,*'$$""!"$ ',3!=J=* #(Dkyyyuruwy~БДЖДЕЗЗЖЗМООУУСФЫЮЩОГwZ6& $'$ .k‘€€€€€€€€€€€€бz0$*XЭµНXIMJGJLH@MТяю€€€э€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€ю€юю€юыъэьь€€€эЉxlkjhigfhjgfhjБ∞”»ДQLMKJMOORUVXXXY[]^^^`a`abcbbbda_ab`a_^`a_^``\\[[]]^^]]^^\\[XRYГ≠”ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щј{`[YXWVVUTUVSSTSRRPPRQQQQPNLNOMOONONLJHHKHCCA@AA=?@@?=<==::=>=@ACEFKQTVYYYZ[[[\\]afcg{§ж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќАstЛї±Аryxvsnf`]^W`Юл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€€€€эЏђђ“кяЈL2*(&%#  "   "'*2=KX[\`bdimopnputvvxzwvxzyz{z{~~~}~Б}xgY]pЫј…≤ЧХПИЗБztkc]VJOhuvwxvwwuroonjjjhihebbefeeemz|yz|}АБГЕЗКМНННТЧЩ††МГУ•©ІҐЪФХШЭЯ†ЯЭЯЯЭЭЮЮЭЭЭЫЫЦМД|wqfZSIA><976201234333,).7>HS]M#5=BFQd`7 'DI5'#%%/Ppxxwusvz~БГЕВВЗЗЗИКНОСТЦЬЯШИ}zc9"  #'#!)Y≈€€€€€€€€€€€€б{2#)ZЭ±Н\KNLHHMKBKРж€ыю€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юээюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€юю€€€€ээю€шрхэю€€€€€€ЉukmliiiiijhghkВЃ–«ГRMKIHJQQSVUWYZZ\\\^^^_a`abcbbdaaba``a`aa``__^\[[\]_`^^^^^][TPiЩЇж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€д°p^ZXWWWUSSTVUSRSSRPPPOOQUPNMKOOOLKOMJIHHGEDDC@@B?=>=@?<<=<;;<=>>@BBFKPUYXXYYZ\\ZZ`cabfrЧ„€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕВuqНƒЈБqwxvqmgaa^Xb¶с€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“Ъ¶“каєВU=.)&#"   !  #%$&)-5APVWZ[]_dhiintrrttvuuwyyy{yz||}}|}|zyi[]oЩњћЈЩФРКИГ}ule^VJNgvzywussuromkghhfhg`_`bcbbahuzxyyz}~АГЖЙЛЛОПСШШЪУВЗЭ™ЂІШБruДЦЯ†ЮЮЯЮЭЮЮЬЫЭЮЬШРЙЕ~vofYKDB><:76533754431+)/6?JV^H(4>::;=>=?BCDGLQRTVWYZ[[Z[^aabbdlМЉс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“ВonР≈єДotxwqlfca^X`Ѓш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€п≠ЗҐ—ибљДZH=3+#   $"  ';GGA@BDDCENTVZ^abgikoomnsuutvvxywx{}}|{||}yh[^oЩњ…µЧПЛИИГ}unf]VORhwyyywurrpomkihhfgeaa`_``__clwwwwwy~~ЕИИИККИМРНЕГТ¶ђ£ОnPEToМЯҐЯЮЮЮЭЮЮЭЭЮЭЫШСЛД}smeXKEB@=979855542022,+18@LWaF-5>FNWg[02A>2((++9Zrwwvpls|ГЖЙЛКМПРСФЧШФПЖЗҐ÷µB   !*)%$BҐц€€€€€€€€€€€в2"*UЪЈЩ^HLLLGFGBLПг€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€эьюыы€€€€€ю€ьЇtkjjigggiihgijАѓћµtLKJHIMPQSSSWVY[[ZZ\^^_`_becddccbccaa__`_`_]^]]_^[]^]]]_cc\TObТ≥б€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏКeZZYXXWVSSTTUTPQQONOPPTUQPPNLHHLOPOJGJJJIIHEDEC?@BDC@?@??>;;<>>=?ABCEHJKQTVYYYZYY\_aa`ach}Іи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–АopРЅµДpuxupmifeaWc±ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€џЖw£“иаїДZLG?6-% "# /H[aa^VC20137>FNT[beglptxwwyzy{zxxyzz|||}~yg\^nЧЇ»ґШПНКИБzsme]VNRjwwxyxvtssromjjfbbcaa_\\^__^etvstsw{yy}ВЖЗЗИГ}ГЗЙУЯЯФГt[@:OmОҐ®ҐЯЮЬЬЮЯЮЭЮЭЫШСИxrj_UNFA===97:<:973230+*1;EP[\92;@CL\jV7<9&+;<2,./*3Smwyvoknu}ГИМЛЛНПОММЛЕ{zѓт€—P  (+%#=Ни€€€€€€€€€€€б}2"(SЫЈХ_HLIHGHIAKСбю€€€€эю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€эюьэ€€€ююю€€юььэю€€€ы€ъµqjjjifffigffgjЕµЋ∞pJJJIJMPQTSTVUWZ\[[\\]^^^addffebabddc`^^^__]__]\\\]__]^_a`ZQQt§ѕч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЋАcZYYWXXWTTSRSSQPSSPOPOONNNNKKMMMMNOMJJKLMKHGFFCCB@ACB@A>=====>>>??=@DFEEJPSVWWYY[\]^```aadrШб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–АssРЊ≤Дsuwrpplfb]Ue≥ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€…dj¶’каЉДXJFCB@=3+#  (! 0Vv{qdZTJ?83-259DJYwНУХУСОКЖГБАБА}{||{yzxi^_oХґЅ±ЦППМЖ~xqle`VKTlxzzyxvttpopplkg`_ab`][[\\]]^kvqopsvuuw{ВЕЗМЛИНТТТОЕ|r\O\wУ¶≠®†ЬЫЭЭЯЮЫЯЮЧФМГzuqg[UMA:99;<;8630/,-29EO[X.3==??<<<=>>=>BCB@BINRTVYYZ\]]__^_]^akПµл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕ~rtСЊ±Гtwupmkf`[YTgѓу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€ч†Hb¶‘йяљДTFFDDEGGD;1+''''%$'(%$#!(42 &dЖЛМЙГА~{ska[PIIDXЕ≠≤™∞ґ≤Ђ•ЮЧТСНИДГГБ}yg\_pХµ¬±ЦПКЖЕwqic^VNTlxxxwuvuspoqqljjgdcdb`__^\]_^cqrmnosrtvx|АДЛМЛНМЗБ|АЗЛЖГ{hi~Х©іЃ°ЭЭЭЫЬЭЬЭЪТОКБ{vne\SJC>?>=;:=?A>8620/-/5=?>=>>>@ACGIMQTVWWYY[\\_^]^aeqХ”€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»|qpМЄЃЕvvsokgb_[WRe±ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€ээ€еw9dІ“кёЄВVGDDCAFKLJD?868:@KPTUVVROT^T0 KДХЫЭЬЬЬЬЭЫЧФТНЙГ~ЖЫ±єЄњ∆≈»«ЊЄЈµЃ§ЪЦТЛЗЖi\brХЈ∆≤УЛЙЕЕБxnfd_UKPjxwvttutsrqpnlkjiefgddc`]^_``aluomoqrrtwy|АЖЛЖВЖИЙНТФУРПЙzyЕЦЂЄ≥•ЭЭЭЫЫЪЪЫЦПЛЖА{ukaZTIB@@@=>@BBA>8861+*-3:BP^Q '3:@FRcbHКу€€€€€€€€юр√ЧЕm[I;>Unyyxz{zzz{xttt|ОІ”€€€€€эЭ&!  %)'$-e”€€€€€€€€€€€гВ8%+Z†ЈРYLRMHKKHAJОе€€€€€€€€€€€€€€€€€€ьъю€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€юэюээ€€€€эю€€€€€€€эю€€€чіtplihiihgefhggЙєћ≥sIHILNKMRUVUVXZ[[]]\\^_```aaaaacdcaabba_`_^_]]^^]\[\]_b`\VNaС≥аю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ёПk_Z[YUTTVUTUTRTTRRTSSPNPNOPPQPNLKJLOMONLJIJJJKIGBEGDCDDEBA?==>>>=;::?C?>?A@DGIMPTUUVWZ\[[\\]__ajЗ√ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћ|rqМЇѓДttrnje_\ZXSdµы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээъћ\3k™÷кёЄВVFDEC?DJJIKJD>;86>KZlЙИБ|АГpH-xЪ†§¶ІІ™ђЂ©©©®®¶ҐЬЬ°Ђ±ґЅћЋЋ √¬»ЌЋƒњїґ≠†ШКo\_pХЄ≈іХМКЖЕyrgc^VMRjxvvvttsrsqnnnkjjhhhecc`\]__^afrsmptrnpvxyy~ИЕАМЯЃ±ђ•†ЬШОЕГМЪђЄµІЭЮЮЬЬЫЪЪФНЛЗВ}uja[RIEBABACEGHDD?:72-*.6>FS]I+5:@HSdZJ§€€€€€€€€€€€€€€с‘іҐЧСЧЮЫНГ~|zxyz|ЗЦѓ„э€€€€€€€ѓ1" "(($+[≈€€€€€€€€€€€бА8$,]°ґМVLPNIHJH?IЛ№ъ€€€€юю€юю€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ъъюю€€€€€€€€€€€эю€ю€тѓspommjggfeedfjЙЄћµrGIJIILNSUVVWYZ[[\]\\`a_^aa_adcadcabcba```^]\]]]^[[[Z_c_YQS{®ќч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€„Еg^ZZXVTUVSRSSTTTRSTRPOPPPRQOPPNONIINPONMJIKMNLHHHFGGFEEGE@?<;==:::;;>BA@>>?AEEEHKOSVVXZ[ZY[]\[]`gГЇт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќvpsНїѓВsupkhc`]\ZScє€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кЩC6l®÷зяљГSCDDADHIILLJFB9.  -XЧЇЇ∞®£†ЫЛ`* RТ£¶™≠ѓ∞±іі≥і±іі±∞Ђ©ђѓ±µЈЉЉЉњ√∆Ћ——Ќ Ћќ √љ£sZ[oЩљ«∞СРПЖВ{qic]VOTjwwvwuttspnnnnlkkkhfeb`^\]__]]^iwsruroptuuvyББЮ√ЎЏ÷ќї§ЧСННЦҐ≤љЇ®ЭЭЭЬЫЪЪЩФОЙЕБ{tmaZSGACD@BADKMIFA><6,(.;FMW[=,49CMVeVNµ€€€€€€€€€€€€€€€€€€€€€€хџ√≥™ҐЫЩ†і–н€€€€€€€€€€њ>  "''$*Tї€€€€€€€€€€€гВ7&-]°ґНWLOMJFII?FЛџщ€€€юьэ€€ыъю€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€юю€€ю€ээээ€€€тђpmmnmhfggdddejИ≥∆±rIHHJJMPRTUWXXY[Z[\\^a`^^``_adcabbced`_a``^[[]\[\]][Z^_[WM[Рµё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыЅ{c\ZYWVVVURRRUUTTSQRQOSRPRQOPPOMONJILOMKKLKJJNMJIKGEHHFGGDAA?<=>;:;<>>>@B>;=?@AACGIKRVXXYZZXYYX[_`eА©е€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эь€€€€€€€€€ xrrИє±Дsqkkib_][WPfЉ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўp0=o¶‘жёЇQB@@CJMJILMHEA4% W™ѕ—Ќ»«ЅєЈ§}Q.6}Я•™Ѓ∞іііµЄЄєЇїєЄЈµµЈЄґЈґЈґµґєЇњ∆∆≈…Ћћ—ѕ«™uZ]oШЊ«ѓНИКЗЕГ{qke\TMRhtvvvuutspmljkjiigdaa_\]][\][\\`lvwxyxxyz|~~А{БђЎжллжћ¶ХХРПЫ®Ј«Ѕ™ЮЮЭЫШЧЩЦУПЙДyskaZRJECBADDEJNNIEC?3''0@?==<>?>=AA=;<>??AEEHNSVXWYYXXYXY\\]cwЯё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћzpoЕЄіГopmkgc^\[XRfЉ€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€ц±O$@s®”жџі|P@?ABGKHGJJIF=1"sїќќћЌѕЋ≈≈√ґ£ЖdJ24eШ©Ѓі≤≥ЈЈґґЈєїїєЇЉњЊЊЉЇЉЉЇєЇЇЄґіЈЇЇїљЉљ«∆ј®v[_mУЈ¬ЃНЖЗЕЕДАukd_VIPjvwwxwuusponjhhgfda``][\[YYYYZ\\`ktx||~ГЕИКЙББ®‘екни…£ЪЩУС°Ѓљќ≈™ЮЭЬЩЩЩЧХУМЖДАyqg]WPIHFEGEEINTQNKHC6)(0;CLZ[4 29=EO_gVЛр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аi  ()##D£ч€€€€€€€€€€жЖ:',Y•ЊЦ^NROHIKJDKСаы€€€€ьь€юэю€€€юю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€эю€€€€€€€€€€€€€€€ээ€€юэю€фЃmlkigghjigghfnР≥«ЈsJJGFHJNPQRVVVXZ\\Z]^`a`]]_baaa``bbceb_^__][\\]]ZZ]\^`[WNOБ…ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жЮra]\ZXUTVVUTRSTVUUSRRPOMMLNPPPRROLLOMMPOPPPONKMNJFHIFGFHHEFECABB>?@;<==<=@@ADJNSUUWZWWYWWXY[\_oРѕ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќyqqГ±Ѓklljfc`]YWReЇ€€€€€€€€€€€€€€€€€€€€€€€эъь€€€€€€€€€€€€юю€€€€€€€€€юыь€Ўx-#EtІ‘е„ЃxM;=AADIHIHIJE<*<У≈ЌЋ…ЌЋ…ћЌ ∆√њµ©ЯХЦҐ≠≤і≥ЈєЄЄЇЇєЇїЉЉЉљЊЊЉљЊљїєЉљїЇЇЇЄєїєЄЄєЄЄ£sZ\kФє¬©ЙЖЗЕЕВАvkd_WMUvИГ}}~ywtqqqlhfdca__^[YXYXWVXXXZ[^gorsxz}АГИКЕЕ§ ўёи軆ФУФЩІїќ”јІЫЫЬЪШШШХРКГВ~vof]WOHGKJGFJMPTQONMH8),6>GQ\V,29=BM^cN]ƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цП$#  (*%#>Рй€€€€€€€€€€дБ8'+Y°ЉЫ`KQMJNNJAHПаю€€€€€ю€€€€юю€ьь€€€эыэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€эыю€€ыь€юю€€€€€€юю€ю€€нЃqlljighiigfhhpС±¬≥tJGFGKLMPRUWWVX[[ZZ]_^_``_`bbbaaaaabdc`]^_]^\\^\Z[^]\][WN\Щг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аТn`]\ZXWVVUUUTTUXVSRRSRRPNLNPPQQPMKMOMLMMMMKLLJKMKFFHHHEFGFHFA>A@=?@<<=>??@=;<<<=?CJPSUVVVUUWYYXYZ[]hЖЈо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∆uqpДЄ≥Вnmljfba]YVPdљ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€ээ€€€€€€€юьэшыц≠N&Hw®”еЎ≠tI8:>BGHJJGJG?7# ^ѓ…ЋћЋћ …ЌѕћЋ  Ћ «љ∞±µґЈЄЈїЉїїЇЇїїЉЊљЉЊЊЊљЉљЉЉљЊљњЅјњљЉЉїЇєєЄҐrX[lУЈ¬®ЖДЖДВ~}wlf]UL`У™£ЫЧУЙАzvtrnkfeeb_^]\ZWWVSSWWUVWX[cefknpuwy}~ВУ°®ї—„ЉОВЗЗЧ∞ћбЎї•ЪЩЫЭЫШШЦПЗГА{rle\VQLJIJILPNOSSSUVP9),6?GU^P! 18>CM`^;Oƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ђ/!%  &(%#7ё€€€€€€€€€€гА7%-[°ЄЩcLQMIKMIAKПёь€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ычь€юэ€€€€€€юю€€ю€ф∞rliijifdhheghrЦґЅЂnJGEDKMNQRRWYWX[YZ[\^_^]^``_cc```aa`aba_^]]][[[[Z\\\[YXTPm¶д€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷Лla][XXVVWVTTTSTUUTRRQQRSRRPOOOMLLLLLKHJJLJFJJGHLMIEEGFDFHFDDA@@>>=<<;:?A@?><<<;<<;;<@CEJSWTSUTVXWTVZ[\^d{†а€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈uqpЖґ±Дomkigba^ZWPeґъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€юыю€€бА1)It¶ѕгўЃpC58=BEIKHHJD;0 ,Г¬ћЋћЌћЌЋЋЋћќћћќЋ∆Ї≥ЈЇЇїЉЉЊњњњљїљЊјњљЊЊјјљЉЊљЊЊјЊљјјЊјјЊЉЉЊјї°qY\mУЄ∆≠ИВГ}|}wme\TNh£љїєЄµ™ЬФМЕytqmjhgc`\ZXWSQRUWUTVWX[[Y\_cgdfijpvxКЈЎЏЉОАГЕЬ¬Ёе“≥°ЬЫЫЪЬЫШТНЙД}wrkcZROKIKKLNPPRTUWZYO7*19@@=<;;<;99::<==@DKQTUVURSTVVYY[^^`oТЌ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€«wqpД≥µЗmmihfc`]YVQhƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фїd#,JmЪ«я—£h>/3ERYC&04;CPaU6|т€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€«? $!  '-*&.gЌ€€€€€€€€€€жГ8&-WЫµТ[NSQMKIGAKОяь€€€€ю€€€€эьюю€€€€€€ю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юю€€€€€€€юэюю€€€€€ц∞plkggihfgihgdtЬіњђkFDHJHKPRRTUTVYZYYZ]^]^__]^`baca`b`^`ba_`_]^\Z\][[[ZXUQOfШ≈р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хЊАe`][XXWUTTVVSSUUSSTSQQQPRRQNMLJPPNOONMMKILNKGILHKNLKLMKGFFDCAA@@><==:=?>>>><<=<:<;89:;6#rњћЋЋЋќѕЌќЌћќѕќќЌћј≥є¬ЅЅ√ƒ√Ѕ¬ј¬∆ЅјјЅ√≈∆¬Њјƒ¬јЊЊјЊїЊњЅ√јЊЊЊј¬¬ЉЯoZ]jТЄ¬™ИВБyy~}ujc\TLh†ЈєЊјјјњјЅљЄµЃІ§•®ЭЕiRJJJLMJJQUSSTVY`d]WYXVLEDGNdС∆зж≈ЬС°Љ÷Ё”јђҐЭЪЩЩЪШЦФПНИБ~ypg_YPHKPPQRTTTVY[\\]N3+3@?>=;:2  ?Ы… ЋЋћћЌЋЌќЌќѕЌќќ…њєЉЊЊ√ƒ«…»…… Ћ…»∆≈∆≈√ƒ¬√∆ƒ¬¬јЊЊјјј¬ЅњњЅјј√ЅЊ£mX^nУЄ≈ђЙГВyzА|skc\SKeЫ≤іЄЄєЇїЊЊљљЈґЇєє√јЧ\;6;<>@>@HJJLLNQZhi^\]YRMLLThТ∆йењЯЂ≈““»єЂ§ЯЬЪЩШЪШЩХПНЙГ}wof_WOJMQQSTUVUX[^^[ZH-)4>ER\X2-03;FWbG<•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ў] &' &)+')Rї€€€€€€€€€€еГ9%+TЯЉЧ\ILIGFEEBJЖ÷щ€€€€ююю€юю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€юю€€€€€€юэююэыы€юьююэ€х≥qmmljheefgggfv£Љ¬ЃjGIHIILQQSTTVXYZZZ[Z[\\[Z__^^^_`^_`bca_][^]]^[Z[YZ\[UOPcСµа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€й£vb^\[ZWUUVUTUUTUUVUSRQOPRPPOOONMNNNNOQPLJKKJKKLGHKJJLJFEGHHIGEBAB@=>=;><<<;:;;<;:;<<=?DHLPQORSQRTTUUVX[[avЩЎ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юƒupnВ±єТommifd`][UOkЅ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€рќРB#=Ubz§¬іВN//8<@FGLNIF=*kЉћЋ ЋћЋ ћќќЌћЌЌѕћ√ґ≥ЄЄЄєїњ√∆ ЋќЌЌћЋћћ»»…«∆ƒ¬ƒ√Ѕњ¬∆√Ѕ¬ƒƒ√ЅЅ√¬њљ†mY]nХЇ≈ЃЛЕВyy|ztkaZQMhЯЈі≥≥≤≤≤≥±≤µѓ±їЇ≥іµШV% $$(+,.35:>?ADH\kd\[VNLOSYkТ«лиЅ£Єќ»ЇђҐЮЮЮЮЫЪШЦЦХУПЙГzvme^UOLOSTRRTVZ[[\[XS?+-8?GR\W* 017>EW`DF≥€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еr!!(' #*,&&K≥€€€€€€€€€€еБ7%)UҐЊЦWINIDDEF@IЛџь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€юьэююю€€€€€€нЂoknmkjgeeheddt°Њ√ѓkCEEJKKNORTTTVXYZZ\[Z[]\\__]__^^^``^cb_^]^][\\\\ZXWXTOUw•∆п€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жЧpc][YZYWWUUVWVTTTTSTTQNPSRRQPNLLNNOPNONLLLLLNKGFIMJFHIIHGGIIHFDEEA?@@@@>FR]U& !.17>IZZ9BЂюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЛ'"%& $+-'#@§э€€€€€€€€€зВ4$+Y•ЊШWGMJDEEECMМџъ€€€€€€€€€€€€ю€€€€€юю€€€€€€€€эь€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€юэю€€юююь€сЂqnnkjkjgffdddv£Ѕ»≤mEEEILKKNSUSTVXZ\[\\[\^_\]`___^_^_a`___^^[[Z[[[][XWVRO`О±Џэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЁМlb_[YYYXWUVWWVVUUUUTUSRRSSPQRPNOOOOPOMNOQPOMNJFGJMMIFJJLKIHFGHGFEAAB???>=@>::<<;;::89<<<<;=>?CBFKLKKOOQPQRSUXYZ\d∞к€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьљmoqАЃЉЦqiihdc`Z[WNiƒ€€€€€€€€€€€€€€€€€€€€€ю€€€€€юьь€€€€€€€€€€€€€€€€€€€иНA 0CNcГі‘√НS1,5>AFJHHE>0 [≥∆…ЌќќЌќќЌЋЌѕ––—ѕ Ј•¶©ђ©§•І®Ѓ≤µЇї¬≈««« ЋЋЋЋЋ«««≈∆∆«≈√ƒ∆≈∆«»«√ЅЊҐp[^mТµ¬®ЗДГ{wvwrjd[RKh§љїєЇЇЈіі±™І¶§††ЯЮЮЩКzmcWHK_Q% "&-./6@PZXODBHTkУ«идЅЪРСННМЛСЧЧЧЪШХФСРПКЕАzvqkcZQKKNTSTVVVVVUTTN>/+/9@HSZO !048=I_Y4>Эимх€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь¶/ %&! $*-)#5Рт€€€€€€€€€йЕ5#+Y£љЧXHJFBDEFAJК÷х€€€€€€€€€€юъы€€€€эыю€€€€ю€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€ю€юююэь€юэ€€€ю€у∞pnmlkjjjgeffdw®¬«≥oIFFJLLLORSTUWYZ[[\\\]``[\__]]`_^^`b_]]\\\Z[\ZZ[ZXXWQQpҐ≈п€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЄГjc\[YZYYVUUVWVTUTSSTTRQRPNMRRPRPLKLLMNNMLNMJJJJJIJNKIJKNLKLKHIIGCBB@?=?A@??<;?=;=;:98:<9:<:9=?>@EJJJJMMNPQSTSVYZ[`uЬ’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈rpp{©ЇЧqjljdb_\[XOk«€€€€€€€€€€€€€€€€€€€€эы€€€€€эь€€€€€€€€€€€€€€€€€€€€аi( 9EJaЗЄ„«ПR.-6>DKLJJD:)(Ж≈…ЌћЋћЋћќќћ≈Ї≤ђ≠≤∞ЯЮ•§Ґ°Ґ°†£¶™Ђ±ЄЉњљљњ¬≈≈ƒ≈ƒ≈«»≈«… »∆≈∆«»≈≈«≈¬ЊЮmZ]oЧЇјІЙГВ{xvuribZQKk®ЊњЊљљїЈЈµ∞ѓђ¶£ЯЭЭЪШТНМКГyxЕ|U@=72..*(&(2JYTHABMgЦ збЊУy{АЕДЕКМРХХТРПОЛЕБ}xrmf_WQLIMPRTTUUUSOMH>4+,4;CKVZG'016AP_S2IЦєЈЌтпухуш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≤2 %'!"(+(#2|а€€€€€€€€€йЕ6#(U†ЇХVGHB@CEE@JК÷ц€€€€эю€€€€€эюю€ю€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€юэююьююьэюю€€€юэ€фѓplmjjjiihdcgfy©ƒ»≥mFDEIIJNQRSSTVXXXZ[[\\^_]]]^_^``c`^_]\][\\Z\]\\[ZVUTN[З≥‘ч€€€€€€эы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мЂ}ha^[ZZZWTUWWVTSSRRRSSQPRMLQSQOOOKHMMKOOKJMJIIHJLJIIGJKILLLMMJIIGCFEBA@>?B@@>=>@><::9:;<::;88<=>>EHEGKNMNQQRRQSWXYZ^rХ—€€щх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈soo~™єХqklhcb_\YUNk…€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шЈD )?BE`ЗЄ÷∆НP,-7?EMMMKB5" H®»»ћћ … ЋќћїУohegklsН†ҐЮЬЬЭЭЯҐ•¶ЃЄїїЇїїЉљњЅ¬ЅЅЅ¬≈ƒ≈«   ЋЋ »…»∆«Ѕ°lX]nЧїƒ©МДА|xtqngaYRMlЂ¬Ѕјњњљљєґіµ∞ђ©§°ЯЬЬЩУСОМЙЖЗЕ}uplf^ZQGBBENVTPF?IhШЋжвљНrhmtz{|~АЕЙМНПНИДА{yuoh_ZSJBBEOYVROPOLG=71*'+4<9:<=<;<<;:;<<=ACCACLMMMOPQPMQTUUY[^kЗ €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЊqon≠ЇФpkjhda_[XUQn…€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жu-3B==\Иї„ƒЛP--6>EKLMH@/mЊ»«…ћЋ Ќ–ѕјҐЙЕЖИЗyhpДФЧЦЧШЩЬЫЮ°§ђіЄµЄїЇєЇєїЊњјЅј¬ј√«««» ЋЋ ЋЋЌЋƒ£nY]qЫЉƒ©ЙГАzwrnmh_VPNp≠¬јљЊњјњєЄЄ≥Ѓ≠Ђ®¶ҐЮЭЮЫЧХФТПОМЙКЙМКЕГ}w{}{qeXQLENnЯќжбЄЗfY^ekosuwz}ГЕЖГБ|xuria\VMB;=CP_\NHJE@9-&'&(.4;DOYV5-.2;HT\B/p±їљЊњ√∆ƒƒƒњ¬ƒј‘цтуух€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ D',' *-,'+eЌ€€€€€€€€€е~0&RЮ≥СQ=BC@BAA>=<<=;9<<;<>?<;?=?@AGLMOORRQPQTTVXZZ\b}≤м€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьњrooА±їТnjhebb_ZWVTr €€€€€€€€эы€эы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы√O 9C:5WЙї÷∆ОP-.7@GKLJD:'3Х»» ќЌЌЋ≈њЉњЅ«ћѕѕ∆ІЕБЖДГЛРТФХШЬЯ£®ђ±≤ЈЇЄЈЄїєЄЉЊњЊљЊЅƒƒ√ƒ«»»»…ЋЋЋ…§lZ^tЭЉј¶ИБ|qklg^WPMnЃ√ЅЊњ¬√њЇїєі±Ѓ™®І§°††ЯЭЫЪШЧЦФСТУЧШХУТФЦТЙВzkZKGPo°ѕжяЄЖ\HKT\aehlprvz|yyzwtrmf]VQF?<>DWg`L><:2+"$(.9=@LYS,"/19@JVY;,lЃЇЉњј¬≈∆√ƒ≈≈»…¬ј√√Љќуоппуюю€€€€€€€€€€€€€€€€€€€€€’Q %-' ).-()\«€ю€€€€€€€зА0$OЭµУK9A?=>?A=GЖЁээ€€€€€€€€€эю€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эыэ€ыъээю€€€€€ю€ьыюююэььюціoihjigjjfgihewІ¬«ЄqBEGGGILOSUUWXXYY[[ZY[\\[[[^]\]\]]]]^\\]]^]^]ZZ[[VQPcУЈя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бРqg`^^[YZXVVWWXVTUUTRTUTSSRPSSSRQOMNMLNKKOMJIHHKKIHKMIIIHGGHIJLIGFIIBCGCCBDBAA>>?:::98:;::=:8;:=?=>CHKNMROLLOQPRUWWXY^tЮ‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щЉsonБ±ЈМligdcb_[YUQp €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мГ3+@B85XЛї÷…РS11;AGIKGD5 bљ ƒЅЇ≠£ЫФЙО≤‘ееизў≤РНКzs}ДИМППУЫҐ•¶Ђ∞ѓ≤іµµЈєЄєЇїљљЉЊј¬њЊЅ≈≈ƒƒƒ»«Ѕ°jW]sЮЉЅЂИ|zxtomoh^YPMl©њњЅњњјљЇЇЄі≤≠©І•§Ґ££ҐЬЫЪШЩЩЩШШЩЭЭЬЫЮЩЛq\bsxlWGLkЪЌзяЄДW;;BHOV[_behkhlpnjkje`YTOD<<@QnraF3.( %0<=BP[P&%006>MZV31{ґїЊњЅƒ≈ƒ√≈ƒ≈«»≈√« ∆√љЊЊїЌпзмоому€€€юю€€€€€€€€€€€џ]%#*) &,+%'Wњ€ю€€€€€€€йГ1!MЮЈТK7><=??@=HИ№ю€€€€€€€€€юэю€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ююыъь€€€€€€юю€€€юю€ююю€цЈpkifgghhhgghhu•≈∆ґqEDEFGIHMRSUVWXXY[ZYZ[Z[\[ZZ\\\[\]^\]Z[^_^^]^ZXZWRLQvІЌш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьѕИnf_[\]]YYWVWWWUUVUSTUUTSRQRQQPOONNKKMOLKNMJJKKJHKJLLKKIKJIILMKGGIIECDFEFEDCB@?@?==<;::=>;;<=<869;<<:=@CFJLLIKIKOOOQUUVVW]pУЋ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цґtomА∞ЇЛlligea`^[VRn…€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы∆P  6EGIP`ИЉџћСV=9;BGFJHA.0|¶ЧЖue^dgmqy†“ййккЁєЯҐЭКБВВБГИЙОУЦЫ†§І©Ѓ≠≠≤±±іііґЄЇєЉЉљЊљњЅњјƒ¬√≈ЊЬfV_pШЉј£ДВАzursqj`ZQOp™ЊЊјњЊљїїЄЈ≥∞ђ©®••ҐҐ°†ЫЪЪШЪЪЪЫЭЮ°°†§ҐНf7#-GcslZTjЪћзёЈГU80149>FJMSY[Y]a_^]\ZUNID?=?PoАwaA& '/7>IRYJ)016AM\T/9ЕЇљљЅ¬¬¬Ѕƒ«√«»«∆ƒ≈ƒƒ≈ƒ≈ƒЅЅЊїЊљЊљѕрмзл€€€€€€€€€€€€жs($*+ $,*'*Qґ€€€€€€€€€иА0"LЮЄТL7><:=?@@JЙЏъю€€€€€€€€€€ююьюю€€юю€€€€€€€ю€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€юьь€€€юю€€юэ€у±nkgfgijiieehiv£√…µmDCBDGGHLQSTUVWWXYYZYYYY\][[^]\\]^\\][[]\]^]\[YXTOM^Кі№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€п≤Зjca\Z\^\[ZXWVURSVUTTRRTSSRRQQOOONOOMNLJMPONLKJHIJIKJJKKKKJHHJJGGIIGDFHGGEDCC@>??>>@?=IRXD'/19BP]Q+@НїЊњЅƒ≈ƒ¬Ѕ¬√≈»«¬∆∆ЅјЅ√≈∆ƒ√√≈¬ЊЅ√¬ЊњљЋнйзйзо€€€ю€€ж~.$,+" $.-*,IЂ€€€€€€€€€иБ/JЩґРJ5==::=??HЗџы€€€€€€€€ю€ююыэю€юэь€€€€ю€€€эю€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€юэю€€€€юыы€хіmjiiihhgfcchgr†√ћЄmBCADFGKMOSTTVXXYZZYZYZYZ]]^_\]\]][^_^]]]][ZZZXWTOQnЮћш€€€€€€€€€€эы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€о≠Бgb_[\\Y[XXXYWTTVTSTSQRSSTTRQRQOONNOLNKJMOONKKIGLLIIIJLLIIJJIJIFJHEFFGGHJGFDCBA@CB@@@?>=<;;:9:<8:778::>CDCFLMNILOMOOPQPRUWY[d{©ию€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уЂmpo±іЗjjheca]ZXURt—€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЅO!4DE]Я¬єЊ”№ƒФvun_YYYVUK4&!&'$)M_kДЬЇЏезклв…ґѓ©ҐХДyy{|}БДЖКННРУЦЩЬ°°£¶®Ђ≠ѓ∞ѓ≥ґіґЄЇїљЊљЊљЉєЧaV_tЮЇљЬГЙВywwtph_YPNpЃƒƒ√¬ƒ√јјњЇЈ≥±∞≠®І•°ЯЭЬЩШЦЦШЫЫЩЮ•©Ђ®ИM (NeoyЭќдЏ≥y@$%"""%"#&),142446310*)'$*HЕЏэ€€€€€€€€€€€ю€ю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юы€€€€€€€€€юыююь€€€€€€юь€юэю€€€€€€€€ю€и®qfffgfdehbadfu†≈ќЄoBCFGHJMPQRUWVXXX[][XYZZ[XXYYZYXZZZ[]]ZZ\\\[ZYXUPQgЧ«ч€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йЬvea`_[YYZZYXVSVUTUSSSSQRUTRSSUTRQNMRQQSQPMLPNMOMLKKIHLLKKLKKJMKEEEEGFHIHKLGGFEBCEIEGC??>==<<;987689777=?BCACDFILJGHLLMMKPRSVZ[]iИ√э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъуэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фЃpqn~ѓЄЛiiklie`]ZVRu”€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щЈH 2==:XѓлнйклЏ®ИЛЕrWE:2/'"!(:XcS1"'@WqЖОЪ™≤ґїƒ»ј≤£ЦКБ}~ЖУЭЂљЄ£ЦПЛЙЙНСОНЛРФЧЪЬЭЮЯҐ¶І™ђ∞≥іµґєЇ≥РbV^x¶љљ°Вzvyxtle_WPMn≠њЅ¬¬«ћћ…»∆≈Њљїґ≥∞ЂІ£°ЬЩЧФХШЦЪЯ†Ґ••РW 7hЬ—зЏіt.    "IvЧРviM!-:=DQYQ* +06>EU[A.m≥њњњ¬≈√¬√Ѕ¬≈ƒ∆»«ƒ««≈ƒ√ƒњ¬ЅњњјЅЅЅЊјЅƒƒЅјњњ¬ƒ≈≈√ЅЉЈЯY% $** %/+*'0o«днэ€€€€€иА0!JЪіНH7@=:;>@@JИ№ю€€€€€€€€юэ€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€ю€€юю€€€€ююююэюю€€€€€эыэн±ogihfefegebdhsЭЅ»ЈoCCFCDELPOQWWVYYXZ[ZYZZZ[ZXZZYYY\][\]\Z[Z[\\YXVUPVzІ’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь‘Цqcba`]YZ[ZYXXVSUTRQRTSRTUTSSSTTPPNNQPQONNNNONKNMKKLJIKKJKLLMJJKEEGEHFGHGGIFGGEDFHIILE?><::<=<;=956::768>ABB?ACGIKMKJIKMJNNOQUWZ[d{∞тэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уѓspm}≠ЈНjjjkie^\XSR|Џ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аe& '>FILh≤йлзк鄶ЙОЗg:,-+)$ %,@[g]E.%*:\}ЛФ§©©≠±≥∞≠•ЯФМКЗИИПЪҐ©®ЯФННПНННМЛНЛЛПРУУХЧЫЭЭ°Ґ•¶®Ђѓ≥≤™К_W\y™јљЮА}wxxtlc\VOLoђњњњЉњ¬јЊЊјјЊЊњЊЇЈґі≠©£ЮЪЧШЩЩЬЯ°§©¶А=  'a†”е„≥{A *>NSTMB, *9AGSYM% ,-1?<=;??HЗЎш€эыы€€€€€эы€€€ээ€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€ээ€€€€€€€€€ююк™nkjhfddcdedehqЪљ»ЈmABDBDJLOQRWVWX[ZXZZZ[[YY[ZXYZZ[\\\\]]Z[[\ZZYUSQNaТљй€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рµНneb__^\[[[\XXVUVUTTTUSTTTUTUSSTOOOOPMNONLLNNOMLLIKOMLHIJIJLMHGIHEEEFGIGDEFDGJKKFEGHHC=?<<<9;;9977788987:<>?==ACEGHHGFGKMLLMNPVZ[\auЬ‘э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€р©vplА∞≥Мnjhhe`][XSSя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шђ= -LfrАКХ∞№нмкй’£ИОЗa1(,+%" #+/33.$$(.H_gm}МТЬ®Ђ®©®•£ЮЫЫЩЦЦФУХЦФХПНПССРОНРОПНООРППУФФЧЧЫЮҐ£§¶І°В]U]z•љњЮВВ}z{xtld^XNMpЂјњљЊЉЇЇЄґЈµґііі≥іґЈ±∞Ѓ©•Ґ°ЭЫЯҐҐ•≠§o( $^Ю—еЏ±В^@* $06AITZJ#)+1=GSN+9Лї√√Ѕ√¬√≈ƒ√≈√∆∆√Ѕј≈»∆≈≈≈≈ƒƒ≈¬ЊњјЅњЊњњЉЉљїЊјјЅ¬√њ√√≥s/"$+, !--)$'5IZШй€€€€€лБ0BР≠};4=?<;;?@JЖ÷ш€€эь€€€€€€э€€€юэю€юэ€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююь€€ээ€€€€€€€юэю€€€€ээ€€€ьи®qljigdddeccdfrЩї єlA@ACGLNPRSVWVY[ZZYYY[[ZXZ[YX[\\[ZYX[^\[\[ZZYVSPQs£“ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€р∞Еkc`_\[]\Z[]YXWVVWUTSTTTUSSSUSSSRPQPONMNMNMMLNQOLLMLMMJJIJIKMIFGHEFIGHIFEFHGHKLME?FHGC>@<;=;99989967986878=<<<=ABCDFFFHJJJMMJPTVY[\apП…ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€р©vplДµµПojgdeb^[VQQАя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дf /UpИЪ™≥±•Ївззе–Ы~uaG91+'$!#.1DSTSYchmyЗРЦЯ£•¶•¶©¶§ҐЯЮЭЫШЦФСФХУФФХТССТРТСТТСТУТТУХШЩЫЭЩ~^W^x§љЊЭВАzyzxtle_VPNl®њЉїљЇЄЈЈЈі±∞≠©®І¶••Ґ•®®ЂЂђ©•§©ЂЃѓШY"^Эѕдў∞ЕrgS?, +28@KTZJ %--4n €€€€€йД/BТ∞А;4<<;9;??IЖ—о€€э€€€€€€€€€€€€€€€юъю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьэ€€€€эыэю€€€€€€юэюю€€юэээюьл≠rmhhedfeeabfesЬљЋЈkA?ADEHMQRSUVVYZYZYYY[\ZY[[ZX[\\[ZWXZ\[]^\\YYVSOYЗ∞Ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пђБg`^^\ZZYZYZYYXVVVUSSTSUUTURRSRQRQQRPQOONOPNJLPOJKJJMLMJJMKIKJFFFDFJGHDFGHJFDGIIDBDCBBA?<==<;;<9:=8897554:9;;;=?DEABEEFKHDDGIJPSVXZ\^iЕњыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т®qpnЕ≤іЧpkjgd`\[TOQ{Ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф±B+K\dp|ИРЧТ®”ЁаЎєЕlkfgaL;0*%#"" "+0;IPZ`aa^^aehlv|ЕТЪ§®Ђ™™Ђђ™І§§ҐЬЩЭЫЧШЩЧФЧШФСЦФУХЦЦХФРТТХШСx^X]zІЉЉЪАБzy}|tkc[UMKk¶єЈЄЇЄЈііі≥∞ђ™•¶ҐЮЬЪЦТОНТЩЮ•ІІЃґї≠ЕB]†—д’Ђ}cdd[PE;2& *28>FV[C $,/5=IYJ(MЭЊњЅƒ¬√≈ƒ√ƒ≈≈ƒ¬√¬¬√≈≈¬Ѕ√ЅЅ√ЅЅ≈≈¬Ѕ¬ЅЅЅЅЅјњЊїїЇЄЄЄЄЇµЗ;"+,  (.,%%+26^Њ€€€ю€йВ.CШєЗ<4==;<=?=IИ‘у€эю€€€€€€€€€€юэщы€юьыщю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэюыъээь€щїoighfddbecbeerЫљ«≤i@BCDEKLPSRSSUXZXXZYZ\\XYZYYY[\\]ZZZZZ[_a\[YXUNPiЪЊи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€н•Аgca][ZYXZWWXYXVWUVUSSTTTUSPQTQMPQQQONNPONRPMOOLIIJJKNNKLMMJGFFHFDEHEFCFHHGDCFGEAEB@@ADA??=>?;:;9<:543258985;=;5==8:<>>JЛџы€ю€€€€€€€€€€€€€ээ€юю€эюююы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€ю€€€€€юэюыьэю€эшьчЄojihddbabcedcrЮњ≈∞gBCEFGKLMRSSTWWXXYYWZ\[XWWXY[Z\\]\\[\\]]]\[YWSNT|®–ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дЯ{fb`[ZXW[[WWVWXXWVWUTSRSSTTRRSRNMOQPNLLNMNOPNNMMNKLKMNNMLKLLIFEHGEFGEEDGHHFEFGDDCDCAA@BB@@=>=;><:88452497897;<99>B==?@DFFEDFIHJILPTVZ[^cwЦ«ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пҐytnЖ≠ЂКmkjhhd[XVONГо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€р÷†]4 Lf_[[YVUUU[kzАЖСТye`aU@5.,'$#! (1!$(+' !+,(#'3@]±€€€€€кЖ1FЬїЙ>4?@::>>>JНя€ю€€€€€€€€€€€€юью€€ю€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыюью€€€€€€€юэ€€ю€€€щжро©rlljffedcdddes†¬»±eBBCEIJMLPSSUWVWWYXW[[YXUWXW[ZZ[[[Z[]]^[Z\]ZVQP^Пљй€€€€€€€€€€€эы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эўЪscaa\YYZZZWVVYYWWWVVSSTTUSUSTSSRNNOPQMKMOONONLLNNLLNOMMLJIKMKGGHGGFFHGDHHHGEDFEEGCDD@A?>@?<==?A>;:;9555536965999<;;=>?ACDGGCGGFGIJQSUZ\_bpЛЅъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т©uroК®£Жkjjhec\ZWNJВн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чѕШ^9 6lzrpqlga^][Z[\Z^ac_YWL=50+%# (0=`Ф√ћќћњЃЛmda`_]\]ZYYUPOMQRYgxИЦ•ѓґЉїЉїЇі±±ѓђ™£ЯЬЫЪЬЬЩШУvZW_Г≠ЉµО{}|uh`ZUPMaМЬ†°Ґ†ҐЮШФСУТРТУПРЧУЕsljkkmqwВРЮ°КJ bҐ”г‘Іd%/89?MYM# )0/6CTW4(i§Ђ©™¶ҐЯЬЪЧЧТНССПРСУЩЩСОПППТФРХЩЪ†®©ЭЦТНЖДslhbcgiogH- !(-( '-,$%0A_µ€€€€€нН6DШїИA3?A:8=A@GЗЁю€€€€€€€€€€€€€юшы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€ээ€€€€€€€€€€€€€€€юю€€€€€€пђpkliffgdecacgtҐ¬∆∞gCBADHILLQSTUVUYXXXYZZYXVXXWZ[ZY[ZYY\\][Z[ZVTOTr£–ь€€€€€€€€€€€€ю€€€€€€€€€эы€€эы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь÷Пpcb__\ZYXYXWWYZXWUVUTTVUSQRTVSQSQPPNOMMJKONOOOONLKKNPKJJJKLHJHHJGIHHKHDHKHHFDEEEHHECAB@@A>@>>>@=<=;88521253145757<::>>=CECCDHDEHGLOPUVWZ_blАґъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уЂurpН™ҐИljjhdc`\YQMГр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юдђ^9! Dq||АЕВВzuqoida[XWYXXVPLHC:3/+($"#$,IВЅ„ўў÷√УngbZY[^`^^_^][]ZTNMMMR[ivКЦ•≥ЈєЈЇњњєЈ±Ѓ©•§†ЮЭФwYXdИЃЇ≤О~А|АД}ui`\UPJZГСУХЧШПБ~ЗОРСРЛtuВГzrnjhglnt~ПЭЩw6&h•”г‘®e '1;ОЇТH2==99;A@GЙз€€€€€€€€€€€€€€юэю€€€ю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыээю€€€€€ю€€€эьюьэ€€€€€€€о©nkjiihfbbbceft•≈∆∞hCEBBHKKMRSUWSUYYYYXY[YXXXZXXZY[][Z[ZZ[[[YWTQO]И∞’€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уЈНnb__^\XWYXZYXZXXWVWUUWWTSSRSSVRQNPQPLLMJKMLMNPOOLJKLOKJJKNMHJKIKIIJKIGFIJEGIEDFBEGDBCB@B@?@=>?==;<967631340013102::87:>@ABCFECCDEIIKPTVX]`aiz≤ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рЯrqqРЃ®Лjijhfe`[WPNДс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁБD+ (Mntvw{~ГВВББ}|xrjf`ZYVUUROIEDC=5/-+$"# ! '9i≠——”“їЕf_YRTZ]]_`ba]`aceaa`ZYSOMNS^jyЗУ°ѓґєЉЊЊЉєЈµ≤©Ю{WVdО∞єѓК}ДБД|sjb]WPL\ЗЖИЙИ{n}ЯЈїЉєђЛhXaqppniiknpuАПХКa$ -m®’в“®h% '/:>IV[L !)/3::::975454,.2/-..-0118_®√ƒ≈ƒ√ЊЃx:+'&)-/,!!%,+).+$%.>]≥€ю€€€кД1 <МєСG5<<9;AA?FКй€€ю€€€€€€€€€€юэ€€€€ю€ю€юы€€€юьюю€€€€€€€€€€€€юы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эюэ€€ю€€эь€€€€юычэ€€ю€ююэи™lijijhfccdfffu•««ѓfBFDAFHJNPRTTTWWXYXY[ZYXXWXXXXY\__ZYZZZ[\YVUQQlЭ∆ф€€€€€€€€€€€€€€€€€€€€€€€€€юы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€у∞Зldab^Z[YZYXZYXZVVVWVTUWTVSSSRTTQNOQPNOOOKKLKLMIKMLKLMMMHKLMLKLIHIIIIFHHGHCDHFCFC@EHDDAAC@?@===?><<;86684330222//3666478=>BDBDGFHFJJMPQTVY\^ck}∞чэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пЩnroТЄЂИkjmieda[VONЕц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щѕГB" /Tswxwtutstxwy}~{rkd`[ZVTRQPQNJHEA=972+'"!#%.L}•ђ±є°p[ODFSYZZ[^aa^_aceehgjmigd^ZWSRRT\evЗЬ©ѓµєљ¬ЅЉ∞ЕXVeЦµЇѓЙ}ВАВ}tlbZUOJ_АЕДБ~~xpК∆ддддЎ±mLRaffgdfjkpwГППyG3n©„в“Іh*   !*/9@OX[G #(.19HZJ!*.**%     Gђ’„ЎЎўЎƒt #** '.*#&/=_≤о€€€€жВ0"CТґЗA5;;<=>@>FЗ„ю€€€€€€€€€€€€€€€€€€€€€€€ю€€€ээюы€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьээ€€€€€€€€€€€юыэюююь€ююэмђnhjjhfgccfefct¶« ѓbADDBDEKMOSSTWZYXYYYZYYXXXWXYXZ[\^\[\\[ZZXWTTYђ‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сІhabc_[ZY[]ZZZXXYWVUUUUUTVSRRTUSQRQRRPNQPMLMLOMIIJKJLNNNLKLLJKJGDFGJGGHGFIFDDEBEDEJJECBBDBC?<<>>=>:8778755612310/35464569==>ACEFCGKKIKNPTWY[`gn}•аы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рЫmonТЇ≥НjhiihfaYTMKЕс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЈR5# #%2Ywvyywvtqrqnnjkoplkfb`_ZXWUUVRPQPNIIIA>=7/.-,.6H\hssTA507NYZ[]^```abccaegilpnlmmnoke]ZWRRYalzКШ§Ѓ≥≠ВVUgЪєЉЃКГ~АВ|ukb[TNL]ГЛДАДЖ|tУ‘онмнз√rOT]]\^^^adjvАЙЕg-  4p™÷г‘®i-   %&&*0?=GЖЎь€€€€€€эшэ€€€€€€€ьч€юэ€€€€€€€ю€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€юшц€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€эь€€€€€€€€ю€эьэю€эью€€ээюсѓnjhggeeehfcfcuІ«Ћ∞bAEDDEGLNPSUUW[[YYYXZYWWYYYXXZ[Y[\]]]]\ZZXUQQeУњп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мЬyfa``^\][\^ZZYXWWVVTTUUSRTTRRTTQRSSSRPMNNNKMNPQMLMKKKPPONMONIJJJGFEGEFDDHIJGFDCEDDDGEABBA@BA==@=<=;;=:97656432/011433/357:=?@BECBFIIFGGLRTVY]ain{ШЋъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рЬmonОЈ±Оjhhhfd^XSMOИц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЉQ) !&'3]xsttutqqsqomhgfcab`^`a^[YY[YXVUUTSPQMLKFC??<9<=;AJMI:/,*0ETX[[\]^_bdedbcfhjklijnpnrsqqpmga\UQPV^ivВoUVkЩґњЃК|}{Б{tld^UPL]ЕЙ~{ЕЛБxЭЏмлннй«{Z^fc]YYZ[^anz|rI 8v≠’в—•h.    (*.63)-6=CN[]< ),.4=OY>    2Щ““‘”’‘Ѕh )*   !''"!,>Y§џмю€€мК2:ЖѓЙ@2;<:9=>>FЗгю€€€€€€юыэ€€€€€€€эъюээ€€€€€ю€ю€€€€€€€эю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юшц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээюшч€€€ю€€€ююэщк≥ligghfbfgfdddwЂ»«Ѓb@DDFFKNPNPRUUXZYZXX[ZXXYYZYYYYX[]][][ZWWWSMPs£ќ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЎХtda^^`\\[\[[[ZZVVYVTUVUTTUTRRSSPQTTQQQNKLNLLLMPMMOKLOPQOLNKLLJNMJFEDFGDEGFHEDFDCB?=@EADD@>@C?@A?>=>>?<889632202/11320/26658:?@ECAAEHFEGLQRRUZ^ejnwПЊч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЫmllНіЂЙlhgfd`][TNPКэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъїV0!!!''3\wrppsqoppllhfggd_^\[^^][Z]^[ZYWZ]_`ca`\WQOLIGIE@CD?951,++3=EJMRTWY]bacbadghjljlmkjnomsvusuvoke`YQMQVTWjЪґЉ≠Йz~~А|tld]WPK`КМ{r{МСУґголмни…КhfkeZRTX]_cjrnU(  >vђ’аќ°h/   (-/.))'(/49FR]\4 +-/7BUW5  -МЋ–“‘’‘њi ")  ''$#(6TЯ÷а€€€мЙ6=ЖЂЛC19;;;<>=FБЎ€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€€€€€ю€€€€€€€€€юыю€€€€€€€€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ююьььюю€€€€ээ€юп≥kkkhffffebbbcuЂ……ѓ`>@CDEMRPLOQUUVWXYZY[ZYYXXXZXXZX[[[[[ZWVUTPMXЕ∞’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чƒОmeb_\\]\\\ZYZYYWXZXVVVVSSTRPSSSSSSQPQQNNNRPLJKOMMKJNPPPMLNLKJINLHCDFKKDGKFFDCCDD@?@@AEDCB?@B@?>??<@@?>;9:842323320112./46487;@AABCDDDFGGJKNSVZ^ekpyЛµч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЯjjlРі≠Зljfdb_][SJMОэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€сїQ0%  $%&'4Zwroopqnnmihcadd`^\\Z[[[Z[\\\ZYX[`dkoquxyskc_]XSNMIFA=966202266;>@FNUX[_bbefgjkljjhkkmpttrrssuttsoke\SUjШµЊђИzБВyvoe]XNJjЬ§ЧЙНЯґ…№жйийкꔥ}me\UU[bgfggdP-  =u≠ЎбћЮg2! !#!%%   '39=KY]Q# "'-29GXT, "e≠Њƒ« ћЇi  &#  '&'%%-PЫ÷Џийе„К3?З®ЙC-8:89:@>EБ„€€€€€€€€€€€€€€€€€юыю€€ю€€эы€€€€€€€ю€€ю€€€€€€€€€€€€ю€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ю€€€€€€€€€€ю€ю€€€€€юэюю€м∞nllhedgedebdbr£∆ ђ^=BDBFLOOOPRVUVYZYZZZXYXXWXYXXZYYZZ\[[XWXUPQgЧ√ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф≥Кmba`^\\\[\ZY\ZZYYWVWXVVUTTQRUTSSTSPPSPORPPMMOLNJMKLNLQPIKLKKJJHHHDBGLJGHPICEDCEFAADGCF@@CBBB@<@A?=@>@@<;87642132///1..0332568:=?CA@@FHCCFHLPQX]agnryИ∞хэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЮmmnУґ∞Жhiheaa]ZVNNП€€€€€€€€€€€€€€€€€€€€€€€€€€€€ёСD)$! !#%&&4Zsonommkkihfaaca]\[YXYZYYXYZYYXX^kpgacelstoqwxvsmgcZPJIHDA><86646876:;>DKPV[acffggimmmnqqpnnppsuvsrpaSUjЧіЊ™Еy|Б|xslc_WPLmҐ±≤≠∞Ѕ”ёдаЏў„ёя—ЃПyleejmnlg_SD(  $?w≤ЎяЋЪf7)-.10*&#     ,57ANX_O$*-28GZM$LС®Ѓ≤ґґ§Z!#&% (&$ ",MХ‘÷÷Ў÷ЋМ/;ДІЖB/7998;@B@;;989544541/.1./33142157:<>?B?@CBDGDHJOVY\bintyБ†№ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рШlotЫ≥©ikigc]]ZUKMП€€€€€€€€€€€€€€€€€€€€€€€€€€€÷j4"#" ""#%$3[smklmlkheeddcab_\ZWXXXWVVUWVWY\|®ЂПn_Y[\\Z]cghloouyrlibWOLIFA@@>?;675677==>GOTZ_cdjmmnnlllnppprsqpm]RUkЫЈљђИ{}А}zrlf^UOIY}СЬ§ѓ¬џаваѕ≈¬…«є•ЦИ{tprnhaWG3  '*16(! 'EvѓЎбЋЬh;/662-'"!   -5=DPY^H&(.5;FZM 8nКЧЮҐ£ОH  !%$ ()$ "-KС”÷’ўЏќМ/9ГІВ?18<:;GГ№€ю€юэ€ы€э€€€€€€€ююьэээ€€ююююю€ю€юшю€€€€€€€€€€€€€€€€юь€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьчыю€ю€€€€€юю€€к•kiggddbccc`_at¶√Њђa?C@@FIILMNSSUXXYZXYYYZXWXYYYZWUYZ\ZZXXXUQO`Сљм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€с°zieca_^\\[ZZZZZYXYVTVUUUUSTQPRTSSTSSRRRPOOMNQQOKMMNLGIMLLJKJLJIHJIHIIJHFJGEEDCCEGCCEEBAEEDEAA@CB<>@=@A?<:<<;;99:611310//110135448;<>>=@DDDDEILRTV\biouyОґц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЪmns†≤©~kjkfb_[USJKЙы€€€€€€€€€€€€€€€€€€€ю€€€€€„j5%%$"!"##%&2Ztnkknlidbbcdd`a_][YWUUVWUTUVXXl≥Ў„ЋЫiXWUTQNRVZVZ\`hlrzyuri_YSNIDDB>>;;<;::;::?BIOR[`cgghkkkmknooolk_SUiЩї¬∞ИyА}{vrkd]VM@=DXjxКЮїЌ–ЋЊЈµЇЉђЭСГume`VMB8,! &1?HFI@/$(FvѓўвЋЭiB893+&!  19?BOZ]B(*12ABCDB@?ACBEHPRVW[`bddfimnmph\QSgЩљЊ®Д|Г}{vskc\VL@COWXX`oЕСУУСПМФЪЛ{m^RLFA:5/,-*'! !+3<844,"'Gy≤ўа…ШhI>4)$    !16CBBCFLLQRRTUVXZZXZZZZXVXXXYWXYZ[Z[\[YXSM[ЛЇм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€м§Зlc_]\]]]ZXYYYYZYXVSSUVWUUVWWTTTRTVUSROMQSPPOOOPMMLKJKKKJHIKKHIHHKIIGGFDDEFFGEEACDDEEIEBFJEDEEBADA?DB>C>=<<;;:;9688024/.0000/0211469;:>?@CEBFJQQSV[`flrz~ВКђф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЧlmu§Ї¶|kkif`\YUPEHЛ€€€€€€€€€€€€€€€€€€€€€€€ьћ`5)(&%! !$%##1[mnmkjfdccefdb`]\[YXXXYXWVUTUPT°аежг№ѓkSROOMLPPONOONOQPQPUYZX[afklhb\_ZSOPQLJKCDFDIHNPLPSSSUX[\`ffgb[SWeУ≤ЊђГ{}}zslcZUNCKdedghkpsqptkevjULA85678963313."  !"###%Gz≥Џё…ШhG8,$  "" "27>KUYW. (+-4@PU3    &)  (-,'$)GТ“ўЏ÷÷ћМ18В®s.-7769=A?GВё€€€€юэ€€€€€ьмц€€€€€€€€€€€€€€€€€€эы€€€€€эы€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эъ€€€€€€€€€€ээыю€€ю€€€€юэю€юьа•kkhggddb`acccs§≈ ™^B??CBDMMPPSTWWYYYYZYXYVWXXWXWYYZZZZZYWTQOkЬ ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хѓЙogc^\^^]\Z[ZYWWZYVUUVWWTTUSWUSUSRTSRQONRSOQOLMOLKNJJJJKKKKKMJHHIHIJGEGDCEFCFCBCCDCEEFDCBFCEB?BCBBBEEAA==;==<<;97674334210//0/0/1229959;>BBBEGKOSUZ]ajpty}ДЛђу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЦhku§Љ≠Аilleb^ZVMFKМы€€€€€€€€€€€€€€€€ю€€€€ьЋe5(''%!!" #$##2_mmmjhebadfeca_\]ZXYXVUWVUUTSN[≤вжззг…БSRNMOPQQPNMONOOOLPPMIIKPSRTW[afjmjgf^[UNIIKOOOQRSUURQQSSUTWZZWRVdУ≥љ∞Еy}ztkb\WOFMfhcdkrt|ВСИА†∞Ж_SI@=;:;:8425841$ !!#$(Hz≥№бЋЬjD.%" %  %39AMUZS%+.19BRM*    "$'  %.-)$'EТ—Ў÷÷ЎЌП27Б¶s--6749;<@BCABA??<<<=>=;;98667433/.102//0/12057378;??ACFINOTVX]ciot{БЗК•зэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЩjls°Ї±Жikjgd^XVMELТ€€€€€€€€юь€€€€€€юь€€€эЋ^5,(&#!!" !"!$#3`kkljhgbbccca^]^_[XYYXUXUTTUVR`µвеийе’ФZRQQRRSNJNQPNPNLILLIIHIHIGGILOSUZ_aehid`\[ZWWVSSUVVUTVXWUUTSTTSTcС≤јЂЖ{~|А|wri`ZULEQhj`Ybn~ФЮЧЦХШЈ¬ЧlZNG?<:;7846:==>0 !""#)Kz≤№б»Щg<(" !!(08BNVYO(+/8BQG!  %'!  $/.)#(EЧѕ‘’÷„ЌО10Г©v0-77888;<=<=<;:989831232134222202114678;=@@DGKMOSWY\bjpx~ВИР§аэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фШlmqЯі≥Кljihc[ZVNENП€€€€€€€€€ь€€€€€€€€€€эЌa4*+'$# ! #$4\lhhfffdeb_b^]]^_][YZ[XWWVTUWTfєвжий碥`TSQONMKLNMLMMLHMHDFIJEDFE@DEJJMNPTTW\]]`cfecaa\ZYYXXXYXYYYVWUSTaУіЊ¶~z~}Б{xulb[TIBOfjb\]jРљ є™¶±»«ЯrZRK?<;;;:99;>FH9$    !$(J|µџёƒЦb4'  !+2:@KVYK +,/;FTD  "%! +-*$(LЬ–’÷Ў÷ћМ02ДЃs0-66667;>EВя€€€€юэ€€€€€€€€€ю€€€€€€€€€€€€€€€юююю€€€ююю€ю€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€эщъ€€эьщщ€€€€ью€€€ээ€€юю€€ээьыл£jihfiiebab_adqЮƒ≈І\AA@@DIPMMOSSSTVWVXYYZXVVXWXXVWZYZZYXYTPPqҐЌ€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЊЦwrf__]][]\ZWUVWTVUVVTTSRTTTTSSUWWTQQQMNNOLLLLMKGLLPJILNLJLKJFGHFEEEEHJGEFGHDCEDDDBHFBFFGC@CFCB?BAEA?=?=;<==<9:9;;557410/1851410102437;;9=DHIKILRUX_gnszАЖОУ£яь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фШjnoЭЈ±Мkjie`\ZUKGNТ€€€€€€€€€€€€€€€€€€€ю–`4,+*&#"! "$3^mhhcddcb`a`\\[\\\\YYYYXWUVUYUhЇвзжизЏ¶dVRROJJKMPNLKJIIIDFHIICCFCBEDBEFEHOONRUXY[`a`bdbbba``^]_^[\\[SPUdТ±Њ©~v||}yxtmc]VLAKefffafА∞…Ќ∆љ≈Ў“¶mSONE@>?AA@<>FMN@/ !"%)IЈЁя∆Х^1&  +38BOUZB #)-3CFC?>@><;=;<;::7::77965103520//0334424758=CFJKLJKSW[_jov{ГМРРҐ„щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фХfimЫЄЃЛkjje_]\UNKOУ€€€€€€€€€€€€€€€€€€ь‘\3+-+*#$$" #%4_jghedda_``^\\[[[Z[[ZWVWVRVXYSgјвзийжЏ£bTPQRMMOLMPKHIIJKJGFFE@B@>DEBBCABCDGJQUVVVVWYXWZ]]befddifdea\VPUdЦґјђАuvvxzwsnd]XM@G]`bdb`_xЭЅ≈њјћ≈РVBGQNJFEHJIFEOQRK:"  !&1QДЄЁа≈Ф[-$!+4>>=:;;8;;:87732200//31.112423123=>ACCGJJRUWYbjpxБКНРТЯ–щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уУekiСЈ≠Йjjie`[YVPLPУ€€€€€€€€€€€€€€€€€€“`1)+('&!!"  !"5_iededeba`^_]\\[[ZYZYXUVUTTV[X`±“ЎЁежў°aVRPPNMNKLLIKJMLIJHFCEGDA@BDCBDBBABBFOUTSRTWYWUWXY[\_cfgeglfbZSUeЧ≥Њ¶}tywvuvtnf\WN@?KPRVWXX_|£≠©©≠•xE=HTSQOMONPPOQUVTF, "7I`ЗЉёб«Цd>*!/2@FGDEILNOSSUXYYYYXXYVVXWWY^ZXWXWXXWSPRvІЌ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чєПtda`^\\ZXXWUUVUUUVTTTSSSRSTRRTTQOOLLONLNLJOPNNLJHKKIJLHDFFMKEDEEFGHGCACFCDABEDEBABBA?BB@?BB@?@B>=>?>=<>><=<;>;:75//232014/-0002100.26;<>?ADGPSUY]fnt|ВЗНПТ°Ќт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цХinjЖ∞±Лgjig`\WVRLPС€€€€€€€€€€€€€€€€юёt;+-,'&&!!"  2\hfcdbeaaa`a`]ZYYZYZYXVUTUUTYVRМ™©∞ЉƒјТ^TPNRNJKJKJLMKKHFGHDEDIGECAB@DAAEBADAJKLNPRUXYTUVWVVZ\^]^aede[RTgЧ≥Њ•~x{ywtsoli\VM>><==>>;9<;8453323241/..02000./4:;>?@DGOOOW\_epx~ЕНРРУЪіс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цХfhgИ∞ЃЛlljh`\XUROOУ€€€€€€€€€€€€€€€ы„lE/--+)&%#$"   0Yfedbad`_a_]_^[XWYZYXWVVUTTTUMGwЙГГВВ|jWTQPPPLKLLMOKJIGFEEACBDDCFCB?DADFBCEGGHLLMPNSTSSRPUUWZ\][]`a_YQUhЩµњ•~zАxvusnjd]VL==B>>BEHNQW]acWPQSQPPRQQTSUUXYZZVA) 3_i{Ґћяа“ЅђzH.!#""! '06=HSYT$ (.8>MZL$  +UYOJEEEGIEB>9/   " &''#>Ш–‘„Ў÷ќХ6/o†f,.1128;=;C{‘€€€ю€€€€эыю€€€ю€€€€€€€€€€ыц€ю€€€€€ю€€€€€юь€€€€€€ю€€€юъъю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээъы€€€€ю€эюыэыч€€ыщю€€ю€€€€ю€€ююе£miidddcbccc`_n°»…®\ADC?CHILPPTUVUXYXXWXXXVWVTVXYWVWWYXTQRjЬƒх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћ®Бlb_[ZZYYVWVXURTVSTUTSSSSRSRSTRQQPORPONJKNMNJKHJMNIFHJGEJJEFEEGGFDDECADB@DBBB@ACDBC@@@ACCGA=<==;>>@@=<:79<9865333/1///11/1..18:9;=>@HJKQXZ^iszВЙПСТЦЭ≤х€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цФcggЙѓ©Жlkgc`_ZSROSШ€€€€€€€€€€€€€€ъ∆c=0.++)('$" !0[dcaceea^_^\]^\ZWWYXWUTWUUUTUJ=aoje_XMOUSPQPOOPLKKIKLJGHDBCDBBDBDCA@BBCBCFFFEIPKPKPSQPRSSUTUYZYZ\^]]UQUhЫµњ•z}wttrkhc[VK?>DB<<=<<=?@BHHIOMNOONPRPOPRSVWXWXZZL2" 7dm}∞’№џ‘ЌњyA0  "$%&&'$!")07>JU]P "*09@Q]E   !UZ@>EGFKJKJGIQSF'! %&$"8ЛЌ”’÷’ќР2-kЯb+..35::<;D}„€€€€€€€ююь€€€€€€€€€€€€€€€€ьыъю€€€юю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьээы€€€ьэьюыюыч€€€€юю€€€ю€ююь€эюй£njjfcecbbcb``pҐ«»•[AA>@BGJNQTTTVVWXYXWYZYWXXVVWWTWWYYXROT|©ѕ€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пґИn`^Z[XXUUUXTRTURTTSTSRSRRRRSRQONPRNMOMKLJKKLIGLKKGHKIKJIEDDEFEFBAEEAA?@ABCD@BC?ABAB?@BCDD>A>?><===>>=>=;7787874401021/./0/.../57699=@CGJOQTYckt}ЕИКОХЩ•¬о€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цУdfgЛЃ®Вijjd^_YTQPWЮ€€€€€€€€€€€€€ыћg:11.**''&##0\cc^`dd`__\]\\\[XWWXXTTWTUVTVH1AKH@@A;;><=>@@DLMQNMNPOKIMLLSUWXY[[S=)!7cr±”ўџ‘≈ґrC1"!$%%&())))%&(%+37AJU\I %-19DR]>       DYB57@BGQRUVV[akyd73-     &'#!1w»—‘’’ЌС3,eЪ`-./16768;?yЌэ€€€€€€€ю€€€€€€€€€€€€€€€€ыюь€ю€€ъц€€ю€€€€€юы€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€ыю€юю€ь€ьш€€ыю€€€ю€€ь€€ю€€ю€юэ€ьк°kjhgfgeedc``bqҐ…«£X@A>?DEJOQSRSTVVY\\YXYXXXYVVXVWVWZZVPM_ПЉп€€€€€€€€€юы€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъљРob\[WWWVWVUUURRUTRTSQRRRQRQRRNMONNOKMKJJILJGDHIJKFHILKJJHDDDECCBBFAA@CAB@BBBCACBBAAB?CDB@@?<@@=>=>:=<<<;:99:768374301022./..--./2458:;>>CGGLQV^dpw~ЕКОТЧЯ†∞о€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хСbdeЛ≠©Бihhb`^XTSSYҐ€€€€€€€€€€€€ъћe@41/.,(&')#!1\ca_``aa^]\\]\[YXYXWVUTVSRUTWK.&3:4..-CTTQNNLIKPNKJONNLJIGBCDCBDEBFFBECDDCEGDFGKFFJOPONQSRUVVX[[[Z[XNOUhЬЈЅ™Гyyturlfa`XQI?AOIGDKAAC=?>?@DKNQRRUUSSPOLIMOPRVYZUF/'%!!5]k≥„Џ№‘ƒ≤tE1!"'*))(-*+**).589;6,3:DPWZD &.4=ES[7  )[J7309BMQPZajqШ™ђyc`3! !!!  %'$ (cњ—‘÷”ќХ4,aТ`,+00348:=?x‘ю€€€€€€€€€€€€€€€€€€€€€€€€ээыюэ€€юющэ€€ььщю€щю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€ю€€€€€€€ю€юю€юю€юы€ыё†jhgiigffdba`cp°∆≈ҐX?A@BDEIQRQSUUVWYY\ZYYYXWXUUXWXWWZWSPOjЯ«€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ«Ъt`][ZWVXWVTSUUTTRSSQRRQORSQQPLMLQQKOMLJJKJHIJJJMGHJKLKJKEABCACBCDABBCABBCEBC@@DB?A@@A@BBA?=A?=<<;:9;;<:;<:876567864231/,//----//252669;?zЏ€€€€€€€ю€€€€€€€€€€€€€€€€ыышэюцэ€€юээы€юэъь€эю€€€€€€€€ыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыюююю€€€юэ€€€€€€€€ююьы€€€€€ююш№†ijihkgdeca``anҐƒƒ§Y>@ACFHJPPPTUVXWVWYXXYYWUVTVVVWW\^UOLU{≠’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќ¶xe^[XWWWURSTVUSTSSRQOOOQQQOPLONQQMNOLKNLJGKKILJIKHKKJEHKB@@ABCGC@BCB?EGGD@@A@BB?@@A@@FGA@AA???<:;:;:;7:<<:<94;9;75401-.1/+.//./0022349=;@CELRZ_jszВЗОУШЫЫЮђнэы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чЛdimХ∞ЂГjlkd`]XTTTZҐ€€€€€€€€€€шЅb834/.,,,*'$"  .Zcdca_a^^^]^[[[YZXVVVTVWWVURXWF>PUOE1.BRPKMOMLJHLJEIKIHCGIEFHFFCEDEB?DCDC?@EEBDCJJKONNPQSUVVVVY[YX[VQOVfЩЄљЭ|xztpmmg^ZWQG?@FC@C@ACAEBBHMMSTVVXZ\]]^]YWZXTSPPNNLF?;854646GTsЇгдзеЏ≈}K966548=AFEGJJIE?:1)  "/6>HOXX0")0))*-2=PhМ∞ђ°©ƒдйг МЬВ3"&""###   **!$Nѓ“’’„ќФ7(`Х^)+.4126;>Cz„€€€€€€€э€€€€€€€€€€€€€€€€э€€€€юю€эы€€ю€ю€€юыыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€эююэь€юъъ€€€ю€€€€€€€€€€€ю€€€€€€€ыгҐjjhfhiedecaabp°√∆•Y?A@BCHLKLPSUVXXWWYXYYWUTVUVVVU[abZUNaТїт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁђАg\[ZXWVWWTTTSSVTQOPOQQOPPQPOMNMONMKLMJIJJJJKHJIFHHGFEHHHFEDEGD@@?CAFIFB?@AA?@BCA@>AHB?>=?@@=<>=9:<99:>;9;7666899:332/11-/.-+/1/21028<9:??BKT[ait~ЖЛСЦЦЫЮЮЂЁц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чЙ_eoЦ≠£~kifb^\WTQU\†€€€€€€€€€чјa9/12-..-+,&%"  .Yacca^]\[^]\\YYXXWVVWVVVWWUSZXNUcb[WE=GQNLRNNMKKLMLIJMHHGECGFEB@CCADDFFECCBFIEDFHIKLNMOPTUVYXZXXYWZYOOWhЧєјЮ|wytqpkd_ZWTJ?ABA===?BBEBAHMPWWYY[^bbca`_]ZZWUVVTSRRONLKFDBBFMk∞бежжЁњuPDCEIOSTPQH>95/& &06AKU^W%%,3)"&+0@FFDHB@>B@A?ACB@>;=@?A??=?A?<==89:9;:>:8;77679896242/20/1/-.-.//0015666;>=DJSWanyБЖКСУШЮЭЮЂе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЗ_frЫђ£Аijfe^ZVSRTYЬ€€€€€€€€уіa800/00./-)'''! $) .Zbba``][Y\\Z[YYYWYZWVXUTWWTSXQGVcb_\UNOSPNQPONPPMPQMMKHKIFEFCF@?DBBFCCFEFGCBJJEGFKKNPMPRSVWWYXWXZ[\XPOVjЩЉјЪ|xztrokcb]XTNDGE@?<>=AEAA@BFNXYYY]_befddec`]ZXXWTRSSRSTSPOMMPRg™яжгг№ЅА\TTVXXTL@8-! )09@O\cT &+1=MXQ&   2(%%4=Ow≠‘яеияягелйа≤~Ц}9$##%,/*! ,+%"<Ч“”‘‘–Я<'gЭV',.1041:=Au“ь€€€€€€€э€€€€€€€€€€€€ю€€€€ыъ€ю€ю€€€€€€ю€€€юэ€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эы€€ы€€€€€€€€€€ь€эюэы€€€щьэээьеЩkghifffec_abcp§ ∆£Y@@>?DGJMLRSUWVZZZYXVUWVUVTSUVY`WRRO^Еђ÷€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юсй«Хr_ZXWTRTTTSRTTRRRROPQQQPPMOONPMOKHILOIGHIHJHGIHGCEHCBABECDA?@?AGEDIB?=CCB?AC@>>=??<====:<:8=<:849:5334647320.-/../.../1/4456:=CJRZdoy~ЖНОХЬЭЮ°©д€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЗcimЩ≥∞Иlljg^\YUTVXЩ€€€€€€€тЪ\;==>C?>;45@OXWY^^_dcefgdb][[YYUTTTVVTSRTUUVYcРЇЌ’ќЊ®d[YTI;1) +4;@KZ`K'-2?O\I  ,*&-AO]ДЊќџйклллзклбљБКЙG"#$.2#  -,&!8ОЌ‘’‘–Ю9%hЬS%+32/169;Av‘э€€€€€юэьэю€ю€€€€€€€€€€€€€шь€€€юь€ю€ю€ю€€€ъъю€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€юы€€€€€€ю€€€€ю€€ююью€€€€ьыэш„Ъifgfedfba``aco£ћ∆І\@?>?DGHKLPQRUUXZYYXUUWUVUWUUTX\[SOLbХљх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ †{b[YVSSTTSSSSRSTRPQPOOPQPRQORONIGJONJIFILLHGHJHFEFBBBCDCBB@BBCBB@DF@BCCCCACA???B@BEDA@@>==>@=<=<>;=<:;;:86;;94579942420.0//2/.....142259>@KSZdpyВЗКУЧЪ††Ю™г€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юзДcflФґ±Зljifa\YSSUWЪ€€€€€€фР[://10,///*,*'%"" -W^_^^ab^_][[[[YYZYWWWVWVUTVWXJATWUUbВ{WSTOLKNMLKPMOLIKOLIHIGDDCCEA?BBEEBEEDCFKILPKKKNOQRQTWXYZYZ]][YSOWfУЄЊЧyxxqmogaa]YRFAFEB><<9<>?8--DMY_A '-8ES_E  ().B\vЖНЈѕ„ййллкзйквЉzpДT-2!&#   (+#1}«‘‘‘ќЯ9(fЬP%+020289<@v№€€€€ю€€€эью€ьъю€€€€€€€€€€юэюю€€€юю€юы€€€€€ью€€€ю€€€эю€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ю€€€€€€€€юэьэээ€юээ€€ю€€€€югЬihgfdbdbbcbcbnЯЋƒЃaA??@GJKMMOPSTVXYZXYWVVWVWXWWWXXZVMNs†«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь“∞Аf\XWVUTTTTRQSTSQPNOOQQMPQMOMJHGIMLKGFJJIJJHIFDDFAADECFCA>CDAA@?@CCA@?D@>??B@>??BFDB?AA==A==:<==><;9;88;9::8246744621300000/.---.10131379AHQZeqyАИСТШЭЮ†£Ђж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юеЖbemХ±≠Жljid_\YUSRUЧ€€€€€оПY6/0/01,.-/,++'%   (Z__^]]^]][\[[YWYZWYXVVVUTTTVYHCDA>=99==9,%$3NWZ[\adaba`_ZYWWTUVVVWXUVWWX\_`fisБzdJ;+!  !15=GR^_< "*0:HW`=  #)-v‘ы€€€юю€€€юью€э€€€€€€€€€€€€ююю€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€щэ€€€€€€€€€€€€€€€€€€€€€эх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ьэ€юы€ююю€€€€юъэююыь€€€эю€€юю€эююеШiiefdeeccdb`dp§Ћ«±b@=>@EGKMMPQTVVWWZXYXVWWUXWXXY\UUWKVДЃЏ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аЇИiZXWUUWTSQRRPROLINQQNLMOLIJGIIGKKIGGJHFJKJKGDFGBDFCBDCC?BABBBA@>AA@CB??>?CA>??A@CA;@E@<<;8:<2"!N]^9!  %,.C|Ј‘бўєї–№езе”»√ќ—ѓm<.(&-"#%   %)%!%cњ‘“—ѕЮ>$bЧM',/41577=?r–ь€€€€€€ю€юэ€ю€€€€€€€€€€€€€юю€ю€юы€€€€€€€€€€€€ю€юю€€€€€€€€€€€€€€ю€€юю€€€€€€€€€€€€€€€€€€€€€ъпю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ююьш€€€€€€€ъэю€э€€эююэ€ю€ююэюъЁШhigdedfaca_`dp° Ћ±cA<=>AEHLQRSSVTUVYXWXWYWVXXYWY\XUVMbФљш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф»Ъn\XWVTUTRTQQRPMKNPOMOOLKIMLKIGGHGGHIHHJHEGGBGFCEGDDAB@@@>DCDBB@ABEC=?>@@?@>>>>?CA>>===>=<C==<;<:<;<;788656;98751154123/.-//-.0//1.389>HP]lv}ДПФЧЫЮ°•Ґ®я€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мЕbeiС∞µМkjhf`\XUQRY†€€юеВS5//..--..--.,+&"#  R^a^]^^\XYZZYYZYXXVXXWWVWUVX[L>OUVUXWPRTRQQRLMPNOOKILKGHGFFFEEABDACFEEDEHFEDGJJGJIMNOPQTTTVUWWYZZ[ZWROVeЦієЩ|{wtpomcb]XTG@@DA<><5:<0"-KWY]``ba_[YYWSOONMPOOPRSRVYZ_dikrpgO+ '+7@NV[Y+$,7HYgd5!"!!  &99@z∆яЏ ≤Ыљ—Ўя№љЂ®ЂҐРe4#"&  !$!$[Є”‘”ѕ°<$WЕE&,/20124:>u”€€€€€€€€€ющэ€€€€€€€€€€€€€€€€€ыъюю€€ю€€ю€€€эы€€€€эю€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€€€€€€€€€€€€€€ыю€€€€ь€ыы€€€ююьь€эьь€ююь€€€€€ю€€ююр”Чikfegdccca_bcnЬ≈ћЃaB>=>@FHKPRTTWUUVYWWXXXVXZXWXXXYVQPr†√€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€б≠t^XUTVTTPPRQQPMMOMPNNKKPTOLIIHGFFKJKIFFCFE@CDBBCBEDF?>?=ABEAB@ABA?A?=??>@?>?@??@>@>>=@?><@A=<;;<=:8;<>;:97598987556554231.0.-,../,.2/45:@EO^lu}ЗТФЩЯ†£Ґ°•Ёэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ€€€€зЖbbkТђ≠Лkkida]VQPOXЭ€€кЖW8-0,-/,,--./.**%%!  Q\][\][\[[[[ZXZYVVUVWWVVXYXY\L@RUSTVOFOUUQQQQQQNLNNIJJIKHEIGIB@ACCEHHJHHFFHFFHIGJJNRQORUVUUTVVX[ZZXVRQVfЦЄЇШ}|{sqnjdc^VSK?@FA>=:8;?@?@CBEC>@@=BA<>@ACA@A>?>@D?BA<<@=?=?@=<<<:97:;<<9:9:7:98879955564120-,,--.+-//3489=DP_myБМСЧЭЯ£°§Ґ§„э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€хЕbahРѓІВljge_]YTRQWЮ€лОY<.-.--.,,,---.*($!   P[[^][[ZYZZ[ZVYXVVVVWWVWUYXX]PETUNORLGPSWYTRTQONNHNKHJMIJDEGGFD?CEFHCGGFCCEFHIEGGJKPPOSVTTUUVVZXZ]ZWPPUhШіїШxw{srlhdb]XSIACHA@EJ>>?4%9TXZ]`a`_\[WURPNNJJHFINOOOTU[_dgjpКn< +/17DRZ_M !(6MZ]gY) !  """$"!! &Um^[И™ЭhVixk`Y]qwmbkO)##   &$ F©–‘”ќЯ6$X~@'./0/035;@oѕю€€€э€€юь€€юы€€ь€€€€€€€€€€€€€€€юьь€€€ю€€ю€ю€€€€€€€€€€€€€€ю€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ьы€эюююью€€эю€€€ююэ€ъчаЧljeffdaabcbablЦЊ≈©\A@@BDGILNQUVWWWVVUUVVXWVVUUYXSONRdФґу€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ѕy^YWWSQQRQQPPOOOPOJMMOGIKJILNGFJJGFEEEGIEEFD@CEDDFBB?D@AA@A@>A?=BA>??@ABA?=@>=AA@=;=><><>@>=<;=;::<<;;66::99::758649962522...-,,--/10247CVhi_WaF##& &&!!;ЧЌ–“ќЯ9 W~@&,-//1159?n…ы€€€€€€€ю€€ьюьюэ€€€€€€€€эю€€€€€€ю€ью€ыююью€€€€€€€€€юю€€€€ыэ€юы€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€эыьэьььююьэььь€€€юю€€ююьх÷ЦjkggfdccbcbdekХї¬•\B@@BEFKQMQUUXUWXVUWVVWVUVVUYVRQMTsЯј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љ}bZUSQQSRRQNNPNNPMMHMMJJJIGJJKMLHEHCFGJDFGEADDCECBDDA@B@@=???=?@>ABB@>@?@AA=>;=====@=<=;:=<<<::<:68;;7767649789865432/.----.,.,0.1169DP`qАКОТЪЮ££¶¶••–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€к^bpФ©©Нnkha^]ZUPKTИЛ];),//.--**+,,+((#" T\]][\]Z[ZYYYXXYWWUUUTX[Y\rФ©ґњƒњ∞ХmC8MUWZZURRQRPQNLKIIHIJJGGDDCC@DEEIGFFFDHJHHIMLKPMQRRUVVVWXYYY[YTMNTeЧґЄФywvsomjhb]XSFFS]^= .>Q\^`E!" $""!#$!#""  'BOR\iYI?BH>;6AW__WOQ5&  &'$!1Й»–—ќ†<V|<%*././/69;q«ъ€€€€€€€€€€ю€ююыы€€€€€€€ю€€€€€€€€€ью€€€€ю€€€юю€€€€юьью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€ю€€€€€€€€ююьюю€€€эыыьъущюээ€€юю€€€юю€€ьщ€шќШjjheeabca``fhmЧљј©`A?>>EINSKQSTVVWXVWVUVUTUVVWWVURN]ЗђЏ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒЙiXUTSRQSROQOPPOMIJLNNKKGELLLMLGEFAFJHEEDBCFE@@ABBC@@A@@@?@@=>>?=>?=<@C?>@>?A>A><>;>=??<=::<=<<:::7;:9:;8888854:7667762311//.,-.-+--../37@N_rВЙОХЮ††§•®•®№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№ВcbjСІђРomib_\[VPMHWT?/+-,44****+)*(%% R\[]\[\YZXXZYXXXXXVVVUYZbБ®≈ЌЎЁЁ№ЏѕєН[V[WVZVSRQPNOMMMIFGHHJEDDBBAAEEDIGEFDDKLGIKLHJOKORSUVWXXYZZ[^[XNLTeЧЄЉФxxxsnlkie]YSG?BHHC>;>BA1 /OX[\^``_[ZVXSOLKMKMMOMILNPTWZ_femЛh6  "*/:ETZY1*:JW[^= "$$"%$&$" #  /7;<2*0B=95.@NPUTMA$##  %'%*~«““–Я:"\ЕA&+/0.135::p—ь€€юю€€€ю€€ю€ььэю€€€эю€€€€€€ю€€€€ю€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€юьщыэь€юыыщхфышэ€€€€€ю€€€€€юъююфѕШiiffdaaa`_aegpЩљ√≠b@=>?EJONORRRTUVVWYWVVTTTUVVVUSLLhЩЄл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕ†p]WURPRRSRNPONLJIMKKGHIHLIFIJHGCDEIGCCBCDCB?@@EABBA@A@@CA@>>>>@@?>;?=?>?==<==>?==<=;<<<;;;<:;9799;::7575775868875210/-.-.--,,-.,.17@OcuБЙРШЬЯ£•І®®®бю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йА`ajРЂ±Сnkhd`[YVRKAD8--**-+-,*+*+'(%   Q\]\[YZYYWZXWWVVWWVVVW[bЗ≥Ћ„џ№яёЁ№ё№ѕђ~h^Z[WTTPNOMMKJFEJIDEDEDBB?ACEHDCFFBLTLFFGLIKOPOPRTUUWXXWZ[][[QPVgЩїљХxxvtomkie]YQE@@EB><<=C?/ /RY\_`a^]\XWWROPNKKJMONMNPOTY[]ddkЖi8&+0@DHIIRQSSTVUUXYWUVVUUVVTVTPIMs§Ѕщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€з≥zbXTSSSSPNPNNMMGKJGGKLHIJGKIHFEHFEEBC@DDACC@BD@@@??ACAA>?A@???>?@>>?=>>>>BA>=>=>;=;:<<<=?><;:<<::869989;78874676336755531/..-..-,-,+,,16ASdvДКОЧЭҐҐ¶¶©©™џ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тГ_cnШѓѓУokffaYYUQGCA+))*(*)(*))(&&$#  T\]\]ZYYYWZXWUVVVVUTWX\БЇ”ўёв№№џџёяёаЏЄКo^\ZUVSRPNLNGDHKJEEEGEF@CDDDFCEGGHMNKJHGJLNMOQQSTVVWYXXY[[\YRPWhЫЉљЧzuurmmjeb[XRGAAC@?=;<@=0+RY[`ba^]]YWVSQQOLKJLNOPOPQTZ[]cepОl:    *,2q∆ъ€€€€€ю€эщ€ыю€юю€юь€€€€€€€€€€ью€эю€эьэ€€€эь€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€юъююэ€€€€€€€€€€€€€€€€€ыэ€ыь€€юъъыююыь€€ю€юыю€ююы€ьэ€юц–Уhdccdbb`cb`ddmЬ√…©aCB??DGFLPMSUVVWWYXVVWXWXWVUVSOKWВђѕ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э∆ДeWVTRQRPNLLKNJHJGIKIIJJIKKIEBFHGCDCCDBADG@BDA>>>=@B@>>>A@A>@>A?>?=>FB;><=@>==<;>==??>?=;989898;98887267896535436654010-/..+*')*+--5ARiyДМУЫ†°§¶®™©™д€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€е}^an£ґЈШqjhc`YWVKIJE*())*)'')'&$# %U][]^[ZZZYYWXWWWVUVVXYlђ÷ёвгвџџЏ№гёџаб№ЄКj\ZWVSROOPOKMJLLHFIHDDBEDFGHFEFHILKIIIHIKPQOQRRTSXXYWY[][^XQPWiЭЉњЩ{vurnmhcbZVSI??CB=<;:;;/'MZ\]`a`^_ZXWSQQNNMOKKNQNNRSY[`efuХo<      '-3oЅу€€€ю€€€юэ€эъэээ€€ь€€€€€€€€€€€€€ю€ю€юэ€€э€щюыю€ю€€ю€€€€€€€€€€€юээ€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€эю€€€€€€€юь€€€ью€€€€€€€€€юь€€€€€€€€ъъюююю€€ющьююыщю€€€ьь€€€€€€ью€юлѕФieaab`bbdaadbmЮƒ…І_C@?AEDJOMMQUVTWYYWUXYYXXXVVTQKKcСґт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќТj\USRRPNLNIMMJIHHHHGIEFKKLE@CIHCDEFKCBBFCDDEA@B?@@@?@?>??>??@@@?>?>?>>@?=><:=?>>>?@>;>=;@?@@=?=?@>==?A>;=>><;9;=?>>=>:9;=<<=;;:8879:999::761277414666:33436../20/--++)+-.3>UnАИОФЬЯ§¶І®Ђ©¶џэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ё{\aoЫ±≥Эqhf`^[VTKA?>)#"## !  !T][[[[[[ZYWYWXVVWWXWWc¶‘Ёџ÷— » —ўя№ёдже蓆~d[XVUQMLNHHHEDGCFHFCCACCEEFEFAEHKLFEGIILORSRSTTVWXYZZ]][WPPUhУіЉЪ|{ystole`ZWRF>BB@?=;9;<3) .OX]]_^`^][YVRPOONKJHLMQNLPRV]afd}Уi8      &14?N]a@#$)0>OT7  "#'((%&()*+)(('&#    &$)6CJQJ- #%  "!=Юћ—–Ґ<J|G'()-00148>lљр€€€€€€€юэю€юь€ь€€€€€€€€€€€€€€€€€€€€€€€€эы€ю€€€ю€€€€€€€€эю€€ыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€юыэ€€€€€€ю€€€€€€€€€€ъьюьыю€€€€€€эюыэ€€€€ы„Сffebaa``acba`k¶«ќђ_EA>CIKJMSQUVUVYVW\WWVVWWVVWUQMUАІ’ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кљ~dUURPROOMNLKIHJKIGEGGFIGGGEGFHFDHBCHECD>AABAA@?AA??@>?>>?<>>><<@?=;>?:<=:8<==>>=<;>B;:;;;9977549<<;:66347832257562546821210/.-.+)*-,.3@XrВМСЧЭЯ•І®™≠І•Ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ёz[bsЫ±∞Сokib^[XUJA@<% "U\[\]]ZZ[XWYXYXXWWXXUoЇЎ“ґ≠ґЄґЇ«”бежкклкгЊТrc[XTRMLMKFHJEBBEFCFDEBCEHHEECFLMMGHFFKMORQSSUUVVYZZ[\]\XSOUkХ≥їШy}{uunke`ZXRE=BEB?;:7:<5*$ 3RY^]___^^[XWSPNOMKKJNMPOKNRV^cfayСf6       )27BO`d<'*/4APQ1"%"!&''+)'++)*)*))("   @QPZ^jlG"#  !7С ––°8 NЙT''*-./.4:>A?>@@>>=>?>?>==@A:<;;;<<==;;;==?=88<;;:97:;9;9:977778777757554789555852200.-+,.--/3A^tЖНТЩЭҐ•¶®≠ЂІЂЏ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ё|]as°≥іПnkha_]ZTLE=6 #U\[\\[[YYYYWWXWWVUWVU~∆’ґФУҐ∞Ј«‘бйкийннлй’£e]XTSOMLMJLLFEFGEDDFDDCGFHFEFFHKLHGIIIJMRQRUUUUWY[[[[\\YRQYjХ≥њШwzztrlhd`ZWPG>AFA=9989<;)#,.+!AA=>@???;=<>>@====;CC>A?><=>;<=<99<><:::;9;;8<:9;>;;9:686298:48840597465842411/..-,,+-.3E_vЕОУЪЮ§§®ђЂЂ¶Іўъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€яz]`q†і≥Оojda_ZZTLC:+ #UZZ\Z[]ZWYYXWWVVWUUTVК…«ЮЗДПЭі“бклкйимллкаµЛj^YUTQNMKIJJEGFEDD@BCIGDGHEDDBHKIFCJJJKNQRTTVVVXWZZ]]][[QPZhСґ¬Шyyyusleda[WRG;@EC>::8:><,/>@>6*%BTY[^aa`]Z\XTTQLJLLIJKMOOQTSY\bga}Хf6      !'.6JXc]&$(4@MVL%! #"!"'&&(')*+*)'+.+)'('"!nњќќѕѕєZ  "!#   "!"pњќ—™B G{O))*--/.399m«щ€€€€€€€€€€эьъэююэ€€€€€€€€€€€€€€€эью€€э€ю€ю€€€€€€эы€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€€€€юь€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€э€€€€€€€€ъъьэььэ€€ю€€ъю€€€€ю€ээъ—Сkifc`_a`a`^^_lЯ«ЌЂcG?@BDFLNNMQSSTVVVVVVXXWTTWUQLQ}¶”€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўІu[QROMLLMHFIKJGGEFGFGFHHGFHIEKIOCADECB@A?>=>>A?=@>>@=<>=<<>><;<=@A?=>>>>><<=<<;<=;<<68><<9:79;99:8:885746:66625545535783652/0.-,,++++/BawЗПХЩ°•¶™ђђ§••ќц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€г|[]n§≥µНoke`_ZVSKD7%#QW[[Z\\YWWZZWXWWVTTTUНƒѓЛx|ДЗЬ¬ёймллкмллкзЅПm_XXSRNKEJJJKJHFDEBCFGIGFHDCEDJIIDFFJNNLQQTSSSUYWY[^]]]\TPZiТЈјЩzvvpnkhd\ZUSI9AEB@?<=@?8-6AEHA4-ESX^_aca]\]ZVURMNMLIGILQPORSV\`dbuИ_<    #'.6IV`T $(3@MXX- ##"!%$%(*)+,+,+,,+,*)'$#""Y≤… ћ ЃO ##$   # !_ґЌ“¶A JwG')+**./49>;?@@>=>>;==<==<>>>==;><=>;<=;:::;<;989:;:;:=<6856::9763586665034432569:946432/-,+,+*)0Hd}ЙПХЬ°Ґ•™Ђ•¶ІІ…м€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“{Z^n¶Є≤Зkkhb]ZURNB3# #PW[\\ZZZZY\[YXVWUUURSК±Ш~~ХЧУС§…емммммллкк…Оn`ZVRRPMIKHLLHFGGDDGFHFEFICADEGHJJJKONORPRSTUUUYYZZ[\][\SSZiРЈњЪ{uuolihd_ZURF>DFB?@?@@=7-8AHKH>6KVY_abca]^]YWTPOMLKJJJLPPMRVX\^b\_dJ7*)-..10     !')/9IWbI")2BLYW/$#"""%'))*++++-+*-*'(($" ;О√»» ѓM!##"  &%LЂќѕ°= MzF$',*),/28;o…ъ€€€€€€€ю€€€€€ю€€€€€€€€€€€€€€€€€€€ыщьюы€€€€€€€€€€€€€€€ыю€€юь€ю€€€€€€€€юююь€€€€€€€€€€€€€€€€€€€€€ыю€€€€€€ю€€€€€€€юю€ю€€€ю€€€€€€€€€€€э€€€ю€э€€€€э€€ъюъюю€€ьыэюэ€€€€€€€эююь№Ыkgec_aec_`___iЮћ”ЄeA??@CGGGJMPTSVYXXYYXXXVVTSQPMkЪЊъ€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕКdSNONOJJIKHHHEFFFHGBBJHLHMSNJIDDB>ACAABB?>@B@><@?>?>??=?=<=>==@D@=>>=>@>;9;88;<<>=<:;99:;;;<9:985798485436221323.26987447731.,*+*,,*3Ii~ЙТШЮ°ҐІ®І¶І®©їл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€…z]`q•ЉіГifd`[[YVOB4$ &S[][\ZYY[Z\ZYXUUVUSKKwНЗЖЧЫЫ††ТІ„йкмомлмлзЋУrb[WQRRKLLHJGEDHECEEEGFGEJAAEFLFGJGHLNOQRUUTWWWYW[ZZ[\[XQQXhПµЇХytuqnjgd`\XQE>EIE@BBAB?:.:DGCEB:P[Z_bacc__[XVQNMLMLJIKLPQPSTZ[^a\SRH>67<===8    &-.2>QYcD$+1BO[G ""'"$&&(*)+-..,,))(*))'$!&OХЄЊ¬®P   !#  %#B¶ќЌЭ9 NzH$&++,,.37:nЅф€€€€€€€€€€€щюээю€€€€€€€€€€€€€€€€€ююю€ю€€€€€€€€€€ю€€ю€€€юююыыээ€€€€€ю€€€€ю€€€€€€€€€€€€€€€€€€€€юшю€€€€€€€€€€€€€ю€ююы€€€€€юэю€€€€€€€€€€€€€€€€€€€€€юьъэьюю€€€юю€€€ю€€€ъэюц‘Уihfdbabb_a`_]i†ќ÷ЄfC??CGJHHMNPTTUXXXXXXYYXWTRPNRz¶ƒэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎШmZQOOMKKJIHHFGEHHDADJGGGHPLCEDD@A@BBABB>?@?=>?A?>?@=>>=<<;=<9;?@<>>==@==;;9;=<;;<=;:::<;9::<<8899:998454552110/113559756852/.-,,)))(/Ff}КРЪЬЯ§І©®®¶®®Ї„э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Њu]_mЮіѓЖidb`]ZYVMB4% *S[]ZY[YWXZZWWWUVURMEB_qzЗХНТЪҐЧЦ«бзлолмлйеЌФqbZRRTQMPNIJFGJHBCDBKIFCDGEGDEFDEHFJQLMRTTTUUUWZZ\\[]\\YQSXgТ≥єЧxwwopnjc`]YSD>GLE@AAAEC84=CFBB<;Q]\_aaafb^\YUQQMKNJJJNLOQSTSW\^d`PLUOA<:6/.!        "+/8CR]b:&-3BQX;#$ !$'&&'%)*),.,,-,)**,+))$!#!CuЗЙl8  !$    6Ч ћЬ9 Jr>&(*,-.-037lљс€€€€€€€€€€€ью€ююэ€€€€€€€€€€€€€€€€€€€ыэ€юю€€€€юы€€ю€€€€юъ€€ыъы€€€€€€ыю€€€€€€€€€€€€€€€€юю€€€€€€юэ€€€€€€€€€€€€€€ю€€юь€€€€€€эюю€€€€€€€€€€ы€€€€€€€€юэъыцьюю€€юью€€€эююььъюмЋСehecdaccaa``_iЯЌ÷іdE@BFIJKJNPQTUWVWYYXZYYYUUSQN]М∞вю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€я∆ТiRONMJJHEEGJGHHECCENHFFIFDC@BDCCACBC?=@@>=?@@??=A?=>=<>>>;<>==:>><;?;=?=:;>9<;==<9:<;9989;<69889;:8768952022/02214767696101//,)(((',EdzЗТЩЭЯ£§І®••®®™—ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»vZ_p†ѓ®Гiida]YXULB3#  &S[\[Y[ZZY[XWWXWVTQIA@[ozГЙНЩЫЭЩРµ№ййкдяжзж–Тn^YQRTOLLMJJJGFECEDEHGDDFGGGDGDEFDEJQPMRSSSVWVVXZX\\^^]YRWZfФ≥ЉЩxwyrokic_\YQD>GGBAA@@EF95<@CFG<>T^`bb`aba_\XURRNHLIMNNLNOPSTW\]e^PLRB2&        %)/8FS\_0"'+4ANW.""!"%%'(('***-.,,++*(*))''(""'32& "%    )ИƒћЮ9 Jh2%'),,-//48jњф€€€€€€€€€ю€€€€€ыюю€€€€€€€€€€€€€€€€€€ъэ€ьъ€юъь€эыюыю€€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€эь€ю€€€€€€€юю€€€€€€€юю€€€€€€€€ьщэцщ€€ююююю€€юю€юэ€€эе»Мggfcbb``bbba`hЩ«„Ѓ^C@ACFHKMNORQSWWWYZYYYXVUVRPOnЬїы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бµwYQOMLFHEGHGHHEDDAQMGEFFIF@AEBBBAAA@@A@>??=<>????=;<=>@><<=;:;=@>=>==;<<=?:;;<<::;;987::==;999:969877664341//1/1114998536553/,+++(*0Hf~НЦЪЪ°£••¶¶І≠ђІ у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€¬u\]qЫІ†yfeba_ZXWND3" $S[Z\\[Z[[[XXXYVTURH>?[xВЕМФЮ†•ЩЛ•‘№’–« ЁгбћНi[WRQRPLKLLMJIHGFDEDEEBFIGDEGFGFFFDGLMMOQSSVVYXVYY\[[\ZWPUYhУ≥ЊЪwtusmkhd^\XQF?DECA@A?DG:28?>CF;;S`bcfba_b_[XUSQNGIKJJLOOLOQSWZ`aZPI6       %+2:BQ[V$"&,4FSS)!"$#%'&(')++--.,-,*,-)+)'(%$   "%%!  !#zЅћЫ7 DW)#&)*+,/048jљф€€€€€€€€€€€€ьюююэыю€€€€€€€€€€€€€€€€€€юющь€€эю€€ю€€ъю€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€ю€€€€€€€€€€€€€юь€€€€€€€€€€юъшэ€€€€ю€€€€€€€€€€эъьюю€€юю€€€ыьэ€€€э€фўЊГfdeeac_acabc_hШ¬„∞`D@ACCGJMMORQRUWXWXYXWWSVTOLT®Ћь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч’Е[PQOIKIHEGFDEFEDMKEFHHKFCBCAACAA?@@A@><@@@@?>@??=>@=?><=><;;<===<@=:<===>>9:><;99;9;;::=:769;:9766767535//03/114457:76:::83.-+*))(3NqЗРЧШЯ°Ґ•®¶¶Ђђ™®ƒт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љr\]qЬ¶Яzg``^[YWWLB2 $Q\Z\\\ZXYYYYXWUTSOD=??A@@=?@B@>A?>@==><<=>><<==;;<9=>:=<::<;;<<<;977<9;:87:958999;:788475222/130023164656589751.+*(%&%5[|ЙПФЪЬЮ°¶•£®™™™®ƒу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љrZ[xҐ®®Аkd`\YWVUKB4 #O\\\ZZYXWXYXZVTUSOE=;GrСЙВЧЮЭ§ШК®ї™£ЮЈ„аёЏЉ}bZTRQQQOLLLKGHEFDDEEGFEEFFFGHEEHGGLPQQQPQRSUUSXZYZZ[\]]XNRYgЦїєСyywpmihc]YVPE=DFDC>>BDG91<<>=??<<=>;<=?;:>=;<>;<;9;;79:9:79::68;97757;::69;69:8867663654101//00040324048653/.+&$##&>jБЙОЦШЪЭҐ§£І®®™ђІЅт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€њrXZ{¶©©Аgc`][VVUN@6$ !Q]^][ZZZZYYWYWTVUPG?=@]ЙЦЦЭЫЧЭУФ≠Ђ†ЯЬЊўаЏЎ≠q^YTSSSRNKJLKIKHFHFEDDHGDFDFIECHDEJNQRRQPQSTTUSWX[[Z[Z^]VKMViЬїєПxyvnokea\ZVNC@HJDA@?@CJ91=?AAG>>T^befdcbb`][XUNNNOMLKLJNPRTTXZ_d[K4      +13?PX]A #'.;HV> !"" %'((),,,,,,-,+++,)))''""$#k®±ІЧАkXD  !!" !G©Ћ°:22 !$'*-./156kјтюю€€€€€€€€€€€юю€эь€€ю€€€€€€€€€€€€ю€€€€€€€ющэ€€€э€ю€€€€€€€ю€€€€€€€€юэ€€ю€эю€€€€€€€€€€э€€€€€€€€€€€€€€€юю€€€€ыэ€€€юэ€€юю€ыю€€€€€€€€€€€€€€€€€эьщшэ€€€€€€€€ю€€€€€€юю€юэ€ы№«Оjhfb`_`^_^^^`_iЯ∆ѕ¶X??@AGHJLLJOSTTUXWYXUVVVTRPQx°Њъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э‘ ‘“ЪiSNOMJDHIBDCDGFADFDABABB?@@ABD@@??@??=>=>?@?=>=<>@<<>A@=?>;:;<879:9:899858::7899887776878356963632300/13221.10/35775533.*'&&$+OoБКТХФЩЮ††§®І™ђ©ҐЅс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€јqZYА®ѓ™~ha_][XTRL<1$  O[\\\[[[[YXVWVWVSOJCA>NxТЮ§ЭЫЫХ°®ЭЬЮ∞Ќ„ё№‘Цd[WUTRQSOLHJMMMJJEM^NGFHFEAEIEEHDIJKNPPONQRSSVWZ\Z[XZ]^^UGJVm°њЇПvwvrmifc`[XNA@BHD@DCCOXUOSD4.57@Waeggecc`__\WSPPOMLKLNLPQQTTUY`d[L=     +27>N]_; #'/=AACGJKIJPRUUTVWYXVXXVSSOWИђ—ь€€€€€ь€€€ыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€г√xVQPNFHGDFEDBCCFCAACAAB>??CBCABA@?=<>AA=>?=><=;=A=<=C???E?<==<===9:;<:78:7943:859<9:;847;94955895344////10/101/1015874556631+*&%&1QpВМТТЩЭЭЬЯ£®™™™І§њл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€їqZY~™і≤Бkda_]YWTJ:/ 0!N\[ZZ[[ZXWWWWWWVSQMEB?EcАЛЬ°£†ЫЮЮЮЬ§њ–„ЁЁЅyZWUVQRPRQPLJJKMIIDLYUPHIJHDGIEFIHLLLLOLPORPPQTXYZ[[YZ]]_SGKWlЯњљСwxwomligaYWO@?AEDAGM^|СЫЭЪВfK82;\fijihfc``^\XSSOOMLJLLMOPPSUWZbeZJ9!    ! %/49AP\_3 %*2ATV/# !!$"$%%(*+.--,,,-,,,,+)(&"!!!$qЇ  ћЋ»ќЊ[  "# "3Ц…Ь7 #& #)+--.045lЉу€€€€€€€€€€€€э€€€ьюэы€€€€€€€€€€€€ю€€€эю€€€€€€€эюю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€юшць€€€€€€€€€€€€ющъ€€€€€€€€€эююю€э€ъэ€€€€юыщ÷ЃАibb`_``]_``bbaiЮ«“™^A??ACEKLKNSRTUUWWWYXWWUQSOdЦЈрю€€€ьшшыю€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—Г\ONJJFDFC@AADFHFECACBBA@B>>@B@@@=<>B?>=<==<;;=>==@EA>?BA?9:<><=<;>><99<868:==;;6;976::98587997625625/002/10440121311255464.+'%##4SpЙСФШЪЬЮ†§¶ђ©•©•Їп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љrYYђЈ≥Дjd``^[ZTK?1 +'S^\ZZ[\ZYXXYXVVTRQOHC?BOlЗШ£ҐЩОЙЩ©§®Є–Џџ„ЮbWUVVSSRQQNMLMLHILGFHJNJIHGFGHIKMJLMMJLQPRQQRVWXWXY[Z\]^^SBLXkЬљЇФz}yomlhd_YVOB@IFBDVtЪї…… ѕ…Њ¶В]Lbkklkihecb`^YVSOMNNLKIMMMPQTXZ`eZH3 #   #058BN^W&$*6FYV%"#! !"&'$%*,--,++,,+,.++*&$##! %lЈ…ћќќ…ЌїY "#"! !-Й∆°7  $#%(*,-..26nЊую€€€€€юь€€€€э€ю€ьэыэю€€€€€€€€€€€€€€€€€€€€ыю€€€ьюююь€€€€€€€€ю€ю€€€ю€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€€€€€€€€€€€ъхю€€€€€€€€€€€€ь€€€€€€€€юю€юьэюь€ю€ю€€€€ээѕ°|iadb`___]\`b`[hҐ»–™_C?>?BCGJMPTRSSWXVWXWVUSSRQs°Љы€€€€эъээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№ПbROMHFEBAAAADJICBAB@@CB==?A@@??>???==><=>;<<<:<>>A@?=>C?;;;:8;:;==<<::8688;;78785789:::656:996655561133-/23212/.10/043374/,*&%!)9VoВЙОТЧЫЬЮҐ£©®¶©©•јк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЉnXX~±ґђje``]Z[SIB5)S[]\ZZ\]ZYZZYVVVRQRLH@@BTІЈі®ЭЪІЃіЊ»‘‘‘ЉyZYUVUTTTQOMMNKIKHJIDFHIIHGFFCHJGJKMMONQPPRQSTWWXYZZ[\]]_aUEOXlЭјєРzyzqkkhc_[UO@AMIDR|Ђ≈–“ќЋ——“‘Ќ≠Гvrommkljfdb^YVRPKMMLIKKLMPQRY\_cXH0    $-6:BP]Q  $+8EYQ!"!!%&&#&)-+),--,,++.++'%%## "&gґ ЌѕќЌќЉ_!!""#"  %{¬ЃF !$%(*,,/11gєоээ€€€€юэ€€€€€€эээ€ээью€€€€€€€€€€€€€€€€€€€ю€€€€ыьюющю€€€€€€€ыь€€€€€€€€€€€€€ю€€€ью€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€ыю€€€€€€€€€ээюь€€€€€€ююэ€€€юы€€эы€ю€ююэюуЅЬ{iabb`]^`^^__^[lІ»ѕ™`D?@ACEIHKPSSQTWXXXWWVTRVSVВ®’ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бѓsYPJJJEDCABCFDDCB=??@C?@B@@A???A@?=>@=>?==>><===>?@AAC>><9::99<<::8;=;9;9;;246535578:77669:9996746433112121000/3400123441.,)&#)->]wБИРТФШЫЯҐ£І©¶І®®љу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЊlY[wђЇђ|hfda[[YVMA5  )P[\]\[[\ZZ[ZYWUVSQSOKG@BE]ТЇ«»√ЅЉї«”Ў÷–јКaYWVXWTTTQLIJMNLHGJKIEGIJHGMJCFIFGIPQOLPRPNQRUVXXYZ[\]^_a`UFMWlЬљЈТ{vwpokgd`[VP@DNJQy™√ќ“’“—–ќќ—џ№∆ҐЗ|sqppnicb\ZWRNNNKKIMILOQUUY\_bYH/   )17?FP]J !&,:IXH! !!""!$&(()(,+.--*-**+*)&$$#" $jЇћѕ–ќѕќЇ\ !!"#     nїЊl !$%(*-,.00fЄрэь€€€€€ю€€€€€€эью€€ю€€ю€€€€€€€€€€€€€€€€€€€юъъю€ъэ€эю€ю€€€€€ъщэ€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ю€€€€€€€€€€€€€€ю€€€€€€€€€ыь€€€€€€€юэ€ю€€€юэюыэ€€ю€ээ€э№≤Щzjdca``^]]_`^]\o¶∆ћ©bC>?ADFJKJMORTUVXXYXXXVUVQ`О±у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ц»Б\OOMFFGGHEFEHEC<>@>DCBBABB?@BAA@=>???===;<@><;==>@FA;=:8:9:;:<9;9;;88;9:;899654389::954884598623765531100/2234102/1102320,'%''-Ecv}ЖЛМФЩЫЯҐ•¶¶••ЂЃ«п€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юш±iY\s•≥≠}hdba]\YSLA5  'R\Z[\Z[[[[ZXZVUWSPSSMOGJHJbПЈЌ—” Ћ“’÷ќЇЙaYYVYYVSQQNLJKKMIGFIIHGIGIGIMQGELHJMRQLMQORRSSUVWX\\[\]^^^_SHOZlЩљЄТyvvqnkhc]ZVOBFQMlІЅЋ”÷ў„÷’––—Ўадќ®Пxvpqkeb\[ZURRQKMMNKNPRTUW\_cXE/     -5;AMV]A ")/>NY@ ""#!##"&$%)**-,,-,'(*(&))(""%"!%oЊ–ѕѕѕЌѕЇY !###   " aµ¬% "%*+,,-02fЈф€€€€€€€€€€€€€€ю€юю€ю€€эю€€€€ю€€€€€€€€€€€€ющэю€ью€юэ€€ьюэээ€€€ью€€€€€€€€эю€€€€€€€€€€€€ю€€€€€€€€€€э€€€€€€юы€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€ыэ€€€€€€€€€€€€€€€юю€юэ€€юъ€рЌ™Чykeac``^]\_``_]o°ј«§]@=?AAEHJJJQQSTTVWXXXXUUUPoЪєщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏОcPNIFKNJFJEJBAA@@BDBDCBDAA@B@CA@@>@>>>><<=<<>=:<<@@<>;<;79;:;9<<<99:::9979:8868:77:98985757963777663202//1025300//.-/0110)#$$"/MgqyГЗРЦЩЭ†°§•§§§ђЂњи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щф—∞{[[[q•∞•{jfe_\\YTI=2 3:)Q[Z[[XY[ZYYXXWVWUUVVPQPQMMO`|ЫЄ∆»Ќћ…ј•`WX[ZYYWTRPPKKNHMOOLJKFHFEFEFLOFHJHLRPPLOTRPRRTYWWY\[[[]^___TDLWiЦЇїФ{ywvrnjb\YVMCINZУљћ“„Ўџў„ўЎ’÷ўяддѕђУБzuuoia][YVUSOMNONORQQRTW[_dYG.     "-5=COY\6 $+0@OX:! """!$%#$'((,++)*()))(*('%#"  &lїќќѕќЋћЈY!"!"!  Q≠Љr! !&)+**-11hЄиююю€€€€€€€€€€€€€юыэ€ю€€€€€€€эю€€€€€€€€€юю€€ю€€ю€€€€€€эюэюю€€€€€€€€€€€€€эь€€€ю€€€юю€€€€€€€€€€€ю€юъю€€€€€эъью€€€ю€€€€€€€€€€€€€€€€€€€€€€э€€€€€ю€€€€€€юы€юю€€€€ююэ€€€юйƒ§Хzhcda```_````]^u¶√∆ЭY?>B@CDGIJNSRRTUWYYWXWTTSU~¶ѕъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вФdRNKKKJGHBEAACBBEC?CBAA@@????A?>@?>==<>>;<;:<98;>:998798=<:;:9:;;8:95975657::9778755574567664342210//163//./+--,,/1+$'&!%8Ncr|ВКРФЩЬЭ°°£•Ґ®≠≠љв€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щю€€€€€сЎљЄЄ†Г]PWYnІЈ®xhfe_[ZXSL@4IQ +PZ[\ZWXZYYYYYYXWXYXVTSVTRRRVWMdАФ†ЬОs^XWUVYYWWVUPMQMMPLNPMKHILIGHHGHLMGKHEKLMPQOQPPRRTVVW[[[\\]_]`_SBJUhЧєґО{|yupmh`]YWPFJMqѓ«–’÷÷„”’÷Ў„÷ёджйжћЂФД|vpkb\ZXUSRONMLMPRQOQUY[`dYH,   (2:>CLWV+ "*0?PX3 " #$#%%&&'-*+)))'(')(%%($!!!! &qљЌЌќѕћћє\" ! !!#! @§єe "&))++./0eЄвьъы€€€€€€€€€€€€€юью€€€€€€€эю€€€€€€€€€€€юэ€€€€€€€юю€€юыэ€юю€€€€€€€€ю€€€ю€ю€€€€€€€€€€€€€€э€€ю€ю€€€ью€€€€€€юъь€€ю€€€€€€€€€€€€€€€€€€€€€€€ьюыэ€€ю€€€€€€€э€юю€ыэ€ю€€юэ€€оЄ°Уyhbcbba_^_a_`__v™…ћҐZA>AACCJNKORSRSVX[\VVWTVR]Н∞гэ€€€€€ыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вЭmSOLKKJEA@CBBCDCA@BAA@>>@@?=?????<<=>>?@?><<>><<@@<<<;9::::68;>>=9:;998957985789;987;:68768523643252100000221///---,*,//)(("$'5KcrzГНСФЦШЬ†§£••≠≤±Єз€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шџЅѓҐЛЕКcUJJUWkЮЃ¶{hd_[YXXWO>3+0+QYZYXZ[ZYYXX[YZWYWWYXWWVUTT\g=#.AJF<,7RVOTVWWUTUPPPLMPNNLJKIGIIHJHIHHHKKHIKJNPJKPQRSRTUVY^]][Z\_^bcRAMUjЦєґПzyxqnjgc_YUOCGUПљ »∆«…≈¬¬≈—÷ўжмлкма√≠УАyqkg`\YTQRRMLJNOQQOQUY[_cXE+        "+6=@BKWU' ")2ARW-! "$!#%(('*+-,)+*)+*''$&&#$!#! &uљѕ—ѕ—ѕќљc%  !!&  4ЩґZ !"$)+*,/0.aЈйэюю€э€€€€€€€€€ю€ъюэю€юю€€€ю€€€€€€€€€€€€юыю€ю€€€ььъээыюю€ююэ€€ю€ю€€€€€€€ю€€юю€€€€€€€€€€юэю€€€€€€€€€ю€€€€€€ъь€€ю€€€€€€€€эю€€€€€€э€€€€€€€эцэ€€€€€€€€€юьэюьюю€юэ€€ююююаЃЯТwic^_a_\]]^^^^]rІ Ќ§[A>A@@DJLLLORQSWVXZWWVSURiШґп€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иЄxXPNIIFE?BECCAC@@CCBA??@>>>A@B@>>;<=>?=;<>>?=:988:;:657<:998357799686755987:8:79746732143422/100053/01/-0/--+**-.,(%!! #.I^m{ИНОПТШЬ°Ґ§§©Ѓ≥≤њж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тꔬµ§РziQIF:7:HVWgХЂ©id`\[YXWPA1 #$MWXXYZ\[ZYXXYXYYXWWZX[XUUVTZ{e&7SUNPUWUUURSQKMNOKLIKJHHGCDFGGGGGLKHJKJNQNOSSTTTXYYY[[]\Z[^]^`RAJTmШЄ≤Пywwsqlid^YTOCGc•»…∞°І≤ЇєЇ¬–ЏбкнмммйЏњ†И}vmhd^[UQRSOMLOLNOQSTW[_bXF+     #+4==>=;:;==A<;:79;;;:68;:;::8:87799954969878797546554503641437155761-/2.//,.,+***,+&#!!.DXn~ЖЖЗНУФЪЯ°Ґ£¶ѓЈ≤їяэ€€€€€€€€€€€€€€€€€€€€€€€€ъ€€€юоќЉЃЯРzhTB91-+).:GVXfРІ¶Аkfc_]ZYXN@4 5GNQSWWVWYYYXWYYXXYZZ[ZUVVUWqw> ?@??CA?A@=@?<=<>>==?;;=<:?==<:9878:<97:;<:98::88:78715<87:9778635655542379225655556//053/-.-+,,)'(+*'$!"->Ul|ББЙОПФЩЬЮ†°©ѓі±Є„фью€€€€€€€€€€€€€€€€€€€€€€ъоќљђЫГЗoRD=2,,))'#/9FUXgУ•Яlea^]Y[XKA4( +27CIB>DMOSUWYYXXYXZZYVWVSU]hR*  $FTXTLNRTSNQPOOOKKPNOQOKKLLMJLLKKKIMKJJKNPMPPQUUVVWY[\[\_]]^cc_PALTmЬє≤Мwzurpmhb`YWQEL|≠њ©•©£ЮЮѓЋглммлмнмллм‘≤ШЖysi`]ZVSQPNJJLKNMPRUX[^dVF)    %17=@JR\J$*;LXA"  !,*%&$(**+++(()()%('&&&" !!! :{Э£®Ђ∞µ®^" !$''&&    "gЮD !$&'++-13eµу€€€€€€€€€€€€€€€€юээю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыюыэюыю€€€€€€юю€ю€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€юью€€€юью€€€€€€€€€ээ€€€€€€€юыэ€€€€€€€€€€€€€€€эю€€€€ю€€з≥ЭЫСvhbba`____^]`][r§√«ҐW@<=>>><>>=<=<=><;<<<;;:;:;;;;:87:9:87977634766:745575745552447864466536522154/--,*+)'&$(*)(#"(8RjwyВМПСХЧЭ†Ґ§¶±µ≥є»мю€€€€€€€€€€€€€€€€€€€€мќЊЃЪДl]NMB70/,)'%%"!(4CV[mХ¶•~jfa^\ZXUJ?42 +.,98)$+27>GPRTVWYX[ZYWVTRUTXYE-#:OUVSMQQTRRQQPOQPOLMNMKKOQMNMLMMPQOQMMMMPRPSQRTVWXYYXXZ\`_]^baaQ@KTqЭЉµНzytrnlid_YVPHR≤ґ®ђЭТРСУіџйммнмннмлоЏЄЬЗ{rh`\WTRQNKJIHMPNPRTY^abUE)    '4;?BNY^A&.DHHJKKPSSUUSUWVUU\WqЮїш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№О`OJKJFEBDAAEFCBBCBA=?A>@?;>>?=<<<<<<;<<;;;=;:;;<:;<;:9<989858988::96443579843255666313575423205632342/020//.+++('&$&'&(#! '6QdoxЕМПУФЪЮ°£§ђ≤ЈЄ≥”€€€€€€€€€€€€€€€€€юећЊ©У~k_PB>620-*+*&$" !'2EUXrЧІ©Аicb_]ZWRI=57!  (=F@A:1**'&'-8;=@GJHGLPPOQSTTVWUSWZX}®Ќщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еЪjTNKIFDCFGEDBAAA@>>?A>@@<@>>>=>=;:=?@=<<:<;;9==:<><;:978969:867;;875555564202767630.04449424013312222242/-++*+*)&%%%$$$% !&7K^jyЕНРТХЬ†††•ђ≤ґЈЉ–у€€€€€€€€€€€€ын–Ї£Мxi[MB?;760,-)))''&"'%)0DTYwЬЃђАje`_]XWTK=1-  !/EMONHDA>93/()(&*0:KTUVZZVTUSQRTXYWXXVSSSUTRSURQRQSPNJLHORQMOMNMMNLLHJJKOMKRSTRQRUXWUXZZZZ\_^_aagecR@IUsІјєПxyxtnkhb]ZUNBQБ≠∞Їѓ°Я°ШСТ±аммопннмлмгљЭЛ}qjd^XWUPLNLLNKOOPRSTY_`TB$      .<>?JU[U* '3>SS* !$)('(*+93++,++*))'&&''%"!" #  7z°¶¶®І§w5 !$$$%&!   9h2  !$''*,-00`Љфэю€€€€€€€€€€€€€€ю€ююыю€ю€юэ€ю€€€€€€€€€€€юээ€€€ъы€€ю€ю€€э€€€€€€€€€€€€€€€€€€€€€€€€юю€эю€€€€€€€€€€ю€€€€€€€€€€€€юью€€€€€€€€€€€€€€€€€€€юэюыю€€€€€€€€€€€€ю€эю€€€€€€ю€€оЉ£ЮШНugea^__^__^^_`[m®ћЌЭYA><@DEEDIONPPQRSUVUSYY_Л∞дэ€€€€€€€€ыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€к¶v\QJFECHGDBCCDC==?===BA>>>==<<<<<>@?>>=<==;;<<<;==;:;:;;:955876785867647677466653333575::762331253443320-)'()(*&%%%#!"#  &2FZl{ЗМОПШЭЬЭ†•≠≥ґµ∞‘ь€ыю€э€€юм‘√Ј•ЛudVKD?<7750/,+-+)&$'%#%"&,AWYxЯЃ≥Бhf`^[YXVL=1)  "##%$0HOPPNLKIKLF=953/*+2566@DDFLPSTRSVZ[YWSSUVTTTVSQSRRQMIMNNNMNPNOOQPOMLNOLOQQQQUSRVXWUXVYZZ[^]\_aaehdTGMUt¶љµМzxvtokie_YTNBKuЪІі±І§ҐЫЬХ§’лнмнонлллгїШЗ}rlh`YVUQNMLLLLPOPSTW[baSE'  1AC?FSZR#"(5CVO!'*$"%-741-..,,)*(&'('$##!! #6q†¶¶••¶v3  #%"#(#  .N)  ""%'$&+,10_Єчюю€€€€€€€€€€€€€€€€ююыы€ээ€ю€€€€€€€€€€€€€юээю€€шчэ€€€ююыщю€€€ю€€€€€€€€€€€€€€€€€€€ьэ€ээ€юю€€€€€€ю€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€ю€э€эюю€€€€ю€€€€€юьюю€€ъю€€€ю€€Ё∞°ЮЦЛsecab_]^]]_]]_\qђ–—ЫU?>>?BCEHMNNRQQTWVUTTZZjЪєт€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ніБbMHIDDDGFCCDC@AA=>???@=@:;;;?<=AA><<=>>;<<<:99;==9:68:=;45886972794357:997552265334369896365121212310/+*)(''%&$%#"! "$/FZjyДЙНТЦШЪЮ°®ѓіЈґїѕц€€€ьп‘ЅѓЦn^SIB@@:9:121/.,*,)&&&''" ""#.EUX{¶±ђiecb\ZXUL@0$ "%'%$%'&')'0HOQOPQOOPRMMJIGD<872,'+))+17CHKLMSWWTTVVTTSTUURTSQQNNNPNMQPOPQSTNNMMPSQSSQRSTSTWVVWWV[[[]_^]^abbgeUKOSrҐјµКxzwvojjf^YVNBGhЙЭі≥І°•†ҐЩЭ…жмллкклклвЄХГypkf]YTTRNKJKJJKORSUX[a^RE$  8@DCERZK %,4DZG #&" &*+/,---/0-**)&&&#$#!! "!'5]Х•¶¶•§o/ !$!$*%  &:' #(''),.//b≤ль€€€€€€€€€€€€€€€€€эюююююэ€€€€€€€€€€€€€€€€€€€€€€ю€€€юьюю€€€€€€€€€€€€€€€€юю€€€ю€€€€€€€€ю€€€€€€€€€€ю€€€€€€€€ыь€€€€€€€€€€€€€€€€€€€€€€€€€€хь€€€€€ээ€€€€€ьээ€юээю€€€€эћ®†ЫХКtgbcc_]\][\]^^[sѓѕѕЪT??=>BCEINJKMQTVXUUTTWYw¶јц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€с№П^NOKFGGFBABDDB?@=@A@?A?:97<==@?B=<=;?B@;::::;:<<;98879=68:8897853644645875843353655::6454841/012021/.,+'&&&$&%$#"$" "! %1@PcuИОРУЦЬ°¶™ѓ≥Јі≥≈й⓬∞Тxh^QGA?>;98885/../.-.()()(%#" ,CSWxІЄ≥Дidc_\[WTH>/ %&,////.,/.,+,,--,3FMSRPSSQONNROMKLIGJD<862,)'(,'*38?GLOSUWUSSRSUSRQRRQSPQPOQPNNPSTPOMNRUTQROPRUTUUTTYYY\]\]_^`bfdfffTHOTq£ЅµЛy|ytnlle^YTL@C]ЕЫЂІ•§©¶°ЪЩњёдгб÷џииибєХunha[WSRQOKIKJHINRRSXY^\RF$ #pЦ•©©Юa) #"#&%   &:+#&&(*,-/2d≤гь€эю€€€€€€€€€€€ььэю€э€эыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чь€€€€€€€€€€€€€ющэ€€€ыю€€€€€€€€€€€€€€€€€€€€€€€€€€€ттэ€€€€€€€€€€€€€€€€€€ю€€€€€€э€€€€€€юьью€€ью€€€ьюююэ€ю€сљ§ЭУРИreba`a_]\[[Z[]Zt±ѕќЫT>><=AADGIGJORUVTTVUTUZГ≠«ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еЬiRKIGDCEA@A@???=@A>>C=<719:<@@AA?<<=>?<9;<;;;<<<<;<:::89897876473555524735525447544552454122123010.-,(""""#%$%$#$$"!#+5Mcp|ИПРУЩЯҐ§©Ѓ∞∞±™µ®НxhVG@@?=<:;9643521/.2.,,)''($!! *=QVr£µґКjba_\ZXTI<,)3=ACB<:??97534565321108ENSRRSUSRNPRQLKLNMNMIFFEA=96/ &*7>@IQVVUUTSRSTSQSRQQQQRQPQSSRRSQRVURQPUVVTUUTVYZZ]_][__adfdgheUENXsҐЅЈПzzytomkc^YTMCDRЫ•Ґ™∞Ђ£°ЬЪє“–Ќ«љ–дизЁ≥О{qkf_WSQNKJLJJJIIKOSRVX\]TF$      *;>CEMX`?&.;IW:  !'()*&())-+%$)*(%&(03+$"#"! %*>jЦ¶§ДH# #$$%&  !A."")@<*&%''(*.13b±въюю€€€€€€€€€€€€эю€€€эю€юэ€€€€€€€€€€€€€€€€€€€€€€€€юэю€юьтфэ€€€€€€€€€€€€€ыю€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€шчэ€€€€€€€€€€€ю€€€€€€€€€€€€€€€ю€ю€€€€ъь€€ьээ€€ю€€€€€эюи≤ЮЫТСЙrc`bb_^\]]\YZ\[uѓЌЌЫV?=<>?@FHHIMQQRTSUVSUVcРівь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€м®lTMHCDDCB?>?=?@?>=><:9469:==?A@?<;>?@;99;:;=<;;;7789:97883754678875433466414254574224652132210-.00,)'#!!!!##%%%%#"! !):N^p|ИООЦЪЬ°ІЂЂ§ЪМwhSG>875979969851/3212/20,(()(%$$#  /BTZtҐЃ∞Зldbb][WRJ;) ".>JSXXTROLFDIGCB=;;<=;88415@>EOY^6 !'3>MU2 !!$$%())*'%$%$%)*HfB$! !!$&=oЗ{Q/!   "#'&'(   =.!",MЗ~H*''&&),.1b≤ещэ€€€€€€€€€€€ю€€€€€€€€€юью€€€€€€€€ю€€€€€€€ю€€€€€€€ъщюшэюэю€€€€€€€€€юэю€€€€€€€€€€€€ю€юю€э€€€€€€€€ью€€€€ью€€€€юю€€€€€€ю€€€€€€€ю€€€€€€€€€€€€эю€€€юью€€ьэ€€€ю€€юэьщ—¶ЬЪУРЙte```^_]]\]]\Z\w≠ЋћТS>===>AGIIHKNOPUVWWSTUmЬЇц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€пЅБXLIGCEDBAA@??CHCC@=;6:9?=><=:;::7:>:;;9;669988897767676589845346413572158603721330110//--+)%#""!#$$&&'&"#! $,7I\l{ИНХЬЮ†ЬХЖr`SE>73313363346962/020/0.--+)*)&%'$$"!-CSYt†≥±Жkc`_]YXUN>+ $5ERagfeb^ZWUUVRNOLIHFDBA@>><989?LSTUUSUYVRRRSTRRSSPOQMMMLMMMF' ,--/.1:?@FIJTVVYYYYYXVSTVWTUTSTTRSTRTWVTUWXX[^^_aaa`addcdcddTLQXw¶ј±П~zupmkfbZTPGF@ZПІІ°ІЃ®ҐЭ†ѓ±±Ј≥∆язжжЋЩ}slf_YTQJE@>AEDGCDINRTVX[]R>"0?>>FQZ[- "(4>OP, !#%&"&$!(+-TyP' #7B9(!  !#$&'(  ! 7.&%,SmI.()')*,,-a≤мэю€€€€€€€€€юэ€€€€€€€ю€юэ€ю€€€€€€€€эю€€€€€юэ€€€€€€€юэ€€юьэ€€€€€ю€€€€ыэ€€€€€€€€€€€€€€€ьююью€€€€€€€€€€€€€эю€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€€€эю€ыэ€шƒ°ЬЩТРКsfb_a_`^]\[^]\\y≤ќЋЛL<=<;?CDHJKLNPQSVWVTSUy¶Њу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыЏМ^NJFEBBAA@?=>BCDD@>;96:>BABAAA><;=<=>=99<::87<<9:;;86768::66667775337650565404675331231202230--+'#"!"!#&&(''# " !""'6HczМЧЧСДwh[L>53111130035237663330-00-.-.-**(&%'$""-BSYoЩ™±Йica\YWXTI;+ *:M]hqyxuttmiea`\ZZYWTTRONPMLFA>@><:@MSUUTRSQRTSQSTTPNQOPRPNNOPPOI- 6=:96311/124>>>DHEBGJLPTWY[]Q=  3<A??BA?<;;>ACB>;:;:<9;<:88::78848;B<744756533533437984246762233243541.--($!"%&&((&"##" #  1H^wЕИБs`N?5/-++,...021./4415799441/00/,.--*($%'%"!!!,@SXjЧ®ђКib`\YWWSG=- !/BQduЗЗГГДВБ}zxtrqqjec__^][YVTUSNJEEC<:?DFBEEILNTWY\ZN@"  5<>?HS]S"#%)6DTF  !!#'*' !$$%'&"  (?D0,**--,))'(++-.a≥м€€€€эю€€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€ю€ю€€€€€€€ю€€€€€€€€эыэ€€€ю€€€€€€€э€ээээ€юээ€э€эю€€з≤£†ЧТТЖpe`_`^]]\^``]]_БЄЌ∆МO>>=@ADGEKNNQRTTUVUSScПЈу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€о®pPFB@CB?AFC>=??=9689=?>:<@@>:<=;<@@<=;;<<9:<:;;:97::79:8;754534540355315:9713323224734650.-,((#!&'''&%"$$# #"#.=M`szznZI=6-)(&(**+-...21..2524689444230/--,++(&&&&"! "-BSXhУЂѓДf`^[YYWRF;- 3L`vБМТЦЩЪЦУТСПНКИДБ~~zysqmligeca^\[WWUSMHC?@NTSRRRRTVTRSTQPPPOOMPRPOOOLPK0 >JKLONKGEDA;82.))+-17BEFKQTTVVSQRSTVUVUTTVXYXY\]\\_adccbeifeTFNZy£јґЦАxuurmjha\VOBA<3=nЕ}Л†ЪЦПЙШЃ∞Ѓ ёваб√Оwpjec^YTQLJEA@B@@B@GKNRVX]YRB$#7<>BNW\K "%*8ES> !* $$#%()! &76-($*/-*)'&),--+b≥дь€€€€€€€€€€€€€€€€€€€€€€€€ъы€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€юыю€€€юю€€€€€€€э€€€€€€€€€ьэ€€€€€€ю€юю€€€юэю€€€€€€€€€ээю€€€эю€€€€€€эюъыю€€ььью€€ыюэюѕ©Ґ°ЩХХИqfb_^\\\\^__^__БЈ …ТO<;=@BFHEHMNORTSSUUTSnЬљп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рЅАVHDDC?ADA@BAA=;89:=AA==@A<:>@>=;<==<@A:8;9:;:7747;8;96777624784314423353623424544542230.,*&%!!&'*'&%$$%"!!" +=PdsuleZM>.*)*'&'((*,+**.//-11244334542321////,-,(&#$%%"  -BT[mПЂ±Еga_]ZYVPH;3DbyМЪ°££•§ҐЯҐ†ЯЫЭЪФУТПНКЗЕВ~ywronlhfe`Z[[XSNMGGOTTTTTSSTSTSSPPOPONOPORQONPTO0 @JMKMQOLLLHDFB?:63.,---037;?GPMMQSVUSSUWWVVXZ\\]___aaaebefdcRFO\{©њ±С|yzwsmif_[YPB@;32IvЕЖСФМГИЮ≥љ ÷ЁбаЎ¶}rpkea^YVPHHFA@@CA>@FKQRWY][XB  ,<>@FPZ]A  '-7HT7  (    !!##%&! !,&%$')(*'%('(+--,b±Џш€€€€€€€юэю€€€€€€€€€€€€ю€€юью€€€ющь€€€€€€€€€юьюю€€ю€€€€€€€€€ю€€€€€€юю€€€€€€€€€€€€ьь€€€€э€€ью€€€€€€€€эю€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€ьэ€€€€€€€ъщюэю€ыээю€€юю€чƒ§£ҐЫХУЗpea`_^[\]]^^]^]АЄћ∆ЛK;@B@>:;>><;<=<;<><;A<;:;9647;::96879678764555743334643755652531/20/-*$!"%')('&&&$$#"#&0@WjrpdSB70+($&('$%%%%'+)'(,0.,022442331322130/.,.,('&$#""!! !-BSZkТ™≠Дhb_\XTTQF;@yҐ≠≠©©ђ™ЂІІ£§§§§†£†ЮЫШЧУСТМКЕДВ|ytrplifa_^ZVRQMKOSUTTRRUSSTTRPRQPONPONRQMOTTN0 ALLKNOLLMNJHIGGCB?;974/-,*((*279>GJNQRVWTUUX[]\]^`_^`cdddeeeTJQZw¶ј±Мxx~|rkig`ZXQDB?703SЕ®Ђ®©™ѓљ…“џаяёџЄВpomjgb^XTKDFC><>CB@AFLOQVY[[U@/=>CFQ]`;"+.9MP-    !$#%#""  ((!+;.&*'#')((*,/`ѓдщэ€€€€€€€эю€€€€€€€€€€ююэю€€ью€€€€€€€€€€€€€€€€ююьыээю€€ю€€€€€€€€€€€юью€€€€юю€€€€€€€€€€€эью€€€€€€€€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ээюью€юээю€€юь€йЇ££ҐЮЦРЕpcaba^]]]^^_]]^Бµ ЅДI;=?@DKJKLLNQQSTTUTPSБ≠аь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€южЧaLE@HGBBAA@==<?A@><>>;<=<;<;8996699899;97666542764424303542565624540/1-++)$! #&))+)''$$%#%,>P\`[OA6,*(&&%$$%%$$##%%&(&)+..,-//341452234101/-,+)'''$%#!"""0DT\mФІ™Дib_[XUUPI>GЗЃ≤∞ЃЃЂЃѓ©©™©®™™І©І•§†ЭЬЫЪЧУПЛЛВ|zvsplgeb]YUTROOQTTSSSUTTTTSRQQQOQNOOQRORSRM2 =LMLPLHLIOPKJJIFDBBB@>;7431.*(*)*-07>DJLRWVVZ\[]^__adeeefgihVGPYz®јЃИwzxtpnje]XUNACC;1/7YНµЅƒ»ћ“ЎўЁяёЎЉИnmljiid_ZTICFCBBBBAABEHLQUXZ[R?2<PN)     "!#$#%') # %)%-;.&*)''&'*++/`≤нээю€€€€€€юю€€€€€€€€ьююэ€эьюыэ€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€€ю€€€€юю€€€€€€ю€€€€€€€э€€€€ь€€€€€€юю€€€€€€€€€€€€€€€€ю€€€ью€€€€€€€€€€€€€€€€ээю€€€€€€эюьэ€ю€эю€€ю€€ьџ∞Ґ°°ЭФОЕna`a`_]^]]__]^^А≤∆¬ЗK:=>@BIIIKLORSSUTTROYМЈф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€н®lPBCB@ADD@=@AAA?@>=@@==><<:<;9=A=:;<;:9:<67:98735;<;:7734534476465535524775413451/0,()&"  &).-+**'%%$$*4CIE;2*('$''$$###"#$###$%&'&(+-/.-//0334110050./+++*+)&%#$#### "0DVXkТ™±Иga_[XXURM=HИ≤Їґґ≤±≥≥∞±≥ЃЃ≠ђЂ™™™®¶£§§°ЭЫЧСПМИЗВ}yunkihb][[VRQRTUSTUTTTTSSSPRTRSRTSPPPSRQN3 >MPOQNMOKLNKLKFDFDEDCA@@>?=:875/-*)&)-/2;CHOSWZ[\^^accbdgfijVHQZw•¬≥Н{yvtqlkc]ZTI?BD?649@UНЄ≈…ќ—’÷ЎЎѕ∞Дlkmjjjhea[SLGDEGKHDBABCDKRVW[\Q? 8?ADLT_^2 #,5BSK%    (''*03)"% ##',,)*,))''+.-,cізэ€ю€€€€€€€€€€€€€юю€ю€€€€юю€ю€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€ыю€€€эюэ€ъьэю€€€€ю€€ю€€€€ьыэ€€€€€€€€€ю€€€€€эю€€€€€€€€€€€€ю€э€€€€€€€€€€€€€€€€€эъь€€€€€€€€юьэ€€ээ€юэ€€€„©ЯЭЬЩФСЕnb`]\^]\]^^^\\[{≠«»ЛL<=?@@GIGHLORSTTTQSQ_Ч∆ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т±qRD@BAAEA>====<==;=?<=><==<;:;>=;8798::779966966978:;656553153576545433443300131000+&# (-//-)+.-)),021/,)(&'%#$%#!!"#$###""$&&'))*,...//212131/03/,/63-+,,(%&$$##" #.DTYlС™ЃИgb`[ZYTPK:GК≤ЇЇЄЈЄєєЈ≥і±≥і≤і≤≤±ЃЃЃЂ©¶ҐҐЯЮЪЧФОКЕБzusqnfbc`\TQQY\TQSUSSSUTSSVUSSUUSNMOOQSR2 ?MPQPPRQMNPMLJGJFFGHGCBAAA@=>=<98840/-+*++-4:DHOV[^_`bdddghhVHN[y•Ѕ≤Нyzyvqjieb[TLABFD>@BEGIHKMPSTTRQTQfҐ”ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фјWHHEDFE?<<><9:=?=;;;:::==:;;<<<;;99=;99795699787897565464354667861341141320032//.*$! '-/./+0773/0/+*)))'&%&%%$%$! !##"#!"&'&(*()++,--/23432/0//0-0=5+))))'$$%'%"$(,-6GTXmФ®ђЗj`_^[XTNHHKOQOQTOPPNONLIFHIGEBEFDBB@??>===99:97420-.,+,3=><>??<;;<;;><<<;<<:9:89<;96798855589659655566773795562242432131..-)"! !%,/./-69452/-(**('&&$%$'&"""!""! !"$%%')((),,+--.2312/00/011/0.,+**)'%$%)0;Nds`CCRXkЦѓіНi___[WTQH9HМ≥ЈєїїїїїєєїЉЉЉљїЇєїЉєєЇєµµѓЂ≠Ђ¶•ҐЭЫХПКДzupnld^XSNNRUWVTSUTQQPRSSSQPRTTQROQO3?JOTRNQQOPPPPQPLKHHIGDCEDCAADCC?A?>?@CA><<:;<842//.5>DGPX\_^QJQ\{•ЊђЖ}}wromke]YWQBERPIDDED?-%6BE?2'?^hjlmnljga^ZTSQIJGCEB@@;9?JNRV[[M?  >VIBFQZdP%,/5GP6 )PzТЧКe8   ! ! "##'*)'(()))+/0/_≥зы€эюю€€€€€€€€€€€€€€€€€€ээю€€€€€€€€юэ€€€ью€€€€€€€€€ьэю€€€€€€€€€€€€€ю€€€юэю€€€ю€€€€юююю€€€€€€€€€€эцы€€€€€€€€€€€€ю€€€€юю€€€€эю€€€€юю€€€€ьэчъыэ€ъы€€€€€€€ю€€€€€€я±ЮЮЬШФПРГnb^[\[\\]]^^][_Д≠»√АJ<>>BCDHLLMLOQRSQQRUy≤р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юмЂiNIGBBHD=;===<<=<;<<=>==<<963/-2;BGLIKQYy®¬ЃЗy{ytolie`ZVNACOQKGFDDGB,C_fikmnlhf`\YTQNGFGCDA?>:7=HMRW[^O> RWFFMV^aD$)3;KQ1!DzЦШХГe=)')'*057661'     "$&())**))**45/^ѓеы€юю€€€€€€€ю€€ю€€€€€€€€ююэю€€€€€€€ю€€€€€€€ьэ€€€€€ююэю€€€€€€€€€ю€€€ю€€€€€€€€€€€ю€€€€€ю€€€ю€€€€€€€хуэ€ю€€€€€€€€€ю€€€€€€ююэюьэ€€€€€€€€€€ььфшэ€ыщю€€€€€€ю€€€€€€ьЎЂЬЫЪЦРРРДlb_^\]`___`^^]_И≥ √~H<<>BDDHJKOPOQSTSSQZИЈс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фіtVKDCB;:;=@@?<==;=><=@?<:<>>9;;:99;9;;9777968967866465326885630545654343220/-*% #& '-/01./11@>1+)()+)'$"#$$" !# !! !"##&*'%''(,,12....02///..,,*)((0=N^oАСЭ§™Ѓ∞ЃЕMDS[lХ≠ЄТj`][ZYUMI. &Nbcgklllhgb]XUQJEFFDC?=<;9=GNRV[]QB   *RPCHOV]^8 '3>OL&"!   7aВucK<43:=>@BEF@5+"  $&&&)+)++(.285,[µс€€€эю€€€€€€€€€ю€€€€€€€юэюэюэю€€€€€€€ью€€€€ю€€€€€ю€€ьэ€юю€€эю€€ьэ€€€ю€€€ю€€€€€ю€€ю€€€€€€€€€€€€€€€ьоцюю€€€€€€€€€€€€€€€ю€€э€эю€€€€€€€€€€юююю€€ыэ€€€€€€€эьъэю€€€’®ЮЫЪЦФУПВj``_]_babca^^^`Йµ∆√ВH===ADGJHIMOQRTUTRQcУћч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ц√ГZFB@<=@?>@??>=;;=>>=<<9=>:8:9668:58:469664678983245313567643233102335433/-+'" $%  $),011/0.5OK4,)&)*(&#"$$#$$#""!"!###$%#'&&')*+,///...10---+,26=J^rВРЭ§І®ђђ≠±∞≥іЗQIUZkФ™≥Рkb`^^[WPG94-%   '*97-.-**)3;7.,aµню€€€€€€€€€€€€€€€€€€ью€€€€юьъэ€€€ю€€€€€€€€€€ээ€€€ью€€€€€€э€ыь€€€€€€юю€€ю€€€€€€€€€€€€€€€€€€€€€€€ю€€шъю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€ьээю€€€€€€€€€ююъэ€€€ы»†ЪЫЩУПОПВjaa`^]]]^^[[][_И≤ƒЅБF<@=?BGIFHKLPRRSSPQmЯв€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щкђqSFC@B@>>>?>===>><:;;99<:89987899885556899:55974555535765886542355432740-+'! !#! $*.11/02.7WT7+')+*&$%$&&%%%$##"$#!!!#%$%%&'+--,-,.00./-0/7BN`sЙЫІѓ±іЄєЈµ≥≥Ј≥ѓ≤±ЗSISYgР©ђИib`]\ZVOF:NМ≥ЈґєЉљЇїЉЇїЊЊјњњЊЅ¬њњ¬јЅ√√¬ЅјјЅјЊљљЉЉЇЄЈѓІЯФЙ~ulbWLB9997<@CHMOOQPQTUWXTPRQPWH $DQQQRRQRRSRQPJJLLJKKIKLLHGFEDDBDDAABEHIFDLMKPQPSPMTVUWVUXWWWLHRZ|Ѓƒ®Е{{wusnie`ZWMAEROIJGC@ACB?<2-5CU_cehjjlmifc_YTPICC@@>97402=MRVZ][M?#=\N@ITY]Q$',3=K<  !!,=KKC;9:?FNVWRNGB>50-*%    '*9;/0/+('2:3+-b±кью€€€€€€€€€€€€€€€€€ю€€юю€€юшщэю€юэ€€€€€€€€€ю€€ю€€€€€юю€ээ€юю€€€€€€ыь€€ью€€€€€ю€€€€€ю€€€ю€€€€€€ю€€€€€€€€€юю€€€€€€€€€€ю€€ю€€€€€€€€€€ээюы€ътхэ€€€€юэ€эью€€€€€€пєЭШХХФУРОВlba^]\][[[ZZ[Z`И≥…ƒE;=<>CGIHHJLORQPRPVzЃм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хќЙ[HGDA?@A?>=<><<;;;;;:=?;<@;78656764489779523642676655477875233313444/.,'%#"'/300/41:_Y5)()*($&'$##$%%$$" #$ !#%$$%'*,-++-./.--.;JVbqВХ¶∞±іЄі≤≥µЄЄЈЇЈ≤±≠ГSJSYfС≠≠Зic`^]ZXQI=?BAAEFNUX\`dhkkmnhdb^XTRK@?@?;510-1;FOW[]]O= NkVDJRV\J  ',5CJ4 "(,39;99>FMRUTSQHB?=:61-(#    %%(,*,-))(-.-+-_∞еъ€€€€€€€€ю€€€€€€€€€€€€€юээ€эьью€€€€€€€€€€€€€€€ю€€€€€€€€щы€€€€€€ю€€эю€€ю€€€€€€€€€€ю€€€€€€€€ю€€€€€€€€€€€эююю€€€€€€€€€ьыю€€ьэ€€€€€ю€€ьь€ъыэшэ€€€€эьэюююээюю€€€Ё™ЬЫФППСРНАlc`]]]\\[[Z[[[`МЈЋ√~G<=>>BGJLKKORQPOQP`Кґп€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьо§`LDA@@=>>>=;<<;=>===@>9:<>;8666:86757966898776534868866556635415541,-*&"  "(/411044?ia8+*+*+3=5% "$%#"## """!#%$%&'(*+,+,.---,8QZZ\`dlvАЙЦЯ°£™ЃЄљЄЈЄЈі±ИTIUZgУ≠ЂИhba_\[XQI;NОіЄЇєєЉЊЊЉїїљјЅЅЉїЇЇЇЇЇЇЇєљєµЄєЈґµґµіµґіііі≤™£ЩЛ{jZQG;0,(%!#(18>?@CHJJIORONPNPiЦњс€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фЃjQFDB>>?@>;>=<>><;;=<<=>?<9:976766657876588855357868:6455753522630/-&$  !"!%+/422164Cnf>+)+2GbfG)"$"!###! ! !""#$&'())***+,,,/Kc`ZWVTUWYY^gnu~ЛЪ£©≠≤µґ≤ЖRMUXjН•ђМkdb]YZVPIELVXZ[M; &cjNEKRZZ< #+2:KR0  #&+0247;>?FNNIFB@BAA?<:9;;4.*%!    !$+..+*))++)*,,c±кю€эю€€€€ю€€€€€€€€€€€юэююыэ€ю€€€€€€€€€€€€€€€юю€€€€€€€€€€ю€юээ€€€ю€€юююэю€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€эьэ€юэю€€€€€€€€€€€€€€€€€€€€€€€€€юыь€эыэ€€юьщщью€€€€ь€щ †ХШТОООЛЙАl_]\]]^][\\\]]bК≥»¬}C:;<>BEHJHGKPOPQLRu°÷ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЇvUKEA?A@>;==<;;<;;<98;;<<;=<;86885577444586565655366631357531320/.*% #" %)/423232Ckd=*()5XzqH(!"!!"""!    !$&&'((+*)*,*8Zmkgc]YWUTQIHKLMU^gsВОЪҐ°}OKTYkМ°ђОkda\XXWQH@AAA?===<;><;97972/+&!!   !,.+((()(*,-+bікю€€ю€€€€€€€€€€€€ю€юююэьью€€€€€€€€€€€€€€€€€€ю€ю€€€ю€€€€€€€€ьъю€€€€ю€€€ьэ€€€€€€ю€€€€€ю€€ю€€€€€€€€€€€ю€€€€€€€юыэ€€€€€€€ю€€€€€ю€€€€€€юэю€ю€юэьью€юююэюыь€€€юь€пљЬЧФПОПОКЗ}j__^___]Z[Z[^]cНі…њwB;===AFHKIIIMMNOLVБЃк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шЋЗ]MFBAA>;<<:9<>;9:99;;<::;9;977:888556546754665574374056662330/-+*("!&%#'/312121Ahc<+()-CXO8$ !!" "! !!""$$())***++)>`pqmhgd_\YWSKFB=;=@GNT_jp]CEUZoФ©≤Рkc_]ZXXQGGMNOTWM:Y? ;vnMCKT\[0 %+4?MC !#$(-/15;<=<;<=:;<;857510+$## !)'$'*+)(+,+^≤о€€€ю€€€€€€ю€€€€€€€€€ю€€€эью€€€€€€€€€€€€€€€ьь€€ьэ€€€€€€€€€€€ьь€€€€€€€€€€€€€€€ю€€€€€€€€юю€ю€€€юю€€ююю€€€ю€€ыэюэ€€€€€€€€€€€€€юю€€€€€эуч€€€эхшю€€юю€€€€€ю€€€ээд≤ЧССРОПНМК}h`a_^__]\]\\\[dН∞…їtD<<=>BDFJKKIMONOM^МЈо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыкЮ_MFCB?<==<====:;:9:;<=;899:88967516746666557645566413223441....,%! "(*%#).310.24@ed?+**)3A9-#!# #$$##$'(((')+**@`oqolllie`^[VPIA<989;<ESZoЧ™ѓСla][XXYQF;RТЈљЊїљњњјЅњјјЅЅњљљЊЊЇґЄЄґЈЈµ±∞ѓђђђ™І¶І¶•¶•Ґ†ЮЪШН~xvrpppmfa_SH>86,!-BNRVXVTUUQRSNNQQRQQTUUWXY]]ZVRQOQLHKJDDDFFDGGFEBDHHFIHGJKJMPSTSSUXYXY[\ZZYYNKRY|≠ј©Жxxupopne]YUL?=>=;41/,+-  &)+178?CEEE@9626674462038=DGHNWYL9J0 DyjIFPSZT* !),3AQB !  "(*-0039<=>=>:898:977::89:8;:987652-(&!  #""   $##(,)(*,,)\±ню€€юю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€юю€щъю€€€ю€€€ьэю€€€€€€€ююэюю€€€€€€€€€€€€ьэ€€€€€ью€€юю€€€€€€ючъ€€€€€€€ээ€€€€€€€юээю€€юшъ€€€ьшь€€€€юю€€€€ью€€€€ЁЂЦУФТПННМЙ~ja]]]]]\]]\\\[eМЃ»ЇrB:;=AEDEINOMQROPPfЧ∆у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фђiNCBB>===;9:;9:@@=;:9:9::;77851167545655434544313432212420--.-*# #-/(  #)/322144?`b?,+)(-83(    #%##''&''&)+()?_mnmmnllkfdb`ZTMD?><;<99879DRYtЫЃґУja_[XY[UH:QФєїЉЊњ√ƒ√√њЊјЅ√√јњњЊЇЄґЈЈµґµі≥≤ѓЃѓЃ≠≠Ђ©І•¶¶§£ЯЫЗj]]\]^_]Z[\ZZUSTH<8>DCDHJMMNLOQOOTZZ]`ZYXVWZZ[Z[aec_YRMPNIJKIIJJFDFGIGEIJJIHIHKKHKNSRQRUWYYZZYY[][OJR[}™ї•Дz|wqnood\WVN@<==<741./0( +,+,,,--./,)(())(',0/./5?>=<<::=::9899:946:977755575576323553015665236320.-*$! (..(#! #(/330232>^`@,**)'($!"!#"$''&'&()))*?]kmmlkkljgffb\YWNHFC?=<<>;9CSXrЭ∞ґЧl`_\XY^YI8MИђµїњЅ√≈ƒЊњ¬Ѕ√≈≈ЅЊј¬ЉЇЇєєЄЈµі≤≥±≠ђЃ≠ЃЃ≠™©®І¶£ҐЮАWFEFEDDDDHGHLMLPOGEPVNFEFHKKKNJGKRTSY[UWZWX`fea^_ekjcXNKKKHHGHHIGFFGGHIHHKGFIKMMKLORUXXWWZZWXYZZ[XMEPZ~ѓЅ¶Вx{wplljc]ZULA>A?;740/11/  #=FCA;40,)'" #&)..29A@EQYXI9 `zV?ISW_K "*0:IQ7!""#"! $'),///245675589899835720258853799777475/,,)' %)44 "!'&()()+,++0cѓию€€€€€эю€€€€€€€€юэ€€€ю€€€€€€€€ю€€€€€€€€€юю€€€ью€эюю€€ю€€ээ€ю€€€€ю€€€€юьэ€ю€€€€€эю€€€€€ююээ€€€€€€€ю€€€€€ю€€€юьюъь€€€€юю€€€€€€€€юъъэ€€€€€€€€€ыыю€€юыэюэюэю€щ∆ЯЩФПППНККИzd\]___^]^[\^^XfС±¬≥nA<<<>ADHFFHKOOLLTy™№ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъїmPD@???=;;;=>><<=:99:98968;9;95447965643334663453443441/,--'$!!).+$!!'.220120:[_A.)(($  "$$!!$$$&&&&('&'(=\jklkiklifdfa\[YTNKHDDB@B;7DTZmШѓµЦk_`]YY_]J9JqТ®≥µЄєј¬јњј¬≈≈∆√јЅ¬ЊљЉЇЇєєЄґµµ≥і≤∞ЃЃ≠ђЂЃђ™™•ҐЭ{O;:9433112215779=<>BBCEB>BHJNSJHMMHGLOMNQQQW__^\`gmol\POMIGFEGIFDGIHGIFFIHDGLKMOOLMQTVWWX[YWWWZ\\ZLENYВ±Ѕ®Дz{vplljc_[TG>=BA=952/251"  %CTWWSOJC:3-%%--.5@BJU\XH8 -kxRAITZ]D$(2>LK-!! " !&('*.--/1046520043346645465222333689:9899983.,(%"&9dС©t& !!%&(***+))++XЂзю€ю€€€юю€€€€€€юю€€€€€юю€€€€€€€эю€€€€€€€€ю€€эю€ю€€юю€€ьэ€€€ю€€€€€ю€€€ю€€€€€€€юю€ээ€€€€€€€щы€€€€€€юю€€ю€€ю€€ю€€€ыэ€€€ю€€€€€€€€€€€ээюьэ€€€€€€€ьъэ€ю€€юэ€€€€€пЇЪЩХТРРПЛИИ{g^^___]]_]\]^\gРґЋµmB==<=AEGIIKMNPML\Й≥дэ€€€€€€€ыь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щЊqQFDCB@=??=<>?><:99:9;<87;;97468864665536834432113132/.,--'# #)-)" &.2000207W\@.'&&%!  !!!  """$&%%$##%&9Yjggjfgkifdba_\YUQPJGHGIG<9EV\kФ±ЈТja`][Y_iU;A`zМСТЪ£≠≤µЇњјјјјƒ¬јњЅЅЊЊЊїЇїєєЄµµґіі±ѓ∞∞ѓЂЂ≠©¶Я}R<:62450./0,,++-.--,.38759=>CHHKKGHLLKIJKLJLPQPSX_fqteVQNKKJIKIEFFGHIIFFGHJKKKJLMMPRRTVUVYYXXZ\\[YMGMZБЃљ¶Дvyvpkkid]ZUI>>AA?:630241"  #EUXZYZZWRMF<1)$#"#*7@JU_ZH6 8nlMDJT[];#*5?MI( ! !" "$&()**(*/..//120111220232453221132223677:999::850.*&"!+@kЦіЎъ€∞1  $%%()),-+,-(U≠о€€ю€€€€€€€€€€€€€€€€€€ю€юю€€€€€€€€€€€€€€€ьюющшэьь€€€€ю€юю€юю€€€€€€юююю€€€€€€юыэ€€€€€€€ээ€эюъы€€€€юю€юююю€€ээ€€ю€ююээ€ю€юю€юю€€€€€€€юю€€€€€€€€эю€юэюю€€€€€€ёЂШХХХСРОММЙ}h_^^]^]^]][[[\fРµЋЈl>;;;=BDEJKLONLJLfЩЌш€€€€€€€€ыь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъƒxVIFBB???<=?A?;99:;9:99767768:537:65832765531220131--.-,+&$"$+,&!"'-1.//016U_B+%&&'%" !"!"$   "##%%$#$%%9Yhhggefedec``\XVROOMIJKIC:9HUZlЦ≤ґТmda^[U]rb?4F[ceberБЙС†ЃіґЇЉЊјјЅњЊЊњЊЊљїїєЈі∞≤≥±ѓ∞Ѓђђђ≠ђ™™ҐБXB;9756413630-+,+)(&&(-/133357;A@AHNJHMPONMLNNPRSRaВ~bRLLKLKHHIGEDEIMHHHHIJJJLMLNRSRTUTTTVYYXZ\]]YIEP[ЃЊІЗ|{urliea\XSJ?>@@=8420173# "DTWWXZZYZYVPJB81-&&2AAFJKJMNKJOp£ж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ ЗaNGE@=??<=@A=9;;<;89:8797335645867855787411442110.--*))(%! %.-% #%+100.145RbF+%&('&# ""!$!  !#"#"!#$#$7Yjkigggdbba_\ZXUQNKKHHHFB:9HW\kФµЇСjda\ZXXc_D:P__[SRUZ_dp}ЛСЬ¶≠≥єґ≠іњјљљљєЄєЄЈµ≥µ±ђђЂ™≠≠™©©®ЯАZD=<8874468632230/---+.33445289HPQOPRUSRTU]oЕ|\MGFJJGEFGEEEGHKJLLIHGKLKKLMOSRTVUVUUXZYZ\]^ZKHR\~ЃЊҐВ|{vrmje`\ZSI@=A>:7332493" ATWXZ\][YZXTSOIC>:530(#" #'/ALC7 /SM@@KV]T* "&,5AOE! #!!""#$"#'))*,,,..--,-,+,,-,*+/-,-/-/20/.-./063125429@=9::999:60-,,,1HsШЇе€€€€€€€€–P  $!$(*)*-,*),.,)SІгцыю€€юэ€€€юю€€€€€€€€€€ююэью€€€€€€€€€€€€€€€€€€€юю€€хфю€э€€ю€€€€€юю€€юю€€€€юю€€€€€€€€€€€€€€€€€ээю€€€€€€€€€€€€€ьыю€€€ю€€€€€€€€€€ыыю€€€€€эю€€€юю€€юю€€юю€€€€ц√ЫШЧФСОННМКК{h`^\^^][[[\\\YfХє≈ѓk@:;:=?BHIJMNNLKU{ђж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыбЭiSHAA@@>>@DC@=<::86677777456436897445534203311100.,+*%&% )1.%#&+00/-043NdJ-%'''%$"""!!! "  ! !!!""5Ylkhghhecb`[ZZXTMLKFDCCBA::IW\nЧіЄРhba]ZXTTULJXfkeYVZ[^^\]`agr~ЙФФМЭіЇљїєєєЄґґґ±ііЃђ≠™ЃЃ©®І§Ь~]GA=:<87998754687336843776783:JH<98587>AIRTQNUgkf`TKEFEGGEHGEEGEDGIKIDEHMMJHNSRSUWVWVUVXZ[\\[]YIFQ[А∞Љ°Бwyvrplha\XRMB<><:7220483 ?SWZ[]_[XWVSQPNLEBCBA>964/)(+5CK? '<><=JU\P#$+06AO=$#$"&+*)+./././../,,..,+,,*(*--*,//-.///1/-.26214544:@;9<<::<>848C`БЫ¬м€€€€€€€€€€€иj  %$(+,*+.-+*,-+*NҐеэ€€€€€€€€€€€€€€€€€€€ю€эьью€€€€€€€€€€€€€€€юю€€€€эьыью€юыэ€ьюээ€€юэю€€€€€€€€€ююю€юю€€€€€€€€€€€ээьэ€€€€€€€ьыю€€€эъэю€эьэ€€€ю€юэ€ээюю€€€€€€€€€ьэ€юю€€€€€€€€€йµЩХЦСОРРНМЙЕzh`^[\]][[\[]\YhШЉ…∞g<:<=<>>>>>>;89943897766665456634544331121/.--.-,,(%" !,2-& #)+.10./33NeL.''%&&$! !! " ! !"" !!""4Vgjjihgc`_\[[YWWPKECA>AC@;:FU\rЫґЈОgba]ZWUNJOPUeneZ]a_efa_^\ZXY_eioАРЬ§™Ѓѓ≤µ≤±∞ѓЃ∞ѓ®¶ІЂђ®І•°Ц{^JEB=;:;;;978988988:>:79:88954:@><=;;9654127>CCENWYSHLH=>CGCBHHEECCDFHCCFIIMNLKLPSUX\[[YY[[[]^___[IDP[}ѓљ†Вyzwtplib[VOH?<<><7330152! AUWYZ[]]ZXWTRQMJFEGFFFEDB@>?AGQVC  %-5;?LW^J #*29FP9!'))*-1113422101//...,,*((+*&(*,,-.-,-.-.--./.-0447768;:9<<<;@JYrНђ“х€€€€€€€€€€€€€€х} $  #&),-+,,-++,+*)KЮдю€€юю€€€€€€€€€€€€юю€€€ю€€ю€€€€€€€€€€€€€€€€€€€€эээъэ€ю€юю€€ююю€€€ьэ€€€€юю€€ээ€€€ьь€€€€€€€€юю€€€ээ€€юю€€€ьъ€€€€€ыьююэюьэ€юю€ээ€ю€юэ€€ююью€€€ъьюьэюэююэю€ющўЂШЩЩХСТСНКЖГve]]\]\[\][Y\\ZgУґ«±g=9:>=AEIHGMOOOL`СЉн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ√|XD@A>==>>;:::899658;73456641136742111321.-..,,..,+($!$.3-% "',21.-11/LdL-'&%%&# " '7?1"!! ! !!4Tdhjjhe_^_^\YXUTVOFEB>AC@:9FU\qЬґ≥Нid`\ZXTMEDHUcjkhhd^emkjkie`[Z[[\_cfp~ИОЧ°І™™ђђЂЂ£Э£©¶•¶£ЮХ|_NE?;<<>>=;9<>;89=:;?;;><;:978559:?A@<778212246:>?DC>FD525:=@CBAEEBCEGFBDIIJKKNOQTVZ]\\^dfb`ceedd_MJSYzЃј£Бy{yuokha\XRH=;5440162! @UVYZ[\]][XSSOIHFEGGDFGGEFILNTZXB  +6;@O\^D#(/9FM5*12/02447:630///.---+))(''(()+,++,,--/0-,-/1/.03566776:=<=AFTvЪјеэ€€€€€€€€€€€€€€€€€ыЖ & !%*..,---.-,,++HЪяъ€€юыэ€€€€€€€€€€€€ююю€эъьээ€€€€€€€€€€€€юю€€€эю€€юю€€€эью€€€эюю€€€€ээю€ю€€ююююю€юэ€€€€ююээ€€€€€€€€€€€€€€€ю€€€€€юю€ю€€ююю€€€€€€юю€€€€€€эю€€€ээыщьюэююю€юэщ—£ЧЧФТПРПМИГГxe\\]][Z[^]]^\ZjЦЈƒѓf=77@B>99:;;99768773366644236643565332--///---,)%# !)350&%,52--12/JfN.&%$"$$!(Fic;   1Pcefhie`_`_[YVUWUOHFD>@A=3>>>=>>==<:9>?>?==><=<;;<:778;>@=:;:42547524468::72.//1446;<=>@BBEHFEGFFLU\\ZZZZ\^`dggimponohPJSYzѓЅ§Бy{urnifa\XSF;;??;4354341>QWZ\]\\\\YUPKFGGFJIEEEFGHJORUZYD  ",6HN2/99668:87742.,,*)+*))*(('&((**+*+,+,///-,...00137879:78@H^{С±б€€€€€€€€€€€€€€€€€€€€€€У & %-3/++,0/,,,-+IЫџх€€€ю€€€€€€€€юэ€€юю€€эю€юю€€€€€€€€€€€€€юю€€€€€€€€€€€€юююю€€€ьь€€€€юю€€€эю€€€ьэ€€€€€€€€€эю€€€€€€€€юэ€€€ю€€€ю€€€€€€€€€€ю€€юю€€€€€€€€€€ю€€€€€€€€ээ€юю€€юю€ъ ЭШХРРСРМЙИГБyg]\]][ZZ]^]]\[jЧї ±g:89=?@DEJJIMMKPt¶б€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эаЪbHB@@B>;;9887765775653277436851377301000-,//.,(&$"!")7:0$ #(010013/LmT/%%"!"# 'FaV2  0Nbghecba_`a]XTUVRNFBC@A@;5:JW\lХє±Дgfd]ZXTND;Garj~°Йicbeintqqx{zywoefe^\[XY_`airyВЖРШШЬ†ЫЫЬЫУ|bUPHCA?>==@@<=>=<>?><>><:==??=977789AGFEGGDIU^^[XVX^a^`edeiouvxoTKSZ{ѓ√£Б{{tonhd_ZVRJ<9?=97421142?PUX[]]\[[YUQMIIIJMJGFFFGJLPSVZYB  %089BOXW7 %+5?OM*"4;<855:853.--)(*+*)(()(&$%'(''(,++--..-..////145:;::AOc{Ујй€€€€€€€€€€€€€€€€€€€€€€€€€§%!"#-52-,-/.++,,)JЯёш€€€€€€€€€€€юю€€€€€€юэюю€€€€€€€€€€€€€€€€€€юю€юю€€€эьэ€€ьь€€€юю€€€€€€€ююью€€€ээю€€€€€€€€€€€€€€€ю€€эъю€юю€€юььэ€ю€€€€юю€€€€юю€€€€€€€юю€€€€€€€€€€€ю€юэ€€€€сљЬЩЧУУСНМКЙЖБwe]]]\[\\\\][[ZfТЉЌ≠e=<<>?ADGIKJKKJVБ∞ж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юф≤kNDAB>:;;;87:63776722698346643565220.11-*-/.*$#$# *:<0% $&+--1103/MpW/"#"## "0<8(  /Laeheaba^]^^ZVUTPKEDDDAA@97EV\iСµ∞Гffc]ZXUL@>>==;<>??==>==?<888548=?@@;9996796688<;5////-,-+(())).1256:;@A=FNQRPQRSWYY_ebbdinqvnUJPYxЂ√•Б{|snnlib\VQI?=?=840/.131@QSVZ[[[ZXWSSOLLJLJGGGHIIHJOSVYZE!  #-6<<=>@FIIIJLKK^О¬о€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ≈wTGB=<=<<97865636:98::9666764453232///-,.-+("!!""#.<=4(" #&-0/0113.Jp\1####")73&  *H^adecba^`a]YWVTMGDGHA@AA86FU\lСµ∞Бed_[XUTJ>?BFOSYcgb^_^[\\ZXXY[^`djpuy}~xtuofa`^[XXZ\_emu|}|vj^SMHCB@>@B@>>===@>=@@>=>><<><8::779;>@A<;;889:889;=;71/0/....*)*)*,,+*-/037><950/0/0/?BGHFEHKIKgЩ÷э€щит€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь—Б\HA?=<=;:96578875557:8578425544101///---,)%%$! %1=;2*$ %+/00//3/Gn\3%&$" #-*">>?EDABB?==>?AB@<=<;:8:=@B?<<;::;;:==:884451/.//.-+*+-,+**,,-18=?BHNRSTTTUSV\^_^dgfdRIQ\}≠ј§Д|zurmihb[VRM?;=<:830//00" 9NVYZZZZXYUQPLGHJIIFCGJIHJLOSUYXD$  '1:BNY[B"%/=GSF,33000-,,--*))&)*'((%)+'&''()').-+,.00./0347AVpЕѓе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Џ\ "!)-75//.....,,+HЩёы€э€ю€€€€€€€€€€€€€€€ю€€€€€€€ээ€€€€€€€€€€ьью€€юю€€€ю€€€эю€€€эщь€€€€эыю€€юьэююыь€€€ээ€€€€€€€€юю€€эъьюэъэьъю€ю€€€€ььююыьюю€ью€€€€€ээ€юэ€э€€€юьэююэыъью€€€ыѕЮЧЮЬУМРРОКИИДwh_\[[\[[ZZ\]][mЦµ»≤l@:;>ABDEFGGJJOo•ёэ€у‘з€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЎРfKCA=;;;;846:876789778763232331././0.-.-'$%$"$2<9/'! &+//../20CeU0%&%" *:DLRWY[\\^\XUTVTOMGEDAA?56FSXiТ≥©~deb\YWPH@74DSV\eea\ZZYWWUUSTVVVUXXWY[[`gpy~А~|zvnhfd_]^\]\[ZWVWWRLKKFCEA@CCDECBABA?AAAA@>?>=<8:?AB?=><:;:;<=;;:74441////..-,,--+,--,..047=BFIKMMOWdf\Y\\``^\LENZ|ђ√ІБvvrroiidZUSL@<<>@ADFHJHIJTz∞вь€ыущ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юй™pOFB><:;87;;89:8557665311221000..//--/+&##"!!'6=5,%!(,/0../1.EfU.#%&#  $).7;AHNWWRQRRNKJGDCAB?69HT\nФ≤І}ec_\ZWSLC75ERTbkie_XWUUWUTRRTVVUVVVVXYXXZ^`birvz~{zvpmjfa\YZYVXYWUSQMJKGCEDACEDA@@?CFA@?=>??<9=AD@>><<<<;84342011/...-,,./.-,,.-..1569;=>AJXfe\\\[[]`YGALZ{ђƒ®Аtusomjfa[VRI?>B>:754214=2>SWYYYYWWXUSRNIIHEHHFEFDCJKKQUVWC$   )4>DOZW6 %+4?LQ6&./.,,+,-+))+,+)))'&&()))'((')+././/.18D\|Ю–щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шЙ   %4A>1///.,,-+CСЎч€ю€эю€€€€€юю€€€€€€€юэю€€€€€юэ€€€€€€€€ьыююэюьы€€€ьь€юэ€€юьэ€юю€ю€€юю€€€€€ю€€€€€€€ююю€€€€€€юю€€€€€€ьхц€ющы€€€€€эь€€€эъыь€€эью€€€€€€юю€€€€юэю€€юю€€ю€€€€мґЩЪЧЮЮТООООЙВБtb]\Z[[[ZZ[\\[ZqЪѓЅ≠e;;==>BDEHKLHF[Кґй€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыќyTEA=:<;8::9:9:88:9855335421/..-..--,)'%$# !+9=5*"$)+.//.02/GiV/"##" #*26:>AB?AEGC>?@=56EU^mТ±І~fc_\YUQLA65DPRY`eje\UTVVVSQSSTUTSSTTVXWVUVVVX[^aglqvxzzzvoicdc\YYYZYWVRONJGFFJJIG?>@DGD@>=?AB@>AGGDB==FPOJD<:<<=93553320././..,-..-+,-..-11.0468=BBHRWWWZ\]]YKEMWy≠ƒ•Аvyvolje`\VPG=>B=7444546A;@SVZZZXXWVTRQOJFEGIHECCCCEGKPUXWC%   %+7>@KYS/%,8>KQ3!,,,--,***((+,)%'(()%')(*)()+*,/014;Lf|Э‘ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Э#5A;0/0/.---*@Пўх€€€юю€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€юыь€юю€€€ьь€€€€€€€€ьъэ€€€€юю€€€€€€ээ€€€юьыэ€€ээ€€эь€€€€ю€€щуцъюю€€€€€юью€€юыь€€ююэ€€€юю€€€ююээющъэыээь€€ю€юэ€№®ЩЪЩЪШФСНККЖВБwe]\]]\\\ZY\]\ZnЧ±¬§^<;==?BFHIKMHHdЧƒо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю÷ЕZC?>=<9;<<;:8785599875422011000...,'%&%" #.9;3)##'*-///24/Dh[1"!    !%(*057:::;716FT]pЧ≤ІАhc]\YVQG?85@KOU[`d`^YUVWVSRTQOSSQQPQUUUVUTVVUUWXXY[^bflrvvwurqlea_`a]ZWVUQPMMRROKGEEDDFEA=@A@ABDGHHC=?DHHE@>?<<=96:868732/-/.,++--,,,,+,.12--34249;LN--.-,,..))***((%&((*('+--)(,...3?SgБґк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€•$ "7=4/00...,-';Й№э€€€€€€€€€€€юэю€€€€€юю€ю€юэ€€€€€€€€€€€юэ€€€€юю€€€€ьы€€юю€ю€эю€ю€€€€€ююю€ю€юээ€€€эуч€€эью€€€ю€€€€ююююыххъю€юю€€€эээю€юьь€€€€€€€€€€€юю€ьъэььэьэью€€€€ю€ъЌ°ШЪЩЧУУУНЗДДДГwd]\\[[\ZZ]]]\[mЪЉ«†Y=<<>ADHKMLHFKkЭ‘ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЁУeJB?==<:::86788635898420/11///..-,)&$$""%.::2*! $*-./.25.@h]0      !'-11-5FSZmШі§{ca]\[WSI@70:IRX\]][ZXUUTTUTQNOTTSSQPQUTSSSVTTTUUVWWXYZZ]`dmuusqpmkjjgda]ZYYVUYYWRRRNJFIJD@ACA?@CFEECABA@A??DD@><:;;76875320//...,,**+--,.1/-,.2358:9;>BEFHNXWHFOZ}Ѓј£y|xrlf_]ZVPH>;>>;532/243:65OTX[[\]YXXURPLGGHEDB@ACEEEIPTUYYG*  !")07BGQYF!"&+/;ELF'",.0-,-,)'''((''')*)()+-.--/4@SjХ…с€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ђ+  !395121/.-+,'<ЛЏщ€юэ€€€€юю€€эю€€€€€€€€€юэ€€€€€€€€€€€€€юю€€€€юю€€€эь€€€€ээююыъюэююю€эь€€эь€€€€€€€юцч€€юэ€€€юэю€€€€€юю€€ъфш€€€€юыыюээ€€юэью€€€ю€€€€€эь€€юю€€€эю€€€€€€ю€ъќ£°†ШЧШУРЛЙЛЕГqa\^]ZZZY[]]][YjШњ…ЯW<<<@@CGIF@FQ\ѓњ†|y{uqle`^\WNF=;=<;9654588;<. ,FRUX[\[\\ZXTRQMIHDBDDCDDDFEHPSUYYF(     !"$)19AJUX?"(.4=IPA$,--+),,*)%')('')+-*(+.,-3>VqЩ–ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ј4    2:7232/--,,*?Ряы€€ю€€€€эю€€€€€€эю€€юю€€€€€€€€€€€€€€€€€€€€€€ээ€€€юыэ€€€€ээ€ю€€юэю€ю€ю€€ю€€€€€€€€€€€€€€€€€юэью€юю€ю€юю€€ъъююю€€ьь€юю€ююююэ€€€юэь€€€юю€€€€€€€ээюю€€ю€ьщщЌ†ЮЫХХЧХОККЛИД~qb]\]]XYZ[\[\[XlЫњ ҐV;=<<=BFGJKEEWД≤ж€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЋzRA>>;<<:97678886785331/.+*,,,.+'"#"'4=9.& !&(-/./262?eb6    #       1FUZnШ∞ІБb_^[VTOF>64BSXVXXURRSSTTRSRQPQRPOPRSSRRRTTSTUTTUTSTWXWWWVV[`]Z[[\^_bfjjhjjhgeebaa^\ZYXSPPSRSTUSTURKEADFEB@CD@@A=>;<=87;;85661145.,,++*+,*+-++./03369:;>CBDGFD>EQ\}ѓЅ†zuwtojgd]XTPF=: /=:/12/-.,,*?МЏш€эю€€€€€€€€€юэюю€€€€юю€€€€€€€€€€€€€€юь€€€€€эыю€€€юююьь€ю€юю€€эььюэъь€юэ€€€€€€€€€€€€юю€ю€ээ€€€юююю€€€€€€€эъэ€€э€€€€€юьь€€€€ььыъ€€€€€€€€€€€эшы€ююю€€€ыЁ©ШЬЪЧХЦЦСМЙИЙЕqb]\]\[ZZXYZ[ZYn†¬ †V;<;:=@DDEHDE^Рїз€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ол€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”Д]H@>==;:97766799322111/-./.-.*%""! !'4;5+&$(,../35/:ee8       ,M?  1ESXmЦ™£Аcb`\VSNE=30BPTVWUSTTSTSTQQSQQQRQOOPRTTTRRTTUTRSUUSSVVWUSUVYYWVVXYXYZ\\\_dfhjkihjigdb_][XWWXWUVXYZXTOLLKIFCEDAACA@>>?>=::;8974544.-.,**++)*+**--031278:==?ACFD=BPYxЂј£{txunige_YSMF<<;93+..-3635;@@COWTSW[[[Z\\\\[WTOLMIDDGFDA@DCGOSUW]]G' '*&$#! #+5=BIWX:"',3>LP9'-('*))*+,+*)***+*1?GRjЦ—ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷R +;;10000,+-*CСЁь€ю€€€€€€€€€эыю€эю€€€€€€юю€€юю€€€€€€€ъщю€€€€€юю€€эю€€ьыьыю€€€юыы€€щчю€эюьь€€€€€€€€€€€юю€€€€€€€€€юю€€€юээ€юьюююю€ю€€€ююю€€€€ээээ€€€ээ€€€€€эъьэьэ€ю€€щиЌ™ЫЭЪЧЦЧУПМЗЗЕБ}qb]^][[\[XY[\ZZsҐЅ√ШS9;<<>ADEGGFIdШ≈м€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аЧlH@=<<=:7955785123/.1/-//---+'# ")4;4,$#),,-.03.8ac7     LnF    4FSYoЧЂ°}ca][WUPF<2.>GKORTSSTUUTRRRRQOOPPPQRPPSUUTRRRQQRSRSSUTTSTUTVVUTUWWVXYXWUXZZ\`aacghjkjgda_^\\\YZZWXXWUTTSROLKHGDDFCBBDEA?@<;98:74750.-.-+++++**,,,/5558998=ADE@:ANX}∞Ѕ°zsvrlhfd_YSKD<=:-,,.-.1005>EDHSYVXY[^_``^]\ZWTRPMHECFGABFEEHOTV[a]E) $$&*,11-,)$ &1;>CMWV9$).6DPP4(,*+,+,,,--.-+*,5E`Дґвы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еk +:>611/0.++(BТа€€ю€€€€€€юю€юэ€€€ююю€€€эыэ€юыь€€€€€эъь€€€€€€€€€€€€€€€€€ээ€€юю€юю€€€€€€€ьъью€юю€€ююю€€€€€ю€€€€€ю€€юю€€эыэ€€€€ю€юэюююээь€юю€€юю€€ю€€ээ€€€€€ээюэ€юью€€шд≈•ЧЦШЧФХУЙИИИЖБ}q`[]][XZ[ZZ[ZYYiЧЉ¬ЧT<;<<=ADFGEEMn°‘ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мђnG?@==<97568521211.02.-..,,+'#"-56.)$ #)++.-/3/8_`4"+(   =K1   4IUZpЪ∞ІБe`]\ZVPF>3/7822<:=;:;95/-/.,+++*))+,),2208=8@LGA?=9CQZ≤њЬzuromjfc_ZTNE<81*)+),./03AKHGJOSTTW[\beaab\XXVVTLHHGGEDHKIIMRUY]e_F0&(+-/23971/+$ $27;CKVR2 "*.4CSP-+,*./--.-.0323G]Бїп€€€€€€€€€€€€€€€€€€юыщхтсмвалптчы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уЕ (8@9430/-,-)AТ„ф€эюю€€эъъю€€€юю€юю€€юю€ю€€€€ьыъъ€€€€юю€€€€€€€€€€€€€€€€юю€юьэю€юю€€€€€€€€эыэю€€€юю€€юю€€эщъ€€юю€€€юю€€ю€€€€ю€€ььюыъюэь€€ьыю€ююээюю€€€ыю€€эюэъэюю€€ю€кїЭЧШУССТПЙЕЖЗДБ{qb[\]\YYZ[ZXYZXiШїƒЭX=:9;=@DIHECNz≠а€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эшъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чЉtNA;:<83488311013100-,-.++*'$! $.43/*($"%)-.../409__3".CT>    -3#  4HU[qЩЃ®Дfb][ZVQI?75-!1CHGKOSUROQROPOKMNMPSSQPORSRRSSSROPTUTTTTTTSTSTUUTSTTSTTSTWYXVWZ[Z]]\`ca`cffcdc`^aa][\ZYXXYVSROLJJJCDFDBAAA??=<=;7411/-.+)('')*)*..-485F`R::9;GR[~≤јЭzsponjha[XTOG:.()'$$*-+-6LQCCIKOPRY[Y_dbbc][\[XTNKHHKHHJKLMPV[^ckcJ4-/23679<91-'   $/7@EKWP("$.17FTN) ,-++/0--/6AQcТ÷ую€€€€€€€€€€€€€€€ьщцрг÷≈ґІЬЯМouЛФ†ѓєѕвфю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЪ !6A<423/.-,)CУџщ€эээю€€эю€€€€€€€€€ю€€€€юь€ьыю€ъим€€€€€€€€€€€€€€€€€€€€€юююю€эьэъь€€€юю€€€ю€ээ€юю€€€€€€€€€чч€€€€€ээ€ю€€€юю€ю€€ююю€ыь€€€€€юэ€€€€€€юю€€юсъ€€€ююююю€€€€€ж≥ШЭЬУХХХСМИЕЕДypb]]\ZY[\ZYY[\Yn†њ√ЫV;;<<97"   ',1:CIIJLNQPPNLMNQSQRQONQSSTTSSRRSSQRTSQQTTQPRTTSSPOPRSRTVSQUWWWYYYZ[[]]_`acc`bfeaabb_]]][XWUTSPNLJGDGGCDEA???@=8510//,*+*)*'(),--.027==8678CP\В≥јЭxrqqojhc^YTOH=/'%%!"'+('-7:6:AEJPX]]]^^_a`][[ZZ^_YMFJLLJNQQV\ehilbL8466567983.*& '1:?GPWI#!'-1:FTK"#,,,,/46>Tzѓёфю€€€€€€€€€€€€€юъцогќЇ≠Рqlf`dhhjjieca\[^x™≈ўдрххю€€€€€€€€€€€€€€€€€€€€€€€€€€ыЫ   "4CA720..,+(EЧаыьъ€ыъ€€€€ю€€€€€€€юю€ю€€€ююьэ€ю€ьхшэ€€€€€€€€€€€€€€€€€€€ьь€эью€ююю€€€ю€€ээ€€€€€эьюю€€юю€€юэ€€€€€€ээ€€€ююэюю€юъь€€юь€€€€€ю€€€€ю€эьэ€€€€юьь€€ю€юэ€€€юю€з≥ЦЪЫЧЩХХУМЗЕБ}{wma^^]ZX\][ZYYYZnЭњ¬ШS:<=<<>CEECG_РЄг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бО_B=<99868641133/.//.,,+)%$" #)/1.(%##)..///4170 (/6>DIJJKNKMPRTSTTPPQQRRRSUSSSQRTUSPSSSQSUUUSRQPPOOQRRRTQSVVUUUWYYWWY\^^^acbdggedb``_^\Z[YVTTURPPPLNHBBCA>=:7586/,..)(()()*,----0346888?L^КµЉЮzpoppkfa\ZVOD8.'$$!#%#"#).,/69AQ[Y[a]\]__][[ZasДЕfHJNMORX\`ejjif_N;68731222/)&"  ")29@IQWF #,02::5132-+*))'&(*++,...15544=L`Е±їЭyonnmkgc^ZTMB7.'$$# "#$&&)**,.18EQTW[YZZ\_a___nХ≠¶{RQSTY^dhgihbaa\N:02200.-,*%"  #,37?JRXA(*15=LZJ!)+395Sіью€€€€€€€€€€€€€€€ьоƒРppqqstrpqokieddgkmmommmljnojff`URWbrИ≠…Ёнрэ€€€€€€€€€€€€€€€€€€Ѓ%  1CJD7//-+-*FФ„ъюю€€€€€€€€€€€€юю€€€€€€€ээ€юэ€€ээ€юью€€€€€€€€€€€€€€€€€€€юэ€€€€ьь€эьээюэююььююю€юээюэ€€€€€ъуцьюъэ€€юю€€€ю€юэю€€€€€€€€€€€€ю€эыююээюю€ю€€€€юээь€€эь€ю€юЎЯТШЧФЩШСНИИИГ|{wi]Z[[[YYZ[]\ZZXkЮЅ√ФO:::=>ADGEAKn†’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цєuL@=<65644000/.-/.+*+*&#!$,0.*'#!"'-./03728cg6 -4'    2ERXsЬ©£Еc^][XUOLIA- (/4:ADGNQPONOQOOLMPRPSUSRRRRTVTTSQQSSSRPRRONSSOQPNRUSVUTTVVWWVVWXW[____`cdeffecaba^]]]\]]]XUSQNNLFE@==65:@;.+*((%&))+-,)).1104?MZ}∞ЉЬzqnmnnhc_YTNC5.)&%""%$#(*))+.028>IRTX\YXZ`b^^iМ∞ЂМjWWX]ehhda`_]\^\K6..-,,++(''#  $-69?KUV9%*/9AMW<*+,,(fЁ€€€€€€€€€€€€€€€эхќТotttuutrnljfehiklpssqqrokgglnliiihhge`WYfГЭ°Ї’п€€€€€€€€€€€€€€€€Є*  ,@HG<.,-,-,HШЁэ€€€€€€€€€€€€€€€€€€€€€€ыщыъы€€€€ю€эъьыщю€€€€€€€€€€€€€€€€юьюю€€юю€€юьь€€ьь€€юэ€€€€€ычыъэю€€юччщшэ€€€€ю€€€€юэьэю€€€€€€€€€€€€€ю€€€€юэююю€€€€€юю€€€ю€€€щ ЪХЩЦЦТТРКИЖГ}}xk][]\[YZYZ]\ZZYmЯјјРM9:<>>ADCBBOw®№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш∆ЖT>;9764343/.00..--,*&#" %,1.(%! !"'--/13828ag8$  4FSZsЬђ£Дc^]YUTOIA=-  $,2<@DIOQOLJLPPQPOPRRRTTTSRRQSTSRQQPOOPPQPPPQPRSQSTSRUXVVWWXWWYZ[]\[^`ceddcdeebacb``ab`]YXXVSPNKHH@;9981,+)'&%'&()*,))+,-4@LY|±њЫvqpmmkg`]YRLF9.'%%"#%%$'))-,/46;>HONV]\YZ_bcb|І£|eREAEOZ\\[XVWYZ\ZI3-,)(*+)'$#   '.5:>JUU5%*/7BRV4 fЁ€€€€€€€€€€€€€юш“ЫwsvuttrqoifedhptsvwssrpnmjedgjjjihgjkghgdbceeefzЮЈћџяищ€€€€€€€€€€…:   (9720-*'&&'&'(()))()/>MZzЂЇЪvqnlmiec^WQMF8,'&##$&$%'*+++,049CNWS0(*0:GUP) hв€€€€€€€€€€€юу÷±Гqttqppnkgedhmpuyxvvvqlkhecceiiffgijgeifeijhdegfdcccj~ВК†Њ№щ€€€€€€€ё\ *=HFA80-,,+GЮзъьэьэ€€€€€€€€€€€€€€€€€ю€€ю€€€€€юэьъэюэюышыю€€€€€€€€€€€€€€эь€юю€€ю€€€€ю€€€€юэь€€€э€€€ьы€ю€€€€€ырчюъы€€эыэ€€€юь€€€€€€€€€€€€€€€€€€эыюээю€€€€€€€€€€€юэ€к≥ЦЫЬЩЦЦФПНЗДБА{vk^[[ZY[[YZZ\\\ZoЬЉЅСM8889=CEGHH]Оњн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лЪgE:65331000//./,)'% !$(.-($!#%)-.,/835Wc?!     5FQYpЬ∞ѓПfb^YWWTK>5+.`F  '.4;@CFLOQPOPQRSSSSRPQRPPPOQQQQSPNPOOTSQQOPRQSUTTTUUVWWWVVXXWWX[][ZZ\^]^`abddghdaa`^\]^\YXVUOHHH?840-*)'%%&&()(*3CNY|∞їШtopnlidb^WRMB6.'###!$##*,***,05;?AENSWYZ_dknnrrxx^A%  '09?ENUJ2'&'(+,&&# &0:?HRWR1"'/3>LSF" fв€€€€€€€€€€ьЏУsuttrpljgdabfouyxtvwusokfefghijihighikhehgddfebcddcehgdb`YWeД≠—х€€€€€о *>HFB;2,,,)HЭвьюыэ€€ээю€€€€€€€€€€€€€€€€эээыэ€€€юъьэыъъыщщ€€€€€€€€€€€€€€€ю€эьюьщь€€ю€€юыэ€€€€€юэ€€ьшь€юю€€€ю€юъыэ€юэээ€€€€€юю€€ю€€ю€€€€€€€юю€€юэ€€юю€€€€€€€€€ю€€€€б™ЧЪЪШТУФСОИДЕДzuk_\[\ZY[Z[[][ZZmЪЊ√ФL7978=CDDDHfЩ”€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€о®tC558620/0200.,+*%"#%(--($ #%(-,,0622SdB     3ESYoЬ±ђИcc`][VPK@6) .$  $-3;ABHNOMOQPOPQPPRRNPRQQQRPOSSSQQUQRRSUUSSUSTUVUTTUVVTVYYYXXY[[Z[]\]_`bda``bca`^\]^\ZVRSQIC?=81,+*%$%$'))5FQY|±єХsprnkhc`]VQHB9,$##  "%**)+.15>CEGJQX\_hprrkd`cljVB1$ %+.08=5,'%%%(*'%!  '0;>HSXL, $'19CNRB kз€€€€€€€€юоЈГnrrrqqme^^bgpqswwtusqnjfiijmkjmiihifdefcaa`a_^__ababdddedfhfffhy•„ь€€€шЧ   ';CC@91---,IЭўс€ьюэээюю€€€€€€€€€€€€ю€€€€ююю€ююэььэююьъэ€€€ю€€€€€ю€€€€€€ю€€€эыэьыэюю€€эшь€ю€€€€€€€юъы€€ю€€€€€€€ю€€юь€€юьэ€€ээюыью€€€€€€€€€ю€€€юю€€юью€€€€юю€€€€ю€э÷ЯФЪЫЪШТСПНКЕДГ~xtk_Z[\YXYYYZ[ZYZnЮјЅПJ9:8;@ABCCLo£№€€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џБI:97420210.,,,+'$!#),(#!!'+,,.0622Rb@!    .( 4HVZo†Ј≠В``_]YWRG>6'   %.59;AGKNUSNNNNLNQOOLNQPRRQTSSSSRQQTTTUSUVUUTUUTUVWXYVVWWYWVZZXYZ[_^\^`ba``a__`]\[YXVTRMDA>5.0.)'&'*,2>LY{ЃЄХtpqnifdb^XSJB:-$"# "%')+.07?BHLPUY`krxyxrh^YYZWSOE7*% %(++++)(&&&&&()&"!  )4;>FSZG*+2;CKQ@  jз€€€€€€€ю№Фippoppnmh_]fovwtrrqpokgfdkqokffiiggca_``_^_`]^_]^]_dcbc_`_]addfhhdfБ≠џ€€ю™  &6BB>:2.--*GЬ„н€€€€€€€€€€€€€€€€€€€юъы€€€€€€эь€€юээююэюэююыы€€€€€€€€€€€€€€€€€ю€€эщь€€€ээью€€€€€€€€€€€ю€€€€€€ю€юю€€ьь€€эьээьэюъщюююэ€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€щѕЮШЭЧУХФРННЛЕЕВ}ysi]YZ[ZYXZ[Y[[ZZmЯ√∆РJ9:;=A@CEERy®џ€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зЙS:98730010//+*(&%&')&"!&+-../622TiC   >eD4CS\r†ЄѓД^^^[XXTH?6&  #+4=KMKJKLLNOOOMPPOQONSTQQTSRQQTTSTTUVUVVSTVZXUVUUVXXXWWWXYXXZZ]^^_^]]^\[^]\\\]ZXUTRMG=66430.01/2?MWt¶≥Тrprokid_[WRKA8*#"$#'()-279FOQW_eiqvwvpibZTSROMMJH?5-)##')++*('''&%('&(%"  *5;?LXYB).5;BNS7 fж€€€€€€фњ~mnmlnpmiga`jruvuqqpmifabjnsrhbcgf`^^]\[^^]^_`__^`bbbfgfdcea`a^abdghgceВ√э€Ї#   %3AC?;3./,*FЪџц€€€€€€€ю€€€€€€€€€€€€€ю€€€€€€юьююьщэюью€ьыьэю€эю€€€€€€€€€€ю€€€€€€ююэью€€€юэ€€€€€€€€ю€€ю€€€€€€€€ьщ€€ыщ€эью€эыююыэ€€€ю€€€€€€€€€€€€€€юь€ю€€€€€€€€€ю€юнљШЫЭЧЦЧФОНМИЗВ|zyui\YZ[[ZY[YXYXYZlЮ∆»ОI9;;=@ABBEZЗія€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€гЪbA97402200+**'$&&&%#!!#*-.--552SuT! 3&  )05D?91/-++GЬбэю€ю€€€юэ€€€€€€€€€€€€ю€€юэю€€эьююыъю€ю€юэыьь€€ю€€€€€€€€€€эю€€€€€€€€юью€€€€€€€€€€ююююю€€€юю€€€€€эъ€€юэ€эью€€ээ€ю€€€юэ€€юю€юэ€€€€€€€€ьь€€€эь€€€ю€€€€й≤ЦЫЩШЭЫЦПМИЖЖА}{vpe[[[ZYZYYXXYXXXl†«√ИG:<;=>ABAE_Рјк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€н®oF:633/00+)*+&#&'# "$*,,--363Ow_&    *5- 4FSXlЬєѓГa_\YZVMH=0#  $,=Tde]VSRQTSRRRQPRRRSSTSQRVVVUUTTVVVWWWWUZ]XUVXYYXVWXXYZZZ[ZZ[Z[]][YYYVUVUUTNIC=:9:95577>IRkЪ™Оtsqmkfb`]YRI@7(""$*07;::861*##&')./.,,,*(')&')'$#   -4>ELTQ2%*5BKQN, mо€€€о≠qonmkjkjjc\_iquvusrqmhcbafospmlgaa`YVWXYYY\___^_cb_abcedddffffhghgfggggifeddhrf9 *;B>620,+*HЫ№щ€юююэ€юю€€€€€€€€€€€€€€€€юю€юююэ€юююэюыыьэыэюыэ€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€юьыю€€€ююю€€€€€€€€€€€€€€ююю€эь€€€€€ээ€€юы€€ьэ€€€€юь€€ю€€€€ю€€юэю€€югђЪ†ЭЪЪЫЪСЛИЖДБ~xsodZY[\Z[ZYXXYZXWl£»∆ЛG8:;>?@A@HeЧ…ч€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шљБO<8510/-,,)$$%# !%)+---342OtW&    &/& 3GT[jЧґ∞Е``^[WSLC:1$  ]Ы†ОrjaZUTQPQRSSSSRTTUUUUVUUTUVUVVWVXZYYWWWUXYXXUWYYYYXYYYYZY[\YXYXUWUSSRLHDA?=>:7<>8>JTkЫЂОssrnlhc`\WRLA7,((/7@JPUY]ekkd]YSPRSNJGB?CDA?=;=96758<8+((*,.0/0-,,,+((&))'$#    !-4?GKUO+ (,7HRVK(  hи€€џЗglkijghke^[alvxsqrqrnf_^fosrokjhc[XXVWXY[\\]^__]^``^a`bcbbabdggfefhihgfghgdadeb_T- &7B>61/.,+GЧЎч€э€€€ьъ€€€€€€€€€€€€€€€€€€€€€эю€€€ююююэью€€€€эъю€€€€€€€€юцф€€€€ю€€€€€€€ю€€€€€€€эыэ€€€€€€€€€€€€€€€€€€€€€€€ью€ью€€€€€€€€€э€€эъэ€€ююэю€€€ю€€€ю€€юэю€ы÷§ЫЮЭЫЧФТТНКЖЕ}{wqmc[YYZY[ZXYYXYZYo§ –ЪM78:<>=?AMq£‘ь€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎМW=62//.,,(%%""$(..-/420NqR%   & 3BP[jР≤∞Д^_]YVTND:2$  `Љ∆Њґ≠§ЦЕulcZUURRSSUVVVXURUUTTTVWTVWVVVUTTUVVXWVVVXXXXVVWXXZWWZ[YYXWXVTRSQKGD@??><>:;?A<9CPXuІ∞Рuusljgb`\WSNA64:@HQUSTW]ZTSOMIFEGD@?<8977765943567502200013545202/--,)****&$  %/5=GQXL! )+1?70-.-+FЬ№ш€э€€€ю€ээ€€€€€€€€€€ю€€€€€€€юэюээю€€€ьыьэ€юьышъ€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъы€юь€юь€€€€€€€€€€€€€€€€€€€юэ€ю€эю€€€€€€€€€€€€ъћХЧ£°ЩЩЦРСОКДБ|uvskc[XYZYYXXYZYXVViЭ∆ѕЪL;;<;=?ADTВ≤ё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€п§lH==;1,(%# %&+--,44/JkP      3GU`mП≠¶_]\[VSLD7.#  Q±ќвбўЅƒ÷€щй№—≈∞ЦК|wnf[RTUUTVVSUUUVWWVUVWWVTUW[ddYUWVUWYXWXXXXYXWVVWUTUSQPKE?A@@@>@B?;AOZxЂіМtvsljgc_\ZVN@9>FFR_\TPPRQNIEDDAAB>:76576469654454430312114663431310/--/.*)$  '17?IOVF!).3=NT4 #]МГlc`beddcZUV]kuwustoidairrvsrlic^YUUWZ[[^abaa]Z[XXUQOMMMMNWY[]`aafgfdcdedeiifjjljaVRY^X=  %2<<80---*HЮбююьююэю€€€€€€€€€€€€€€€€€€€€€€юююэю€ьььээю€юэюээ€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ььэыъэььы€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€ьэщ»УЫ§ҐЫШУССЛЙЖ{uutlb[[[YYYYYYYWXYXgЧњ ШL<:;<>?BE[ЛЈЁ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€о≤ОfOA70-(! $',.-.45/FgL      5ETanМІ®Б``]ZVRKA6,"  PЈн€€чябмю€€€ыьк№џ—ƒ∞ШЙxskfZSRTWWVWWWUVVWVXWUUWZ\WVVVVXXWXWXWVVWWVWXUSSSRPLE@@A@A?@B?:CPZv™ЄФsrqmmfc`][VM?7?C@N_ZOJHHJD@?????=;642332496655653323763347685687751/..--+    *4:DGKU@%(,4AQW7 8ene`_^_ac`ZSU[erttuurl`XbyГ{uolhb[WVUVW[_^_flmjaWQIEA<973/-2:3-!  T«€€€ю€€€ьюыыэ€эь€€чигџ»ђЯХЖ{me]XSTXZYWWWWWYWVWXYXWWWVYYWWXXVUWWWVVWUSQRQQME@==?A@A?:7BPYtЂЉЫvonljda`\ZTK?6;=:>BACEEDB=;<<==<988734325536654234256568::5767:9873.( )   ,5;EIOT8 '+/9EWW/  B^`\\]``__XSTXeuwtttupcSNayxrnmg^WRTWXXY\f{ПЯђѓ™†ФЕ{jS@95/.+**(&'*3ANX^dfedeggfgfehkjhc]Y]`T0 +6981/.,*EЬёэю€€€юь€эю€€€€€€юю€€€€€€€€ю€€ююю€€€ьъыщ€ююю€юэ€€€€€€€юыэ€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€юююююэ€эю€€€€€€€юэю€€€€€€€€€€€€€€€юь€€€€€€€€юэю€зЂУЭЫЪЬЭЧОНМИГ~|wsoj`Z]YXYXWYZYYXVVhЪ»ћУF9<<<:>FNkЭ—ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юг≠pD81)%"$))+,/44/C`L$     4CS_oФђ®~^]\XROH?6/! U¬ы€ю€эю€ююээю€€юю€€ь€€к≈жд’≠І°РБpfba`]ZXXWWYWWXYYYXWXWYXXYXWWWUUUVWTSSRQMIGB>>@AAA><7@RYu™єЪuoqnida]\XRNC7349;=ADA@?=:;;;>=<:87748734535642236434669997657740*$ '   .5:DKSR0%,.7HVS)  1QYXX[^bbZTNYdjptstssqfYQTjwrmif]VSUYWZ^kД§‘ц€€€€€€цн÷±ФxW@80.30)"!)2>AA?>A;=O[r®їЪupqmheb]YWQJA3-08<>AA??<;988;=@=;97736632565322227534973687410+! &    $18=EPVQ'(.0:JUK# 0LXUWY]]^ZQMXltvvtsppne]bruwupga]TRUXZ\kЛЈт€€€€€€€€€€€€€€иЇЦtI47863)%'(,18HVaggihcecceehjjg_XW[K  $29660,,-IЮЏс€€€ю€€€€€€€€€ю€€€€€€€€€€€€ю€€€€ю€€эьэю€эю€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€эъю€€€€€€€€€€€€€€юэю€€эыыюьь€€€€€€€€€€€€€€€€€€€€€€€эыю€€€€€€€€€€€ы‘ЬЦЭЬЫШФНООЛИГ}{xunhc[ZZYYYYXWYYXXXgЭЌ“ЦH98:=?>BS~≠Ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€нµ}K3.&! !'(),./24.CcR'     6ERZpЫЃ®~^^[YUQG>3+" Uµ√”€ыю€€€€€юь€€ю€€эю€€€€ю€€€шкмрьхг—ІЯФЕtlmi\YYZ[[YXWVXXXZZYXXYXVVUTVUSQOKEB??BF@?B?9?OXvЂЈШwtrojfb\XUSM>0+.4<;;<>=;<98:=>@<<858645535720/1/3544678534/*& # %1;AHRWL-/.9JSB 1OWVVXY[\VMIVjvwvurrrlcZc~Дxtoi_UUUSV[eБіч€€€€€€€€€€€€€€€€€€€дђ~G6:@=83.,+,1:IZcjidcbdfdfehki]U[Y:  %16210,+,LҐвэ€€€€€€€€€€€юээю€€€€€ю€€€€юь€€ю€юэ€€€€€юэюэюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юээъю€€€€€€€€€€ю€€€€€€€€эьюьэ€€€€€€€€€€€€€€€€€€€€€юьюью€€€€€€€€€€эюц≈ЦЧЮЪЧШХПНМЖГ~xuwuoibZ[\[ZYXXYYXXXYgЮЌ—СE:7;;<>I[Зµа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уЄДP4(#  "!&)*,/.01/EkW'     5>!5DQ\uЬ™§}_^[XSNH@5+"ZЈ«÷€ю€э€€юъ€ю€€€€€€€€€€€€€€€€€€€€€€цлмздЏ∆µЬГsfa][[ZXY]]ZZZWW[ZWVVUTTSRRQNGDCABE?@C>=EMXx®±Чywvnkfa]ZVRI>2-01699;?=:;;=>=<=<;53795345743312/1255732/)&"   (4:AISYG*,1?MS> .NXSRUVXZVJFUlvwwwurrmc[avЕwpqh^VRSRWd}Ђр€€€€€€€€€€€€€€€€€€€€€€€пЫB3;ILHA7-,,+2>Qcjgccfdcgeflmg^[YS2   #-2/.//-+K°я€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэээю€€ю€ю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€ээ€юэ€€€€€€€€€€€€€€€€€€€€€€ээю€€€юю€€ю€€€€€оЈЦЪЮЧСФЦХСМЖГ}wuurlg]XZZYYXXXWYXYZYhЪЋЌМB99:9:=H_Нјр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€т√ЭU1#!  %'+-.031/ElX(!"   $SV& 3ES\xҐ≠Юs^]YWSPI?4+" [є∆‘€€юь€ььы€€€юэ€€€€€€€€€€€€€€€€€€€ю€€€€€ъунйЁµЦК{qh_\]\[[[YZ\YYYXWUTTTQQNIGB@A>?@D?;AM[z™іЬzuwmiea\[VQH?5,0367::;=;;;=>>;:=9875884467653340.25110(  $   +8<  6FS[{Ѓі•w^]XVVQJA4+! Zє∆”ю€€уяэю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€шскё»ҐФЙ}md\Y[Y[ZYWVWXUSPPPKFDBFC=<=@@9>O]}©ЈЭxoqlhgc]ZVTLB5-+.48::78:;9:<<99;88545:9345530010.-(##)!   $   ,8>EGSW;03;FSS/ %LZUTSUVVQH;Iivvtvsrrlb[jАБ{tni]VSRWfК €€€€€€€€€€€€€€€€€€€€€€€€€€€€€фУCAS^ed^QE:201:I[ecbdeeeefimpk^XXJ"+2.,./--M•я€€€€€€€€€€€юю€€€€€€€€€€€эюэ€юыыю€€€ю€э€юэюэ€€€€€€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€юэ€ю€€€€€€€€€€€€€€€€€€€€€€€ю€ыъюэюэю€эю€йђЧ†ЮШЦТФХРДВ}ytspjd]YYYZXWWWWXVWXYhЭ……ЙA9:=<;>7;M_Г≤їЪunpliif]YUQJ@0+*-598;99:97:==:98:9447<842321.+(("#  #   ,3;AEOR0 #3382=M_ЗЄЊЫuprlgfb\YUOD<0**1767:=<;:9:>=;;9<947984430-)% "      .5;AGON) )46?LVP%#DYYUTTSQNA5<_utuustsmcW]{КupfYRQU\А €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йxNamtsmmlg^O>2/1?Sbfecddefgirrg]YU7 $01.,+,-M®гш€ыщ€€€€€€€€€€€€€€€€€€€€€€€юыщ€юьэюю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€юь€€€€€€€€€€€€€€€€€€€€юь€€€€€€€ю€€€€€€€€€€юэшщюю€€эъ€€ъ’ЯУЪЪХЩШЦЦСЗЕГ}xwqkda\ZZ[YXXXYWXYZXXgЭЌ…ЗB9=;:;AT~ѓЏ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€х≠d'!"  !!!$./..134-?fY/&(*5JM/    9GRZ{∞єІr[\YURRI=4.! V∞ƒ”€ю€эшэ€€юь€€€€€€€€€€э€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€эщъумв∆§ЦГ{l]VRPOLFB?<@B?63AM\А≥Ѕ¶xrqkfca\ZUNK=/**1557:=<98:9>>;869746410.*& " !  #/9>CLUO$*05?NYK:Y]ZURQNI?06WrytrtttndXWoЗГwpi^SQQ`Чм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€х°PgqvwrmnlhbS@222;Regffdefgfmuqg\XN% #-..-,-,J§выьщщ€€€э€€€€€€э€€€€€€€€€€€€€юь€€ьью€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэъюю€ююэю€чѕШХЭЪФУСТРНЙЕВyutnig`ZZZZXXXXZXWW[ZXhЮЌ≈АB9=<;=AYЖїи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъќp."" "#'.3../34/;[S.&'1Sxh6 !     :JR\y©Ј§m[][WPJG?4-  OЃ«—э€€юыэ€€€э€€€€€€€€€€€€€юыэ€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэъпд“≥ХДujaZOMGBCCC:3>M]~ЃЊ•yqnleba\YTOH;0*-/357=;:7;<;;;:77653.*'!  ! #   )07=CMWM(-7@P^I"L^ZYSPPK@0/NnzwuusupeXSiВxqlaVRWcҐы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш≤Yly{{ujhmoh`P?721;SbgecdegciptnaXXC  !*--/-,*FҐжэюэыюю€€€€€€€€юэ€€€€€€€€€€€€юы€ью€юэюэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ээ€€€€€ючќЦЭҐЩХЧРПОНМЖАxvtpkg_\Z\[XWWXXXWVY[Zk°Ћјz>:<:<=B^П»ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€юы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эџ|9"#"+39.-/54.6/,.0147<;89;==;9841.*'!   # $ ,37=BLVD)-5@U`D0ZZWUTSNA0)Fiyyvsstsl]TcВДupkdXQUg•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шґcwДД}wjciqnjcUD945=TdhcdeedikpqiZYU. *.--.**H§бъ€€ю€€€€€€€€€€€€€€ю€€€ю€€€€€€эъыэю€эь€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юью€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€юю€эъю€€юэ€ю€чљШЮ£ЭЪЪУННОЙЕВ}yrokd\YY\\YWVWWXYYWZ\m§ћ√}@:;8;=GeЩ–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эгД>$" -<<-,/55-:YS.('&3HA,%#%""     ":HQ[tІґЭj]]YWTME>8/]ґ∆Ћгаж€э€юэээ€юь€€€€€€юь€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юы€€эрЁЃ£ФЕxgVHGQaИѓЉ†tmomgb^[VPIC<3-,1666:;:=<=;95.-.(    "  &  +4:>BMR< "+28EX\98YYVVRK@2&:dwvuvusrk^U[xДzqibWRUe•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щїoЖМЛВvibbioqpgYH;51?VfggefeghjqrdXXD +/..0,-K£џчю€€€€€€€€€€€ю€€€€э€€€€€€ю€€€эъююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€юю€€€€€€ыцю€€€€€€€€€€€ю€€€€€€€€€€э€€€€€€€€€€€ююыъю€ьэ€ьюэ€с∞ТЩЯЯЬЫЪУСМДА{ysoljc\ZYYZXWWVXWXXYY]q¶Ќ≈~@:;78?Kl•ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иЗA&%# #2H?-..47.=bV,('%.@;-$"##&$  !:FR\uЂЉҐk\\ZXUMD@5, `≠∆≈ƒƒ…к€э€€э€€€э€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыукЋ±ЮoLR`К≥ЉЮrlplgb_ZWUQK>3--2778::9:51.,(),3/     $   -6>AFRQ5 $.5;HVW-7UYWWQH5,Uqxvtsssj^TWrВ|sodWOQZНы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы≈ЬЮЪКugc_ajoqqhXH8/2BYhhghefggpsoaVQ. *0-,/--IҐдю€€юю€€€€€€€юью€€€€€€€€€€€€€€€ю€€юэюэюю€€€€€€€€€€ю€€€€€эю€€€€€€€€€€€€€€€€€€€€€€юэ€€€€эю€€€€€€ьъ€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€юээюы€€€ююьээ€к®СЫЯЮЧЪЪПНЙБyvsooi_^\XXYXXVUVUUVXZ[q•Ћ≈|>999:>Nv™ў€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йМF('$&" !!!!&6K@-//57-@pc/'(&)0-("!!#&&!#   "8HS\r®ґЭi]^[XTKD=6+NХ√∆∆ «…йэ€€э€€€€ыэ€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€йДKScНЄїЬrpqngcb]XURJ?80-0266620-%)#%      # "0:>CGRN))16=FVT(9VVVVJ6'$JjusvxutmaVSkАvqgWOOScІ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЄСЈЄ∞Сvfb__finsncWF613D_ifgghgglpsl\WI%&//-.-/H†Ёю€эь€€€€€€€€€ю€€€€€€€€эю€€ю€€€€€юъю€эээ€€€€€€€€€юэ€ю€€€ю€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€ююэ€€€€€€€€€€€ю€€€€€€€€€€€€€юыю€эюэыю€€€€э№ЯТ†•ЯЧЪФЛМКВАzwrkf^[ZYWYYXXXVUUWXY[r¶»јz?98:<L\MBUUUN;& 8btvsuuuqeWRf~Аvpj\QRVVgµ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жТ†∆ ЇТteb_baejqqkbVC4.5Ldjiihghgkrsf[U:)0.--./K§гь€€э€€€€€€€€€ю€€€€€€€€€€€ю€€€€€€€€юююэю€€€€€€€€€ююьыьэ€€€€€€€€€€ю€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€ю€€€€€€€€€€€€€€эьэ€юыы€эюю€ы÷ЯТЬ†ЪХЧПУРЗВАБzvule`\ZXX[YWVXVUVWYZ\uђЋ¬z>9::4146F_kgedefgirsj\T;"-/0-+,H•в€€эю€€€€€€юэ€€€€€€€€юю€€€€€юэ€юэ€эюьэь€€€€э€€€€ь€€€эыью€€ю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€эъю€ююч»СОЦШШШРСНИДВ{wqmgc_[YX[\YYZXXXXWYZZvЈ“√yA<97;DfЭ—€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юцщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьќi3/;CE<2& !$-4.-/.37/;e`/!"   "%#! #"$("  ###$&&($"$$%""     %;IR]rЫ≠†m][YXUMFA:."oї»… ЋќбяЏ…вяаяЁЎєЩ~[f¬€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€е{NUfТєїЫusqlhc^]XUQKDd≥Я;      %    )06=CLU8 #*2;HXV4.QXI5%8etrtuvsoaPRnЖЖzncUORSSSRVУ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щЊЖЫ§≠Шzhccda_`aegrtph\K<9;Oflhgffhfnup^XL*,./.-.J£№ь€эюю€€€€€€€ю€€ю€ю€€€ю€€ь€€ыч€ю€юьэю€€€€€ю€€€ээсь€ь€€€ю€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€юю€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€ыыююьъюэ€уЇФФШХЦРОЛКЖГБ|toifb^ZZXYZWVXWYXWYZ\\wіѕЊxA=;:Sa],==LxЄт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пСM=CIKC5)!"$-.,--/3507UW0$%$#!#!  !"#'((*)&%''(&')**&&%'(($#!  *:EQ]t£µ¶p]`\XVQFA;/ TЂ≈њѓH+!$]ЫСS$2Ky±ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юяvNXiРЇЇШpnkjgeb]YWSKHj≠|)        ( %.69?FSK).6F]qb&>K74_kmqrttm^KRqИАtpeWOPRRPRRQSfƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы«РЬ¶©Пviebb`_bb_Z]bbfjh]SG<;ATfkgfgeaforeYP3 ),-2.-L§бющэ€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€ю€€€€€€€€€€€€эьэ€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€юыэ€ээ€€€ыг•НУЦФФФПМЖВА|wsrqjd_ZZXWYYXYXYVUYWXWWtЈ÷»{@=;:>RГјъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юы€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч£X<=@@:1(" ! +/--..0217X^0###!! "$#%%&'(&&&()('+,++,.-+('($$" ,=CP_w¶ЄҐl]`]YURD@>1 !wЂЗY-=$"LkjmpstsfSJdГЕtpjZSRTRQNOQPT\Щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€х≤ХЮ™ЬБofcaa``dc_eiXX_jldXMC>AI^nighfdflul_WC%-00,,L£гэчю€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€юьыььюыь€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€эю€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьъющ€€ю€э№ЮОФЦСППРПЙЕА|yvrojc]\ZXWYXXWXWXWWTXWYt≥”∆{?:98>VН €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы¬d=;:85,$  ).,--..21:`e/"#"! "!##$$''&''**),--,022-/1//+(%,1 3O4 .@" '3BNgЧ п€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гwNWhТґґСrrrmjfa\ZURLCaХZ        )   '-3?CINA,7?RhmI!&;16`khnrvsiZN[|К{njcTSTRQRPNPQU[Йэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лЮЧ°§Кyldacaacc^cЙЙQM[inf]PIFA@SjlgffhfittgXN-$+--./L•вээ€€€€€€€€€€€€€юю€€€€€€€ю€€€€€€€€€€€€€€€юъ€€€эю€эыъь€€€€€€€€€€€€€€€€€€€€€ю€€юы€€€€€€юъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€€ю€юю€юю€ээь„ЪТШФРЛЛОТПД~~{sngca]\[YZYXXWVYXVWYWYs≤“»{@;:8B_Ш–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гzG974.($ !!(-)+.//20     (   !-3`ghmstodRJbЕЖuqeXQSVRQNMJORTWZm≈€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы“Ь®£С{mgffcdacbjЂвўНHWbotm\QPLCHQfnefeefmvtbXM&$*1/.0K®Ёы€€€€€€€€€€€€€€€€€€юь€ююэ€э€€€€юю€€€эю€€ью€юэю€э€ыэью€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъы€€€€€ю€€€ю€€€€€€€€€€€€юююю€э€€€цЅТНТТОМИДЗДА}wurnebb[WXXYYYYWVVWXXXYZrѓћјwC<=:5159621*(% 'GF/'$!  'LМ“€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ‘kLWdРєЄПvplkgcb][XTLDWh1          &  $/9@AEME".06CLRCC\`ejmooaKMpМДrmaVUWVXWSSTVSUWZ^aЙэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ювШЂ™У|mhd`aadcepњ€€€уСVcktvreTMGGIPbmkfeghpvqaVF#%())-HЯ„ыюэю€€€€€€€€€€€€€€€€€€€ю€€€€ю€э€эю€ю€€€ю€€€€юэюь€€юю€€€€€ю€€€€€€€€€€€€€€€ю€€€€€€€€€€€€эъ€€ю€€€€€€€€€€€€€€€€€€€€€€юььы€€€€€€€€€€€€€€€€€€юэ€ъюютіУЪТННСНЗГЕА{vsmmgca[ZWVWYYXZXVTXZWVXXrЂ»њw@;=>Nј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч§gF6(%!! &'+-.-/0-5hБ;!$"!!!"!%&&%&&('&((*+),,*,//0/.0/5GPSK=7=FQ]u¶≤Рg```\VPD?<7;D?:70-)$   $##  =Бѕ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э”kKT`ПљЉОqlmkebb]ZVSMCPY'       &  *4?EGKOB+.5@HQ;:W\`ejlm`MHgЖЖsmdWTSPVXXSQRTUZ[\^ayг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юꥃҐЖrgfd_cebdiЦ€€€€€№_^hqzzo]OIHIIWjmdeefktul[R3%**)+H£ўфюю€€€€€€€ю€€€€€€€€€€€€€€€€ю€€ээээ€ью€€€€€€€€эюэ€юю€€€€юьщы€э€€ь€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€ыэ€€€€€€€€€€€€ьш€€€€€€€€€€€€€€€€€э€€ю€€эйЂФЫУСПНЛИД|{wqmkgac_]XVUXYXXVUUWWWVXYwѓ»Ѕs?70+'%!      /kЊ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь√jNSbСЊЊРusqlhd_]ZWSJ@KE    $   -6BHPQQ: #,/2?JP32PZ[bilkdUDZБЛymeYSRLFRWWRQSSVZ\]_aoЊ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш«£ђХzkeedbffcey‘€€€€€щСZipzzvfTNJMLReofggghpvtaTA&%+-,,H§Џь€ыэ€€€эю€€€€€€€€€€€€€€€€€юэю€ююэю€ю€€€€€€ыю€€ыыэьюэьэ€ьъчъэ€€эы€€€€€€€€€€€€€€€ю€€€€€€эю€€€€€€€юэ€€€€ъэ€€€€€€€€€€€€юь€€€€€€€€€€€€€€€ы€€€€€€€юк©ФЬХПМИЗЗЕАzxzuokf^_]]XWX[WWWWWXWVWWXZv≠…Ѕq><>AYСЌ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€п£dC0%"  ""').111114hw7!"!#"!!" "#!#$$!#%&$$'$$&'&$%'&)-/3Yttoje`]SHF?<51+$   %cњю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыЊhNUeЦњњСtsqkgea^XURI?G8      !%   /7BJQTP2 )//4AQO+(CYW_fkmhXIPqЛАngYRSI@EMVUVUTUWZ]]^ckЫю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьйЩ®£Лrgfcehgfdi†ю€€€€€ю“\eqx{zq^ROOPN[llhhhgkvvhTO0#-,,0L£гю€ьэ€€€€€€€€€€€€ю€€€€€€€€€ьюэю€€€€€€€€€€€€ьюэь€ью€ю€юээыэьъ€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€э€€€€юю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьюю€юю€€эёЭФЫТПОЛЙЖГ~zyxrmkic_\YXUVWVWVWWYXXWWXZz∞ Њq@:9@_Ь№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ют–ЙQ6&  "#()-/-0505dt6"$$"!! ##!#""###$"&'#!"!$$##$$&()(((*5@JS[x™ЄЬj\[\WURFA1-&   ,w“€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьƒhOVgЧЊЊПsqlieca\WSPI=A3   #1   ".7@GLQK),0/4@PL%$7TXX^ehjaMDaЕЙslaRQT<3CMSUUUTTZ[]_aeiДц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юв¬£ЂХ}mfebehfeewў€€€€€€€уYmvzzxgWRQPLSepighhlvyp[T>#,/16LЮею€€€€€€€€€€€€€ю€€€€€€€€€€€€€€ъ€€ю€€€€€€€€ьыщэьэээююьъээььыю€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€юю€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ью€ьЏЧНТППНЗЗВДz|xnljkgaYVUSWWWUWWXXXYXXW]А± ¬u@>AFf™п€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уІi?($ !%'(--+,3.7eq7"##! !"$#"#"""#"#%&!##$#$"$$##$$ $'5?IP\w≠ЇЫh[[]YWRH@>JИїґѓ©ҐШПЙВ}zqlhc]PF=3*&"  ! !   5Нз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыґgPUcФ¬¬Сqoihjd^[UROI<=/    %;  %/:AFMNF" *0.1?QI!*HZUX`ehaQERxН~piYQ[tP+>MVVVUUY]_^aaffzб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хґЪ≠ЂИsifabgggfkЫь€€€€€€€эЇQbsz|xl[USOOT`nkiiilsxvfVG*)116BЧя€€э€€€€€€€€€€€€€€€€€€€€€€€€€€ьюючэ€€€€€€€ээюэьээщъчптэыыю€€€€€€€€€€€юю€€€€€€€€€€э€€€€€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€юэь€€ъѕТМХЦФОЙЛЕА{zupljifc^YUUTVXWTVUWVVWWXY\|≥ќЅt>CPStєш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыѕВL1&# !%&)+,-.1.8dj7!#!  !##"!!!  "%$" $#$"$#""$#" ')7@HP[u©єЧhZ[[XUOF>?KЛ√««ƒЅЊґ≠•ЫУНЙБ|skd[PF=3/*%$$  &#! !$$%$"  I∞€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЇhPTaРљЅХqnkkjd_[XRLF?=/    %7  &2=BJNPE(0/3BSI 6VYUZdfeZFBfМЛrl_SZЬп£/@LSWXXY[_c^cggksЊ€€€€€€€€€€€€€€€€€€€€€€€€€€€€юџЦҐ≥•}lgfadffffv”€€€€€€€€юб\Umy~zrcYTOMS[kmhglknyylXN2*10-@Ыещ€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€юь€€€€€€€юээ€€ю€ышэьъсыью€€ю€€€€€€€€чнэю€€€€€€€€€эю€€€€€€€€€€€€€€€ээю€ю€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€ьэ€€ьэь€фЄНОШЩССОЙД}ytrokikc`YXWXVUWUVVVUTTVWYWX{µЌЊs>:CQ}¬€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уЮb=+&#!#$$$)(,.1417_g9#$! ""! !"!"!! ##$!! ""! !!%));@JQZq©єХh_ZZXVQH@=IБґљ¬«ЋЌћ…¬Љ≥ђ§ЬЧМГzrld\QGA;81+'%#! &((&$(*'''&"!!  $мь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьєfNUbОЅ¬Хtnlkfba[YTOG>?1      /  *29BGMO?'116FUBFZUU`cc_Q@T}Р}mcWVwл€’<:KSY[[]^^aadhjmnЬ€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ»Ь£ІУtdddbcccdfМш€€€€€€€€€сoMcv{|xjZTQNPUdmffljjvzo[S?01,,?ЩЏщ€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€юю€ю€€ююэьэю€юььэпъ€ьэюью€€€€€€эбЏ€€€€€ю€€€€€€€€€€€€€€€ю€€€€€€юэ€юэ€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€э€ью€€ю€чЈОСЧЩТСЛЖД{xtpojdegaXUUVUTXXXWUTWTUVYWX{≤«Љs=:GT]sІґТfa`^[XRFAADkУЬЮ§¶Ѓ≥єЉњ¬¬¬јЅњљїєґ™†ХЗ}skhaYVPKGGCC>62,(! (,-+,+,-00-$#''%%   ,Уюь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эќmOWeЪЅїТrolkgb_ZWSMC;:/     "+  +6=ENMN1 %..3<@[Ц‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юфµuD1'""#'+)+-,-4:IQRQ+ ",.3@NR/1PTX\c_T>@hЛЕqh[T`’€€€эЮ;ELZbcbeecfgffjkrЋ€€€€€€€€€€€€€€€€€€€€€€€€€€жЃЮ©£Оze`^^^]`ak≥ь€€€€€€€€€€€шsOat{|{o`[YSSUfojghjnuxo]T<,()?Ъўэю€€€€ю€€€€юю€€€€€€€€€€€€€€€€€€юю€€эюэ€€ююю€€ьщ€€эьщэюъююы€ю€€€€€€€€€€€€€€€€ю€€€€€€€юэю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эъюь€ю€€ь€€€€€эиђЦЪЫФРПЛГГ{vrrmjg_\XUVUPQVZYYWVWVUVWWZ]ѓƒєo>?C`Ґж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жЦZ;/%&''**,,-/7;HT[oІєЦiba\YYSN@@BhДГЖНПСУЩ†§©±∞≥±µЈґЉ√√ƒ≈∆¬ЉЄ≠ҐЧМЕzuqlha^WQH?70-$ (-../104=?<8:7340,& 9Ышы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЊeNSe£…ЉРqnqnga^]WROD::(   &,  &,6?IQSL  $+/8ANQ+4QTW[_WF;T{ПzkdXXҐь€€€юЊ?Hf¶х€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЈyJ6)')()*)-/1:=>Wm@'$&5O]I."" !+>@IS\q©їЧib_\YVSNBBDd|xxБЖИОТЦЫ°ҐІ®©™™≠ЃіЄљЊњƒƒ≈Ѕї∞¶ФЙВ|xrjfd\UOF?72-$#&.444567=C@<<@>874.&  !sЏю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЊfLTf¶ћїСqqykgb`]XSNC;8(   $+  *0;DNTSI'-25DTQ'6QRU[[M:CmСЖpj\Wuд€€€€юяHCN_fjkcceeccfilpИщ€€€€€€€€€€€€€€€€€€€€€€€€в¶Ц§¶Рyja^_\Y]ag£ь€€€€€€€€€€€€€ў]Xoy~|zj^ZYUV]jkjjklnwxhYP7,*>Ьа€€ю€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эь€э€€юь€€ыьыю€€ъюьээь€€€ю€€€€эю€€€€€€€€€€€€€€€юююьэыъэю€€€€€€эю€€€€€€€€€€€€€€€€€€€€€юэь€€€€€€€€€€€€€иЂУЦСМИЙИЗГzvppokea`ZUVSPPTVVVUVUVUVUVWYy™ЅЄp?H?1  *?@KT\m£ґЩib_\[XTLC@A_zvsuw{ВЖМСФЧЩЭЭЭЯЯЮҐ•ІЂѓіґїЊњЊґІҐЭЦОЛВ}xqkd\WRKC?;4,+25:;??=BMKB>AB@;990$ Kђ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эґoUVf•»ЉЦsqpeec`[XSOF=;* %- +5@`q=$%&'2=:-)<+  ',  ,7(-5;KXF#">NTXWL;>kМКrh[Tzн€€€€€€щ{>P]ilifghhfghhkjt’€€€€€€€€€€€€€€€€€€€€€€€ЁЯЩҐ†Т~oieb][[]bЧш€€€€€€€€€€€€€€ыМUk|}|xlc\\VWfplhfkkrzq_SB.-@Чќр€юэ€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€ыюю€юэюэ€юю€ээ€€юю€юээээююэючэю€эчээ€€€юэ€€€€€€€€€€€€€эю€ю€ююэ€ьэ€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€э€ьюэ€€€€€щ–ШХШТКЕЗЕБ{vvrikh`\ZVSQSQPUXYVWXWWTVUVV\{Ѓƒєn@?LЖ»€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щґuI4,--,*/--7>Aes?'###$&% %4SАХ{kaRUј€€€€€€€€ІBQ^lqniiggfhhijlm≠ю€€€€€€€€€€€€€€€€€€€€€эЊОЭ©ЬЗulhd`[ZZ^mћ€€€€€€€€€€€€€€€€іWcw~}}{oc]]VVaokkilkqzycWJ1+<УЌх€€ю€€€€€€€€€€€€€€€€€€ью€€ю€€€€€€€€€ю€€ьщ€€€э€€ыю€€ыь€ээ€€ю€эыььшъю€юэью€€€ю€€€€€€€€€€€ю€эю€эьююьььэ€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€ю€€€€€€€цƒШЦХПККЙЗБ}zxrnlc^ZYXVTQMOTWXVUUTVUWVXW\{ѓ»ЉoB?OЛћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьжІjB2.,-*.-,7ABbvD'#"!  (>@KU\s§∞Уh`^][UQJA@AS`acefjlrroquwxz|}А~zy|ГДЕИККМРУУХШЪЩЪЬЫЫЭЩЪЧПОМГБ|dRORSSSNJMNUXZYVRRNJE-   E®ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞gPTd†¬јШslljgd`[URNF<<&    &%  #*6BIKQP0)07AOU;(FOUTB3;gНЙpgXVЫу€€€€€€€€ћJQ^itqigcgghiiihmГц€€€€€€€€€€€€€€€€€€€€€жЯШ•ђУ~mgfc^\[Z]Бр€€€€€€€€€€€€€€€€÷_[rА~~qd\\YZbnllkjmpwyg\O4-@ЦЎэю€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€ю€€€€ююэю€юью€юыэьы€юьюю€€эюэээю€юшъ€€€€€€€€€€€€€€ююю€ю€€юь€юэьь€эщ€€€€€€€юю€€€€€€€ю€€€€€€€€€ююю€€€€€€юээ€юэшЅФРШЧПОМДГ}vssmeb^\ZXVURRSTVWVUUUVUWXWXZzі—ƒsA?QПќ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эшЏШa?3-/--..9AEcwF"##! ! (?@GS\q£∞Рf_`\YTQMB@>FKPQTX]`cfhjnpqttstsqnpv|wzАВЕЖЙЙМРРТСФХТФТФЩЦСССПВaSTZXSSRPNIJRXZ[[ZURE&   ,Пщы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞hQTe£≈јЩtnlifa^XTQME<<&    )&  #,8DNOSO' ,/7BOW4-LSTL6-MХznbShл€€€€€€€€€йXS_frukfgjiihiihjxд€€€€€€€€€€€€€€€€€€€€ъЅЦЭ©•Зthcdc``]\bѓэ€€€€€€€€€€€€€€€€оlYo}А}Бvga\Y[bqqlhkomrwm_X=,AЦд€ьюэю€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€эююы€€€ыыьюэ€€щюю€ьюю€ююыюээюю€ю€€€€€€€ю€€ю€€€эьэю€€€юэ€юьюэю€эю€ю€€€€€э€€€€€€€€€€€€€€€€€эьэ€€€€€€€€€€эюцЉУНРТПМОЗА|yulf_``][YUUPORSVWVUVUTSUVUWX{іѕЊn@CYЧ“€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ€ш¬Р`A20-.-.8=GczH"$$"   (ABKU_r£іТdaa\WVOHDA=0+07=ELQWX[^bdekmjjmkgjlonpstw|~ВВГЕЕКЙОСХУРРЩХСССПx`XY\]Z[a_ZWKFIT\[ZXV?!   !xп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃgQUe§ЅљЧrklhca\WUQKG;9& )'  %-8ENPTM!%/.8DPU01OQK@-8fТТqkZNcл€€€€€€€€€чiW`fstnhghhgiklkktЋ€€€€€€€€€€€€€€€€€€€€а™Ю£≠Щndceb`a^^zй€€€€€€€€€€€€€€€€€ыЖ^oz~}А|oe_[Z^mskgjnkqxraZE-:Цёээ€ю€€€€€€€€€ю€€€€€ю€€€€€€€€€€ю€€€€эюью€€юэээю€юь€юэъъы€€ыэю€ъьыыю€€юь€€€€€€юэ€€€€юэ€€€€ээ€€ъ€€€ю€юээю€€ю€€€€€€€€€€€€€€€€€€€юю€€€€€€€ь€€€ююу≥СРОМЛНОЗЕБ{uifdc_\]YUSOLQUXYWURTUTUUTVW~іЋЈjBFb†ё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьс≈Т`>/./.,6?D\zL&%$"  '  ,# ! )?AKT[u®ЇТc]_^ZVPG@@>&$.7>GJNTUX\\^`a``effgmopqruvx{}БГЕКННРПЦУФРПЙl`^\Z_ehnkc`UG>I\]YYY:!  Pіэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€±fPTaЭљЉШtlhge`[WURME88$  %( $1:FLPUJ %.1:BNT*7PPB4)G|ЪВoeSOXўю€€€€€€€€€ЦT_jstqkjihgilmlim¶ь€€€€€€€€€€€€€€€€€€э«ЧЭ™®Пxh`dha_a`bѓэ€€€€€€€€€€€€€€€€€€Ђ^ly|}~Аtfa^Y[epkhkllorrcZI0;ТЎэ€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€ю€€€€€€эээюэю€€€€€ю€€ючьщьюэь€€юющцюэ€€ьююююээ€ю€€ю€эю€€€€ьююэъэ€€э€эщщю€юьээ€€€€€€€€€€€€€€€€€€€€€€€€€€ююэ€€юмѓОПСМЗЕЖЕЖАyxlega\[ZXUTPNPUWXWURVVSUTUVXГі∆іhAGg©и€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дм€€€€€€€€€€€€€€€€р«Сb<-./,4>BXuM'%#"  ) ""0'  )>@IQ]r°ґУe^a]ZTNDACILMQUZ^affhhgfhjmsxx{|}Б~}ВВsoh^^bbknklgcWQMBPedb^3"  #0AZhf^SBSВђо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞fORj©¬≈Яukige_`YTQLC99  $!  +=KU`suF,0/:EOL@JB3(AxҐКm`RPE;Їю€€€€€€€€€Ў\^hswuohghjkmiiklvа€€€€€€€€€€€€€€€€€э∆ХЪЂІП{kdbafb`ae£ш€€€€€€€€€€€€€€€€€€€мm[r{Б~ztjd^\\bnpnlilqwuk\U;;РЁь€€€€€€€€€€€€€€€€€€€€€€€€эю€€€ь€€ююю€ю€€эыэюю€€ю€€€юыю€€€€€€€ээюююыюю€€€эщ€€ю€ыщюэыь€€эъ€€€€ю€€юь€€э€ыью€ююю€ю€ю€€€€€€€€€€€€€€€€€€€€€ю€ыэююб°РСПЛИИВ{z|vsod^]]ZWTSRPKPUVVUUWVTVVVUWYДЈќ±eDLqµ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЅЉэ€€€€€€€€€€€€€€€€шкЋРM8206AFg}K*%!!!$"!!"!,EAFPZt¶ЈТgbb\YVQF@@=   '*37;BEIRUW\^_]^acgkpprtx{y{}}|sjjfa`cdlnjib_VNLENgdgZ4'"  "%##'+% %-BTftГЙЫ≤Јл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃdPTiђ «†tlhfba_ZURMB7:+    $  !1BRYjwh8 -24?FRF&@C:(*ZОЫwi\OG36ƒю€€€€€€€€€кd_iryvngikjjlhhjms∆ю€€€€€€€€€€€€€€€€н°ШЭЃ°Дshcaefbaapяю€€€€€€€€€€€€€€€€€€€ъwUjw~}xnaa^_`mrnkjjmuul^ZBAЧяъ€€€€€€€€€€€€€€€€€€€€€€€€юю€ю€ю€€€€€€€ъэээю€€€€€€ю€юэ€ээ€€€€€€эээюююыэ€€э€э€€€ыыюьъы€€ющю€€€ю€€€эюэээь€ю€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€эщьь€бЮПНКМИЗА||{tslfaYZYVSQPPPQVUVTUTVUVVUUWXБЉ‘µgBNxЊэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€унЉyN608DHh|I'#  #" ! .E@JTZv©єЧf_`]XVQF?=9  $-35>EENQUSVXW[^agjjlnqtvvvnff__bdgkpnkc]VJGKMbamU2-,18/,(),.*'&&'&"%(/DPB(A=0!7qЫКofVI>(3»ю€€€€€€€€€ыЗbjuywsljkjjljjimm¶ь€€€€€€€€€€€€€€€€”ХЬ©≠Фznhb`cfaabОс€€€€€€€€€€€€€€€€€€€€юЛY`q}АА}pb``^\jsmljijpsma_JCЧўъ€€€€€€€€€€€€€€€€€€€€€ью€€€€ээ€€€€€€€юээюююю€€€€€€€€€€юээ€€€€ююю€€ыъюэю€€юыю€юэ€юъэ€€€€€щэ€€ю€€юььэьэь€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЌЪОУУНЙДВ~}unkffaXXXVSSTSSSVUUUVTTSTUUUUYДЅ’ґfBNАƒю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шг™wF17@C_sJ&"! !#""! ##"! !,CBJRYt™їЫma`]YURH@;8 &,.7;@CHJJPSWX[\_adgjnlejh\`behmqonfcXNFHHXia627" 87&=XTH@62//-//*,+(#%! !%(+5?Me{Х©єг€€€€€€€€€€€€€€€€€€€€€€€€≥hPUiѓ∆¬Яsmjeb^\VURJC5@XZOH<,   $  (BU_ikbQ$ #-17;AO<.B7(#LЕЬ|l`OD2$/Ѕэ€€€€€€€€€€†ajt|wskjigkjfijlj~р€€€€€€€€€€€€€€€фіЫЯЃ©Иsmg`acecbhјъ€€€€€€€€€€€€€€€€€€€€€©_^o|Б~rgdc]^froliiilurd\JAТяы€€€€€€€€€€€€€€€€€€€€€ю€€€€€юэ€ю€€€€€€юыю€юэ€€€€€ю€€€ю€€ьью€э€€ъю€юьэээю€€ээ€€€юьь€ю€эююшэю€ю€юэьъюю€ыыэ€€эю€€€€€€€€€€юю€€€€€€€€€€€юэ€юь€€ы≈ШХШСЙЕЕВА|rjecdb[UVUTRQRSSTUUVSSTUUWWWWZЕј„µdCOЖ«ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыј¶q=5&&2_RJetg_ZVRIE>;A=41,+,%&**'%(%*.7CTjГЧ®Євыысф€€€€€€€€€€€€€€€€±eNSi∞«≈Эrmkea_\YXSLA5CVXWOE>8.$   %  3IW^cd^N).26:BP52<- .fЧФrgWK=(-іь€€€€€€€€€€єbls|yuljijmjhhkkjuаю€€€€€€€€€€€€€€‘ТЩ§™Щmgc_cegecrв€€€€€€€€€€€€€€€€€€€€€€∆b^m{Б~~xkfc_^cqrlhijmtsgZNDЦЁэ€€€€€€€€€€€€юь€€€€€€€€€э€€€€€€€€€€€€€€€€€э€€ю€€€€€€€€€юыюэээы€ю€€€€ъэю€€€юээю€эээ€€эээ€эюю€€€ьююъюэээъы€€€€эю€€€€€€€€€э€€€€€€€€€€€€э€€ью€ц¬ЬЪЧРМЕ~}{piffbb^YWVSRQQSSSTTTRRSVVXXVXXµ—µfCSИ≈э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€эЅїЪb67?\pF$"""  ##$&$"#$ !!!   1GAFPXp©њЧkhd^XWSK?76 $',38>@CFKOQVZho]\`eglptsmfj[NFCERvЖ^LGH# Ah_eЛЙwnmolca^XWUKC>73+,-1-+-*,,,+/460*$!   &   !9LVY]^]H*-45@IR442%?|ЬГm_MC3",≤ь€€€€€€€€€€џfiq{{vpjiknjklkmlo¬э€€€€€€€€€€€€€ы∞ЩЭ≠®Лvibc`dcegdУф€€€€€€€€€€€€€€€€€€€€€€бk\jv~}{ogcc`dppjhjjksriZQFЧдь€€€€€€€€€€€€€ю€€€€€€€€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€эюэьыэ€эюьююыщ€ю€€юэю€ю€€€эюююьыюэ€€€эю€ьюььээь€€€€ыю€€€юю€€€€€€€€€€€€€э€€€€€юэю€ыƒЧЦУСПГzz|vogeb\[YVXVUTRRQRTWWTSSTTUVVVWY±ћЇkFXПƒь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эщщз㿥x^25?byH%#!! !"$"$&#"#$   2EAENYm®їХlgd^ZXOE@91  #*-34<30,('"!    '" (>MSW[ZY@'-4:BIK/ 3+"XТЪwjWI<'-≥ь€€€€€€€€€€хvhqyyxrlkjjihkjlki§ъ€€€€€€€€€€€€€яСЩ£ѓЫmgedabdggh ю€€€€€€€€€€€€€€€€€€€€€€чz\ht}~}|sigfcdosmkmkkrtk_UKЦжю€€€€€€€€€€€€€€€€€€ю€€€€юю€€€€€€€€ю€€€€€€€€€ээю€€€ю€€€€€€€€эъ€э€ью€€э€ю€€€€€€эю€€€€ъ€ю€ьюьыю€ю€€€€€ю€эюю€€€€ю€€юэюэ€€€€€€€€€€€€€ээщю€€э€€юпµЦШУООЖ~xxrpkf_\XXXUUWRPOMOUXWTSRUTTUVXXZГµ–ЅqJ\Ч«ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьш䴶Ч_+ 3>^xM&%#!!""$$#"#"""#! "$#! /AAENXk®ЊУjebaZXKB@<3   #.5;J^ncVZ_fjkqspfdn`RLA>Rj_NLRRAGKxЯЮТТОПРРОЙВ~yqkhd[TNF@=<;;50379768834:9;810-)&#"!      ("  ,ALRUYWV3 &.4=EMI&.%2o†НteNF5,±ы€€€€€€€€€€€АiuzzzrkkgijjhgiihАр€€€€€€€€€€€€эљЫЩ®™Мygceccdfhgи€€€€€€€€€€€€€€€€€€€€€€€€З\gs{~}}ujgfddmtpmmljovo^UPЦдю€€€€€€€€€€€€€€€€ыю€€ю€юь€€€€€€€€€ю€€€€€€€€€юью€€€€€€€€€€€€юыэ€€€ю€€юю€ю€€€ээшэ€юэ€чь€€ьэъъэ€юэю€€€€юью€€€€€€€€юю€€€€€€€€€€€€€€€€€ь€€€ю€€ючіЦСМЛЙЖ|xwsonic_WWWURTQLKORUVWURWXVUVTWV[В∞ќƒqI`Ъќэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьзЂЗaP*1;[sN'$#""!#%"!!! #!! %!  !!"!,<>ENYj£їУjba^[WOE?<1  # !@enWR\afjlmnpifn^SLB>TqdLLRL<2C|†ЭЩЬЩЯ§І¶ЮХЛГ}wvrlif]\\XQNE@DGEFBBDAAAEC>=9=7JR[jЯЇРhaa][UQF@:0    >@>867?L\k{ЗТІєПXPpі¬ЄШsifca^\YTSL@7=OPIA@920.(()#    "(   $  6@@DHNSK  (.5>DPG#!!b°ЮwhVG6)µы€€€€€€€€€€€ nozБ~wogiljmnljigl≈ь€€€€€€€€€€ю√ЧЬ®ІНwjec`ac``bpв€€€€€€€€€€€€€€€€€€€€€€€€€ѓ_bqyz}|umgdfchsrjkkjntse\UТею€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эы€€€€€€€€€€€ююю€ююьэью€€ю€€юьы€€€юэъь€ю€€ьэ€ю€€эюьъщыююы€€€€€€€€€€€€€€€€€€э€€€€€€€юъчэ€ы€€€€д™НИЗДБ}xuvtpjc_[XWTSSPONQPNQVVVWUVVVVXXWW|®«µhKi£гэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ БT:/*" +;TnJ)%! """"!##$! !!"$""""  -;;GSYjҐЇНhc`]ZTMC=:.   ,+Hp]IT]einpqnhfbd[RKGHYu`ICA5  2rЗМСФЫ•Ђ≠™Ђ®ҐЬФЛЗБzwxwvyxvsrpnfdb[]a__[Z^[UMHJEA:68=FIKQTuНUGMr±јЄЦrhda`^\XTQL@7?QQHCC>961*'%         # "19;BDGQE ")089- +dwВИЙНЩ£•§§¶§ЮЬЦПЕ|xxxwxz}АВАzusprstrkooid]YSMMGBHLMLJHBGK@DNp≤«ЇУshcda_[WUSL?9EVVNICA=81+&!  %   $1;>CFKRA$+09>HU?LШ≠Бm^OB*(≥ы€€€€€€€€€€€шzov~zqjkljllhhjlkЖс€€€€€€€€€€ЋЪШ°•П{ligcca`cdbƒь€€€€€€€€€€€€€€€€€€€€€€€€€еp_r{~}А}tifffiptpmmjkrtm`\Чеэ€€€€€€ю€€€€€€€€€€€€€€ю€€€ю€€€€€€ю€€э€ээ€€€€€€ю€€€€ю€€€€€€€€€€€€ююэ€э€эюьэ€€юьыьэ€эы€€€юююю€ээю€€эюьщы€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€эююэ’ЮЖИЕБxxtsnjjda[WSSTROMNMLNPTVSRUTVWUVVV]Ж©¬£ZVК≤ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЅБV@4-(# ,82$  $Ugpvz}ЕУЬЩЩЧЪЪЫШПЖАz{wswzБДЖННЙЗДЕВЕЖА}АБyrnie`_WNMW]ZXQMF88AOnµ»њЦrkcfb`[YVRNB7DWXVPKD>7/-("  (  %27?EENV?',/4>MU6gЂЬxhTH3%!(µы€€€€€€€€€€€€•pt{~{rkjllkigikkksг€€€€€€€€€х≥ЬЬЂ†Жtifedc`bdakг€€€€€€€€€€€€€€€€€€€€€€€€€€ц{_n{~}}{rjhgcgosomlkltuma]Хвю€эю€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€юю€€€€€€€€€€€€€€€€€€€€€ю€€€ъюэьюэюю€€эюэ€€эюьъэю€ээ€ъююю€эю€юьщы€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€ыќЩИМЗВ|xusurkifa[WRSUSRQLKNPRTVSSRSTVUVUU]Й±√•\UЗіы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьєГ^L?3/*"  /B]}T($"#!!##%##""%&$%%##%" ! !!#"!.A?EMYn§ЇЛh``_ZVOG:9/ )) 2lgHJZepw{}yslgae[QJBK`fN60. CW\`hnwДКЛКЙМНТРЖБ~{zwuxyДЕМСУУУТСЪЪРСУТЛЖБ~{qoj^YaieaZVO>7CNpѓ¬ЊЧqjib^\YXVOLC6>TWQPNC=62.*"  '  %.1>DFQR5 &)/5>PV3 3Ж±ЛrbMD1(++%#=¬ь€€€€€€€€€€€€…utz{sliknkhihjjjnЌь€€€€€€€€я£§Ѓ±Ш~lcdebca_aa~с€€€€€€€€€€€€€€€€€€€€€€€€€€эЕ]kz|||ukfhebmrplkjlsulb_Чиэ€ъэ€€€€€€€€€€€€€€€ю€€€€€€€€ю€€€€€ю€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€юьщьэю€€ю€€эю€€€€ыьэыь€€€€уыюэьюююээъэ€эю€€€€€€€€€€€€€€€€€€юью€€€€€€€€€ю€юћЧЛМД{twvpqrkifc[VRSRRQPIILQTVVSTTSTTTVUUZИґЋ©aXКµщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№хю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЎФcMB91.+%!  1EbБT'##"  !!#!##$#$#$$%#%""#"!#" " /KMKOXk†єЙe]`]\TLB=8/    =n[AJYfu{АВzsmf`_YSHCKbdH2,, 0INS[aipu{zz~АЕЕzyvxyvvwzВДЛПЦЧЧЩЭ•†Ь†°ЭЪШХСЛГ}rjovsmf^WF8?MpЂњњФqjfd_[YWTRMB82/+(&   2Fe}P*%$!!    " $$$!"##%#"$%%##"!!   1CESSWkҐµЙd]^\YTOE>8-   @gR>J\kv}ДБzxre^[URJFNghC0*) "6>AOZ]_bjkinnrspnlosstuz~ДЗЗУЩЩЧЬ°Ґ£Ґ®©©І£°ЮЫЧТОЙА}ВВ}wqhP7AKp∞ЊљЦskea^[WVTUL@7N_ls{Д~wvn_[\TPOGOljA,'& &+/?LOPSY\\]addfaaejnnqxxЖЕНЦЪЫЬ°£І©®ѓѓђЂЂ™©§ҐЬЪФЛУЦТЙГz]@DKl™њЇФrkha^\YVVTKA77213566411*'&"  % (/8@DIPI" (+5?L\M' 7ПЄПubQC0" "3QЊь€€€€€€€€€€Нsv~xnklnjkhhfhkinя€€€€€€эƒ®¶іґЪzjhhc_^bacczж€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞`aty}{{ypjdfchssnihhpvl\_Ъ’ь€€€€€€€€€€ю€€€€€€€юю€€€ю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€эцэю€юыьюю€ююэ€€€юыюю€юьэююэю€€эьэюю€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€э€нљТЖБvtxxsrpkicb\YWWXUSMONKMQSQTVVVTTTUUVV\КЈЌѓeh®√щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эіНvfXK;1+($"  .D^xR+'$%" !!# "$#!$#&%#!#"%%!#"##!/?=ET^x•ѓГfa^\XVOC?:0   XZ=>P]hktzxrog\WWRMLEQkg<(%# #*74/+%'*,+//.++($# (,;?AJS@ +-8IR_G$XЂіДp]L9(  4~е€€€€€€€€€ЊytАzqkkjjighhiggiƒы€€€€€мЮЫ®Ј™НoeccdadecbcІц€€€€€€€€€€€€€€€€€€€€€€€€€€€€√b`ty|}~|qgegdhqqljiiovm]`Ъўы€€€ю€€€€€€эюю€€€€€€€€€€юю€€€€€€€€€€€€€юююэь€€€€€€€€€€€€€€ю€€€юэ€€€€ю€€ю€ээ€€эюь€юээь€э€ью€юыыююью€€€€ю€эю€€€€€€€€€€€€€€€€€€€хы€€€€€€€€€€тїПГ|uvwvqrmee`d_[WVURSSPNPOTUSVVUUSSSTWVV\МіЋ≤heЩЅщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъЏЫ{ocVJ<0)&%#! 0?]vQ-'%&#!!  !!!!"#$##$$%##$%$!"!"#!! !  2@@LQXv©∞Вccb[USPC=;-  3_R9=LW`bhjijid\SQNHDCRlc8&#!!&*0347<>@FBDGGMTTUY]afmsw|ГЖУЫ£ЂІІђ≤Ѓђђ™ЃЃ±∞•£®∞Ђ©•ЭФlCCNpђ¬µИmgfc`][VRKE@60-+-*,***+*))$&&  (-:>CLV@$+-;O\dC "zЇ•{iYG."  *Jћэ€€€€€€€‘{u}В~tijjfghigefjiЯц€€€э€”ЩШ™ЂШ~iabcccjfcag‘ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ќf^sy}}{riidcisrhgkjltpaaЮиэ€€€€€€€€€€€€эюю€€€€€€€€€€€€€€ю€€€€ю€€€юю€€э€€€€€€€ю€€€€€€эюэ€€€€юэю€€€ъююьююээшэюэыыээ€ыэ€€ъыюээ€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ъю€€€€€€€€€€пЄМВ~uvtpqrmbbca]ZXVVSSTSONOUUSTUUUSTSTUUU]ОЈ»™ebМЊш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ“ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь÷ЭАsi]RF9/,)$   .A]sQ-%#$#"!"  "!#%$"%$#%#$&$$!"" #"! "4B>HPUwЂ≤~bcaYTTOE<9+     FbH5=GPWXZ]\][YWNMIB>@Spa7%# !&)*-//2.045;ACCILPW]djmqwАКФЮ°•©™ЂЃѓЃ±±ґіѓ≠∞іµґЃ©•uDBLo∞√іЖlgfd_\ZXRIB=36669232..,*('!#!  (1;?HNT8 (/4FXhjC =ШїФwbQ@+ !8Єъ€€€€€€зВx~ГБwkfihgghgefjjpаю€с’№≤ПЦЯЪКsc_`ccadcc`Ин€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аq\nx}|{ytmieeisrkegjmtsheЮзю€€€ю€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ю€ю€ью€€€€€€€€€€€юьыьэ€ю€ю€€€э€ю€ээььэээюьююээъэыэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еµЛА{tsrnptphb`^ZXVVURQOSNMPUVTSTTTRSUUUWT\М≤√®geР¬щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—№ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€у≠Жvmi]RD70-(#  )B_sR,%$$" "" " %%##&&$'%$%%$$$"!"$"""3A@IPU}Ђ∞Гc`^ZUQOF?6(  N_?/9@HLLMQTSPOOHHF?=@Sk]4&$ "#%$$()-00256=DKPX`fkqxГКСШЭЯ§¶©≠ѓ≠±ґіі≥≥єЄµґѓxC?Ku≤¬≥Зljgc_][XSNE=4=HMMHCA=>;50-%!  )6O[gg9`±ѓДoZP8$!  *Блю€€€€щМx~ДВ{lfhkgghgdhjjiСЎяѓ{~ДННЖ{m``abcababc∆э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т{\jy|{{{umgddemrnhhjnsujdЬ№ь€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€ююью€ю€€юю€€€€€€эю€€€€ю€€€€эююю€€€€€юю€ээ€юююююэ€юэьъэьюыь€€эыьъыъы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ыЏѓИzuutsqstmif`_^ZWUUSONOOML]]VURRSTSTUSTV[Еђ√®ekЩ ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–Нvqjf[QD7-)%$!  %<\xS+%%%#! !"!  "!###%&%&('%&&''&%$$## !"2ADINR|Ѓ≥Иc]\ZXULC?8+   'WX6/59?CCDGLIHFF@@B>5Bdnkg_]^[UKC?6-&"     ")4<?@BCD@=;9=;9=QcZ3$#! #$%(,36>KRY_fmtx}|ЖЙРЧЫЯ°¶ђ±µ≥≤~GBMwі¬ѓЖmif_[\YVQME=7ItАwvusvsmc\SI@7/'!    #.8<>EPF '.08FTdZ/0ЮїЛr]N>("   %eд€€€€ќБ{АД|ohiiijhkgfhmolggikrx{БД~qgcabcceefbХр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эГ\ix~|tljfbbhpmihilrulg†÷ы€э€€€€€€€€€€€€€€€€€€€€€€ю€э€эюю€€€€€€юью€€юэю€€€€€€€€€€€юю€ю€€юъэ€юю€€€ъюью€эьююэююэю€ю€€ю€э€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€юээщў™Бxtqrrnllkgf_[XVUUTVSQMLMOQRSSSSSSRRTWUTZА±Ћ≠mrЫ≈ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞r]XRRUPF;1+$" +@[yU-&&$"$$#  #! !!#$$#"#&(&&'('$$&(###$!" "%$$&&  /GNTY_eklnpqyЕКНТФЩ°¶•¶xG@LyґЅ±Йlgea[ZXXRMJB8SДПЙДБГЖВ~ytl`VNE90,'!    $3==@GM?%-37DScS)E≤іГlZL8(! $Зс€€€ЁБ{АБsigijjgjgiprrqnhegotv{~zmc_]^_`debg∆ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЕZiv~Б~{umhfddjqmjihiptmg°№ь€€€€€€€€€€ю€€€€€€€€€€€€€€ю€€€€€€€ю€э€€ьюю€€€€€€€€€€€€€€€€€€ю€€€ыю€эюю€€юэю€€€€юю€€эъью€€юю€€ю€€€€€€€€€€€эю€€€€€€€€€€€€€€€€юэ€€€€€€€€€ьэ€аІАyqopstofgfg`\WUTUTTTTPOONNQQRURTTSTTXUSXі–іquЭ÷ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зЪiYUOHFLF9/,&#  0I\tT/'&#""#  ! !"#$#""#%%&%'&&%&&&$%$"$"!"$%.<>3#1=?HRWАЂ±Дa\[XUSLB<4,   7$%-& \_:*,/466;?B@?<0B2'),+8TjV/"# $*.5?CKSX^abadkswzВИМРЧФjC>K|ґ√±Иnhfb]ZXUQOIA:YОЯЮЧЦХРЛЗБ|{tlf]UJA8/&$#      &6>=CJO: $,59ET_G!^ЇҐzeWG1%  'Ях€€оГy}ГВrhigihjkjoruuvwqjinqswxwka[\\\\`b_}и€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЛYgv|А}{voidadlqmkjikptmgЭз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€ююэ€€€€€€€ююю€€€€ю€€€€€€€€€€юэью€эьэ€€€ююю€€ыщююю€ьэ€€эю€€€€€€€€€€ээю€€€€€€€€€€€€€€€€ю€€€€€€€€€ююъ’†|tqommmkjgb]]\WTWVSPQOLOMMNRSUTSSTTVUUVUVБЈ…¶mwҐею€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≥y_URPF9[Ф™ЂІ•§ҐЮЩТКИГ}vojc\PF=4,&!$*+'!   (7=?GNT5 ",6:_Ыѓ∞±Ѓ∞ѓ≠Ђ¶ЯЬЧОГ}wtoe`YND9306::2+%#   !,8:=FST/&,57240(#$  -G^Д_/&%# !!"! !"  $#$$%##%''%&%&&&$# !"$%0JhdA*1@@CLU}™µИeaYVUSL?60* PhS<36:?ISXY^`_WB4*$"""/WtZ0""    "%*+149AOY]\\_aK:>J}¬«ЄЗkgea_\XTRLG>:`Ь∞µµЈЄЄЄєіђЂ©°ЪСЙБ}voh`ZSLHLLIC<3+#  $&,69BGQL&),7?LY]4N©®БjZJ3!  #МфхАrzАД{pgiprsqv{~{|z{wtqokgeffb^[XWY\[Аж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€РWfvz}~|ypcdgeionjjijospjЯжю€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€юэ€ьэ€€€€€€€€€€€€€€€€эщъю€ююэ€ээююэ€юыыюэьыь€э€юэюэю€€эээ€€эю€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€э€ю€э“Яwvrpngded`a^[XUUQQOLLKOKKQSRPQTUSUTVVWTZГЃ»ЬmА©у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шІhXULC?=;62-.)#$  *B\Z0&$!!!!!!"   !!"#%%''$$&&&#%%''%#"##$%&+?EMV|™ґКc]ZVVUL?6.(  )Z`QFDCDLSXZ\`b^UD?:500/<\pU-#"  "#&#%)% "#%''-1=GPVYYWD:?I~Ѕ µЗlgb^^^XURLF?9^ЧЃµ≥µєљљЉїЈµ±ѓЂ•ЯШТЙБxoifb`^]XURH;/(# %!! 00'2;;9752.)($!  *B]xV/%%$##! &#""#$$"$'('$$'&%$$%(&&%""$$#$(/AF7,2==FPW}®≥Нd[XUWQF?80&    3UWXYW\it{}vrj`UF79><9>?F`uV,"$"  %,-)*('*+("  3E>51.++/9@ILL>5>J~ї∆±Гlgda]\YVQJD@8]С£™ђ≠±ґЇїїЉєєЄґ∞≠Ђ¶ЯШСЛГ{uwtljfa\TH>5-+'"%($$$*=3)4;=DKQD %+2IS_L";ЩїИp^J+  !AQaxАГВwqpry~ВДГ~xpfbcbaba_`^^`]XUUU\…э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€†]fv|}|}wmkefhiqoiijkospjЬгю€€€€€€€ю€€€€ыэ€€€€€€€€€€€€€€€€€€€€ю€€€юью€€€ю€€€ю€€€ю€€€€юьюю€€€эьюэьюэююю€юээю€ююьэюъэьэюьэюююээ€€€€эю€€€€юю€€€€€€€€€€€€€€€€€€€€€€€юююф∆Тypkgehhea_]\ZWSSOLRQOMNPQJPSRSSRURTTRTTQ\И±≈•yЙ∞у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бС\QH@>:;920,*&$$! #9Mrc3%$$"! !#$%$#$'&&$&&#$'%'$$"#$$#"$%! .:=DOXw£≥СfZXVWUH?;6.   0FMRer{®”ЁЁџЏ’ќЦP655((,03MkuP*$! #&)+,)'')+,+)(%$$!  0QZ[^]^OGD;85./5?JАЉ«іВheea^YVTPIE;8SxЗМОСУЩЬ§®Ђѓ±ґЈЈґ≤∞ѓ≠ѓђЂІ¶ҐЯЫФПЙxqlgb_VOJHGB:7830+'%$&$)+*-:KK1,5:EJP3'),3;@GTX2$pї•wcQ6 "<\ЛМЖ~xx~АЛНД|tja_`_^``]^[\]\^^^\VOxз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€°Yau~БВБypiijjmtsllkkptplЯбь€€€€€€юю€€€€€€€€€эю€€€€€€€€€€€€€€€ыю€юью€€€ьь€€€ьэ€€€€€€€€€€э€ю€€юэю€ээ€юьъю€€€€ээъэююъь€€ьыыьюю€ю€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€уƒНpkjgfije_]]ZXVSSQOMMNNQTOJNPQRSTUPPSUVUU\Йµƒ•~Оµу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъоы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€нЭ^ME@;;<93/-)(&!!7Jn`6'%%"!!$  ! """!"#%'('&%&&&&')'%%#$#""#"! !!  ! 3<=FPXyҐ≥ТfZYYVQID?5*  #$=V\XZhsЕє№дгдввё≠hLJJEF?41PpvH("&%" #')&'(&%#   %5:;:3/0,)$ 5Hl`6'%% ! !!! ! !#$%#%'%&(%%%&'(%'%"!%&$#" " ! 29@FNW©ґНf]\YWOGB91+  !''%'8MTTZdj|Ѓ÷№адгба≤jNJINRI90PnpD)$%&&&(+(!$$"   #,369:=@@DGE<;92:JЗњ…≠|hge_^\WURHA<8EKOVZ`gjnstsy~БЖМОРОНРХЬЯҐ£©™©©ЂЃЃѓђ≠ђ®Ґ†ЯЮЫЪЧПЕ}ytrhbdb^XSQUVZH/18<@GOJ "5,-6=DJWP$>ЪїПkZC +MoЛФФПИГВЕЙНМЕ|ma]\\[XUSOJDBINPWZ[^^XВи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µadДЩШКГАtnlllnrqlijknvsnЮяь€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€эь€€€шщььэ€ьъэ€юючь€€ыю€€эьэю€юьюээ€юэюьюючщю€эээьэ€юю€€€€€€юэээ€€€€€€€€€€€€€€€€€€€ю€€€€юь€нљИpkjhec`^^[XWVUTSQPLHJMNMNKKPSUURTTRRSUTS_Сґ ™АТїф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€ьп°[DEA<=9670/1/( 3Ef^4%%$ !  #''#%'%&(&$%&&&&'#!#$"#"#!"#" ! 0:@FOYx¶ЄХh\\\YPH@51/ +*&%%(')4HUVY^du†∆“№ёў„ЎЂlRMJMQH02Tgb@,+,-0///'  "+2367777::61511?LЖљ»Ѓigd^\[YXQJD;7<89@HNTX\bbdimqw{}}xz}~ВЙРХЫЮЭ†§©™≠Ѓ≥і∞≠ђђ™®І©¶ЯШТЛКИАxurog\Z^_G14<>@FPF -7--6=FNZO'S™іЗhV9".InПЮ£ШМЗКСУСЗВuf]]ZWVSLC6/*+39>BFOVZ]£ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ђ^iЦ©ЦИЗВxqnmjlsrkiilnrqm°ию€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€юю€€€€€цъюэ€ьью€юьэююю€€юю€эь€ююььюююыьюююююэю€ээээь€эю€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€эю€чЅЕolmjeb`a\XTUVSQSSMKMPNMOOMMORSRSSTRSSSRP`ФєЋІБТЇу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъры€€€€€€€€€€€€€€€€€ю€€«xH@?=<8973...+("0Fg_4%#"!  "&&%&('(&%&'%&'%%!"&"" ! !"!    09@HPZy•їТf[]]XSKC:3+  H\UI?430/:Pems|ЗЩЄ—џаа№џўґЙpaZWVH4AW_R<22233.+#     &-44211//0/-+**0?NЙљ«Ѓ~igc^\[XTOLE;84+*+27=ADLRVX]ceglmhhjlou|БЕЙКОФЪ†£ІђЃ∞≤∞∞∞≠©©Ђ™©ІЯ°©ҐЧТОНyecieD/39<>CRC$;7*+19HR]G-jі•z`P+ +1OtЩµјІРСЭ®£ТВwk_\[XTMC9.%#&/40333;DSc™ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€©dsђЅ≠ЭПЕ}toqnlsrnlikotrnЯл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€ю€€€эю€€€€€€ьью€эьюээюэ€ю€€€юэюэю€юэээыъыыю€€€ю€€€€ююьюэю€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€ю€€рїДrokifccc^YWWUTTSQNJLPOOLNOOSRSTUTSTVTUUS_Н≥ ІЕШљу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€ш±\;?@;78;71--0*&# 0Ih]4&#" !"  !#%$%&%$$'(&'&%%&#%%#$$" ""! !!  "0:?HPX|©ЄПf\]]YTLC=7+ Rloqmb[NHHQb{С©ї…„яджизжб“ґЭЕq]PEIQUYM?60+*#!    !  !',020...-,-)%&%,@EIOSTX[YWZ]`diloqryБКРУЧЮ§™ЂЂ∞ѓ≠Ђ®©©™®≠µ±≠ЃЃ§ГsrrfA-183ДєЦq\H$(1:VА±Ќ»ЂЮђљЇ©С~rg`[XUK8)**%$&*+(*,/16F_Мƒмш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЈtБє‘Ќї•САtqsrqstqmllnsonЯз€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьььюэ€эыээю€ээю€юю€эыью€ььыю€ююю€€ююээюэью€€юэю€€ю€€€€€€ю€€юю€€€€€€€€€€€€€€€€€ээ€рЈВrmjggfca]YWVVUUPOLIHMRSPRPNTTRTUTRUVUUTT^К∞»™ЗЪЅф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€Ќ}E;?>;76983.+-(&# /IeZ3%%# ' ! "$%%&%$)'&&&&%$%$$%##""!"""  ! /:@FOV|ђґПh`_\ZWJA@7) @[dku~~urld_iyОІЉ»Ќ“„Ў÷’ѕ¬∞Ш}cH90$ *(   "!"  ! !$(./010..,,+'$%'0:IКњ∆•vhhe_[ZYTPMF>75' !!$*+18;>@AHNIKNRUY]_`ckllqv{БЗОХЩЬ§®Ђ¶Я°£•®Ђ±ѓ™∞Є£Д}|xe=,/6C>;72352/-+(%$ +Bd]6%""!!&"$$&%&0+''''&%#%$#$$##!#%$"#""#!! !1;AIOU|ѓЈОjdb]ZUND<6) 3MV[fsyw~ЕД{uppПЯ™ЈјњЉєі£Кq\L?9=EJOK<,"%+-8/   !"#&%#$'&%$#"#  ! ! !#$&&'*,../0/--+)&)$$-;LМ√∆¶zhgd_]ZYURJB;63$!%))+./6<98<@FHOQSX^_^^chlouy~ДЛТЩХСШЯ§І©®©®©ђХ~x{{b8(.7:AJR=GO3)-3=JVZ5R•±ГiW=   /DBMlЬјЎЎ‘–Ћ√іЦ{nf^[YM;+*/>@70)!! "&')9QpЖЙЮі»ёлтшю€€€€€€€€€€€€€€€€€€€€€€€≈ДВ©ЋѕЉ∞£Йurqrrwtmlnnossm†ею€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€€€€юэю€€€юьюююю€эю€эью€€эюэьъэ€€€€эщщьью€ю€ююэюю€€€€€юьэ€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€еђyhjgefge^XZYWUSQRMKOMKKNOKJNSTTTSTUUSRSUTbПї–ђКЭќш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№ИG6<=:623///-*+.($!)?da=("#"!"!  !%%%'&)*))))%%%%%#$&$"!$%$""" "#!"08>IOU}ђіКkhc]\VPF=4* -EW^[_dgmvАЕВДЙЛМТЪ©µЉЇєЈІГfWOJEDFA;2'#&# %)-,/>1  ! !"#$%&&&&)((%#%($ " ! %&&'')+((-+,/.-0430-++('*%%-8MКљ¬©|gdca][YVRJ@;6/#"$'*+*+/449?DGINOOQTX]`bflpv}АБЙХЯ°£Ґ§¶ІЯЛ~xyz\4).7;DMUDSM1-06>KYW;hѓҐxfU3  ''#  $CLLYxЮЇ—„Ў–ЄѓђПtha\ZVD3/5DdqeaU5" !#&+GMVГЃґЛgcb^[VQG>5,    ,DYc\VX\_bjutzИЖЕИКУЮЂЃєЉ•dVOJB:2,+%&,1'),*-*1F4!!!!"##%&'&'(&(++)(&&''$####"#$&+,,,,,0-110430/0653/,,+()((/9LКЈЊ£ziid`_ZYXRIA;1*   $'(),247<<==?DGIMRW[`finwАЛСФЧЫЯЯУЕАБ{uU2*29=ALSIZH.069>KZQ?yґЪtcO* (<0(363,&  .CSQS`ЕҐµƒ ‘…≠©°Бka[\ZO=4?O]ЕЫК|xW4"#$)N}ННОРОКЛЛК†Ѓµњ»ярцю€€€€€€€€€€€€€зФzНШШШОУЫП}usttwsljjjnsqmЯзюэю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€ю€€€ю€€€€€€€€€эю€€€ю€ю€€эю€юьюэ€щъююю€€ьэьь€€ью€эю€€€€эээ€эь€эыьэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эяЂohcbc`]\[\YVUTSRNKMLLKLLJLPSVVVURRSSTUTRjЬљ√ЮЗЮд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аОJ658:830/0-+*)+/+$!,Adk@''&!!#"#%&'('&(&$'&&&$%#%%%"!" "'"!$ !"#2<@HN[ИѓЄМecc]\WNC?;.  /CPXWWXZ[\`dehlmoux}ВЛРІіЯБgP@72-%.6,.//*--(**5B3  """#$%%'((()+*+.-+()+,)(&&&&&)*+,,.02542554889989<;4161--,*0BGLQSYdjrzЕЛТСИА~БwrN-+5;IM\О∞ЄЛd`a_\WQC<9,   0CKRVWXZ^```__a_`cglrt}ЪђЯИhD0-:=2BB2/++++*+,-./&   #$%&$%(+++-,-.-,+*),+&&&&(**./-.0115:;::;=;<>>>=>88:<510.,0;MЕє√¶ygffa][XTSKC:1'   !""#&*)+,046:>DPY_cgou{А}y{upoG(*5:?GRMRaD-27>DO[IRЩ≤ЗlaD E[EJagc[QD70,' 0NSWiВФЮЯЮ•єїЄ©Гi`^[Q=4=_zht¶ґ†ХЙm9$)Ggu|БВВЖККМОЛЛООМЛЛЧ™є√≈Џксц€€эвЧyДЗЕВywЕПИ|vwspwvmjjiowpm°ёъ€€€€€€€юэ€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€ю€ю€€€юэю€эю€ыь€ю€€ээю€э€ьээыьыэюэю€ээююэ€юьюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьщэЁ¶whhd_\^[YZYYVURMLNNNLKMLKHEKTUUTUVSQQQQSSeС±ЇЧЗ£е€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юзЫO468632/**-,*''*-(&& (AdhB*&$ !! ! !$#$')(()(')((**060(&!"""$%%#" !" !"! !/8<>@>???@>???>@>8651-09LЙЉЅ°xfcd`\YXUOGD=/"     "%'*.2:DLPTY_eptuwnqnA(+2:BIRLYcA,07@IU[HbІІ{ia?".^_Nb|ui_XJ>3/' AQRbwДЛСШЩЬ∞µіЩud_ZTE97LА}O[СЭЩЃЯn6 0K_jpoptz~~|y}~|||АБЕДБТЯ®±їЉЇҐЗГЖЗВ{tsАФП|uw{zznklkowpkЯдэ€€ю€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€ю€€€€€€юю€€€€ююэьэ€эю€эь€ьюю€ээю€юыэю€€€€€€€€€ююэыю€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыьюа•wihe`^[YWY[XSPQONLLONJNPIFFKSUUVUSSRSSTTTfТ≥їЪДҐж€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЅyC47751-++++,+*''*.)$ %=df>*(&" !#"#$&&'(%%)'(/:NTC. "!$&$#""!! !"#49FNSXZ\^_acaaaa`_^_bhmsБЖz[B9:>51:72+),,)'&%" "%&'&'''+++))(),+*),*(****)*'')+,,-.2259<==810;KБЉƒШsfcba^YWSNHA:2'     !"',/6<@CKVhqvunum=)/38?IRQd`;+2:ELWZJpѓЭui]8%:Src\zТОБxrf\RD8/*$ 6OYapw}ЕИМУЫ≠Ѓ•Йob]XN?9?oРa4*(&#  !!"$%'''&&''()3FrЕ_3 "#$$%#"!! !! ! 4<=DIWДЃіЖd`a]ZTIB=5+  $4A@DHGFGHFIJDGIIHGGEEA?;00;LИњ≈Ъsgca`][XSRKB7.%          !&,.26Ifrvniwi7'039=ITXm^5+59BMYVQБ≠Уth[- $]{gmТ§ЫОЕ|qh^XMGFFGKR]cfosswАЕЖКЦ©ѓЪyibZQB=C\ЦГB*9TuЖНЕX& 4JW]_cefgilnmkkllllmmmnpqrssrwxvwxupjirГЛКwwwwxtnljgnumiЯдю€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€юэюьььью€€ю€юююью€юю€юыь€€юыыэюююю€ююэю€€юэ€юю€ээю€€€€ьь€€€€€€€€€€€€€€€€€€€€€€ъэъЎЮtcba\XVVUTWVVUONMLLLJMQSQLKOQRTUTSRSTUQSReЬЅ ЂХ™м€€€€€€€€€€€€€€€€€€€€€€€€€эць€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ |L;2252//-*)''(*(%('#%$ $8]d?*&%"  !" "$$&)'$')'(*2GnД_5!##!"#!!"!#!"#$6;>EJYДЂ∞Гfcd_[THC=3*  #().4;?HNSY\^^`acdfe`^ekiiovzkI8773/-.-+''%%$!!!"$$$$$$%&''()('''*)(')(((((*-+))++)(+-+-/268::@EAGJHIKLMOQKJNNLJKJIEC@1.9LЙї¬Ыreaaa][XTSK@4,&!      "#$$Aiwtfewd4'.4GMZЖ¶Ґebb]XSKB:3)   !&($'+-4ELORX[aefjlojfgnwxlK731/-(()++))'('&&&)('$%#$&('&%&&''$&)&%''(*+*))'''&)+*+-/38=@CGLQPNPTTRTUTTSSSUUSRQPNMJ82IPVQfЮЯzh`ZE:9;BMW\bghimooqrqooonnqpmnqpqqpprvzБКђ≈£sg\QDQ_Д±ЕB..02FVL;45:62..)# %43*9IPW[\[__^`aabb``_aa^_`___`defeadeedixМЭЦВxtty{ummmmqunkЮвю€ю€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€эю€€€€ыыэ€€€юююэюююыь€€эьэююэюьэ€€юэььээю€€€€€€€эыэ€€€юю€€€€€€€€€€€€€€€ю€ш„Яn^\ZWXXWWUSSTQQSRPMMKKJKMMJJPSSTSTSUTSTTTdЩ≈ЌђШ∞з€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шіb<40/1220,,*')('$$'&#%'$  "5ViF('%!! !!!"%#$(''''&&%&)-6=9/!#$ $'$# "!!##$!#1:?GM]К©ЂБb^^]ZSJC<2% !!!!&'&'')-.,/59;>>?CKRVW^fiddhowwjL2+,,-..1/,-,)+)&&&$'(%%%&'&$%%#"#$#%&%%'((**'()&$$)+)++146L^G*4FNVYZ[]__`a^adcb^aa^b`^]^^ccbc_bc_`hvЕПЛ~yyyyxrpmkmrvplЮд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€юэ€€ьэю€€€€€€ээээ€€юьью€ююэьээ€€ээююэю€€э€€€€юэ€эюыъю€€€€€€€юэъь€ю€эь€€€€€€€€€€€€€€€юэи—Яo_\YVWWXWUUUSPPNLMJLMKJJKLJIORRRTTSRSTUTRdЫ≈ќђХ∞о€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЋ}F4.,./-/.++)&('%"#'&%*+#   1ZrI(##!  !"$$$'''(&''&&*+)&&$&%##$#$#$" !!##!%2:AFK`Н≠•|b_^^[TKB<4'   %%#&&)+**+-.-14687779?BDHOVZ\ajqqcI3...1334/,,,*+('('%'&&&&''$&&&#$%$%#"&('''()&((&$%(**..58;BHMNPSWYWY\]^^\][ZYXYYVTRQQQM83;MДЉњУndeb^\YVTPKB6.-..-.-*)&&&#!  QuiYWl|Q+*.09ENTowG-4:?DPWT|•ПocZXVWVTTY^_cfhkluwqpqppppsrmnsutrqpqpryБРііКvndYJTmПƒЈoIJHDA=AT`bdb]`fgg``pueI25EMRVY[\\^`a``adb]^_^_]\\_aba`cdc_\^juВЛЗ{vvwxwnkkkmsvmk°бы€€юю€€€ю€€€€€€€€€€€€€€€€€ю€€юэ€€€€€€€€€€€€€€€€ююээ€€€€€€€эю€юю€€ьэ€€эю€€ььыэ€ээ€€юююьэ€€ю€€ю€ьы€€€ээ€€ю€€€ююююыююыэъыью€€€€€€€€€€€€€ьыт÷Ъl_[YWUTUSQRSSQOKLKHKOPQPNOJNSRRQQTQQSTVURbЪ≈ќЂХ∞н€эью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эх≥]4,,.00,,,**('&'%%$#%%**!  2ZrI("#"  "###$'((&$'*'&')%$##$%$#%$$#"##!! ###$19BJMeХ±≠Гc^]\XSJA<5'    !%&%&(+,-/+-/134434744;;::>BCHNZccU@5220//0/.,**))'%&%''&%&&$&&##'&%&'%$$%'(&')*))*(()'*-.16<@DMPRVY]\[]__```a^____]\YWUW[X?08OЙЊЅХmdge`\ZXVQND4--22/..,+)'%'%%&" "]s^QXr|M)*/38EOVsuD+2:AHOQUЖ•Зlb[ZXXYYXY_`chiklmnpqtrqssttqrttssspoorw~О∞¶БsiaSG]~©ѕ•hVXWVPL[onflqpqsqnjp{zocPBFMRUY[\]^_a`^`b`]]^`]\\[^caabadc_^ajvВЖГywxyzwmiljlrukjЮёы€€€€€€€ю€€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€юэ€€€юю€€€€ью€€€€€ээюээю€€€€€€€ээ€эю€€€эюю€ююэююю€€ю€€ююээээьэ€€ю€ьььчъэю€€€€€€€€€€€€€ыю€ЏШk^^[XVTSRRNORRROMIHJLORPRPLPSTTRRSRSSQTURbЩ≈ќђХ±о€ышэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бЙC+(,100.-,,*((&&&%&%$"%*%  0UqK&$$!!  !%$#$&('&$&*+&$')'&&''%%%&&&$%&$!"! #&%3;BNPeФ∞ЃЕa[[YXQJB<5)  ! !""#%%(,,,--,,034740262399678:79=DLNF8110.-,+***('%$$###$##"""!#######%&&%%%&'%%)+)(()*))+-/39>AIQTVZ]_aaaaaa``bbaabc_`a_^_c`D3:PЛЅљУneeb_]XWUOJB6+-6630-+*,*'(&&&&##!  3gkWQ\x{G%(-29EOZxm<+39AHNNYНҐБj`ZZWXYZZ[_bcgknmlmqqrusrtuwvvwwssqooosy~Ф≤Ю}rg]MOlЗєЋУd_cgeaezД|wБОФСЙВА}}vy~t^OPSUXZ\[_`^^_a_^^`__^]]]_aadeda__ddi|ЧШЖvwyx}|qkjjmssgfЪёю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эью€ю€€€€€€юююьью€ю€€€ю€€€€€€€юэююэюю€€€ьээююээ€€ьыээыэью€€€эььъчъэю€€€€€€€€€€€€€ю€ш÷Шla`]YWUTTROOQRQNNJHLKKOPMJJORTSSUUSSRQRRRgЬƒЌѓШ≤н€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЊ]3*)-32.,+++'%&%'%$%%#!"**! -TxP'$#!" ""!$$!#&&%%&()($$&''''&'$#$'&%%"1." "#$#%1DNUXZ]^`dfdcefdeffedcdbbeccffaE4GM]zd6-6;@GPPaХЯ|kaYYWVVY[]`defilmlmmnqpqqtwxwwvvurqrqquxЕ£≤УwmcXK\xТƒЊАdfmuvtДЧЦРС†іїґ™®®ЯМzt|ИЛ{`PPRVYZ[]^^`a`]\^`_]]]]^^^acbc`_adfmВ†•Р}wvv}~qiklnqsfdЭЎч€€ью€ю€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэюэыь€эъю€юью€юю€ююэыэююэ€€€€ьэыъьэ€эюэью€эээю€€эююьъьыь€€€€€€€€€€€€€€ы€ч‘Шla]ZXUURRSRRPNOMLMKKNMONKFHPSSTUUSSSSSQROn¶ƒ…∞Ь≤л€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€нУB+*+-//+((*($$%$$$"!" !&&#  ,TxQ(" !# ##$#"#&$#$'(((''&%&%%'&$#&'%$#!/3&"$$$!#.7AGLbО©ЂЕ`ZYYWRH@=7)  "$%%&')+,-///2257547753035267426769==863,+*)*+*(('''%%#$#!!  "!!!!##"""$%%%(,(%)**+*')-./37;?ISVZ]_``afiijjhiiihfefigfhfbb]A2;PЛјЊУofhf`\YVSMHD7+,7<:74013/-+(((''%#  Mm\NTbАu=%*1:@GK_|`409?ENQv®Ъte\TSTTUX[\`dfffgijlmllmqqoqstvwwuuurpqs~Уђ≠Жmh`RDXvЭ»•neggjwЛ¶і≥≥ѓ®Ѓї ÷џ’∞Гpmq{В}pZOSW[[\^^\\^^_]]^^^^```_^_eheca`cjsyЖРИА}xw~ymkkjpzwefЮ„фюьэ€€€€€€€€юю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€ююю€эыэююэююэююьююьюыыююээээээююышьььъь€ььэээюээыэ€€€ююю€€€€€€€€€€щююЎФgZYYVSSUUSQRNIGKQOMKJLNKGIILQRSUTQRSRSTQPkЫЉЅ•Ьєо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€нЪD+,,-/-,,*)''&$$$"! !!!#$'(&  )QnK'" ! "%&$&&#$&)+)())'&&''&$$$"#$!#($! !!!#/5>IMaН™ђЕ_XWVVUNB<9.# ""#'&&)*-0//033212220135478879;=<:87668952--,++*)())(&&%$$""#!!  !! ""#%()'%&)*)(()**+,/1///37=60/11.,,*'''$$$"    '[cNJVjИq7%+05>HOi|S-09>?DKTБЃЧrfXQSSTWWY]bddcdehjkjjkjjmptvwvtsutqprrwВЦ≠•~ie_M?XsЯљХmfhcczНОФЯ°ЪУШ©√џяјУwkjprppn^OQUXY\]^\\^^__^]]^]_```_bfgfc`ccfrАОТЗ~}z|wmhjhp}ydcЪ№ъ€юю€€юю€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€эью€€юю€€€эчфьъь€ю€€€юю€€€ю€юэьь€€эыэ€€эъъьыщэюэьэ€€€юэььььэ€юю€€€€€€€€€€ю€щ„Щj[VUUUVUTTSSRNIKMOPOJNOLHGHKPRSSSRPSRSSPOmЫЄљ§ШЇп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э√j4(*,--.-+**&%&##%%" ""! $)%  -OiK(#$!%&%%$%&')*('((('%%&&###"%& #! !!""$-2>JMaЛІ©Г`ZXWWTK?84,#$&('&*,./003640134424326:999:;<<==;999532--,-,)*)*)&%%%%# ""! !!!!!""$%'''&&()*)*,,-,.95/00356=DNUX[^bhjlmllmnnpqnlkhdefdb`_XA4;J}їЊСmeec_\YVPQK=3(,9>>=86520.-,-*'&%%$!    CKl|O,15:?FMXЛѓРpdWSTSUUUV[`bcbcgijjhjlkmmnqsttpprrpnqtxВХ§Чwe_YG=UqЫѓМohd`nЖНИЦЂ•НЖОЫґ——ІАqggmmjkoaQQUVX[[\\]]]__]__\]^]aa^bebccaa`euЕЧШЙБГ}wlhjkqwtbdЭџъ€эю€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€юю€€€€€ээю€ю€€€€€эью€€юю€€€€€юю€ю€ю€ээьэюю€€€€ээюьэъыэьюю€юэюэьььэьыэ€€€€€€юю€€€€ээмѕЩgYVUXYYSNQRRQNKHILNOLLJJJHFLRRRRRPOQSTQQQq£єљІЪƒц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жШG)'),-++.*'''(%$&%&$  #&$  -NjL("%"  ""#$##$&'('%&'&''&$$#!!!$#!$$! !! %/6>JOcПђЂД`ZYUUUL=62+! $'*+*+-/00255322343123468;98:<;<=>>;:;521.,,,,**)*,(&&&$"! ##! "  "###$&&'&&'*+**-.,+,0/01/37:>EPTXZ]`dijjihhghkliiifbdeb``_V?59:;850..,++)('%# !  HhV@FVnГ^.(,2;BFLozI+18=@HM^У≠КncXSSTUSVZ]_`bdfgggfhjjjkmlnpoppomnqpptzВПЩКm`]W@=WnЦ†Бpi^[sОУЩ∞∆«ЊњњљљЊЈХvjefikkmsgTQSVWZZ\]\[[^^]`^]_````_`dbac`_ajxЗЮЭКВА}ГЙymkkntvpa`Ьящьэ€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€юю€€€€юэ€€€€юююю€€юю€юю€€€€юююююэььээььээююююэыьыыыь€€юээюьыыьььээ€€€€€€эю€€€€ыжЏѕШeYVUVXVRPOOQRPLHJJJMKMLHFFGLQPOOPPOORSPQRo§њ≈ђЭ∆х€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћg1)*+--+())''(%#$&$"! !" "#$#" +RnK(""!  "#!"##%$$&'(&''&%%&$$#! """$$#  "%.6>IMcУЃѓИa\ZTSRK=31)""%')+,-/15987:736745411476669::;===><:96520.+***)((*)(&%$##!""! "! !""!"$((('&))(+-,*+-...0139<)2;@CJPhЮЂГj_URSUTTX\_abccdhhfjjdejjhhkmnkmnjinqrv|ГКУЖl^ZS9;TfЕЕmc]TPczЖЯ»ў‘Ўаая№‘ЉНlgghhlosylVPSUVX[\]][\___`^]_``_```dcbaadfl{Т§°ОБ~ВЙКzmllmtxp^\Чдюь€€€€ээ€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€ьщю€€€эю€ээю€€юээююэььэььюьщъьююю€эюэыььэээ€эьюэыъъэю€€€€€€€ю€€€€€эзџќЦfXUTTVUQRQLKOPLJJFGKJJIGEDBJQQPONNOOQPQSSk£……¶Эїм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф†D((+.+)*)&'('&$""#$"! ! "$%$" +SrN)#"!!!"""$$$#%''&''&%'&$#&$! """""  $/7>FLeСЂѓЗ`[YVTPI=53)!##&(*+,12139988997674452464138;999:;;;;75520.***)**('*)&%%$$$#"" !$$"#$!"#!$&'''%$()*,,---./00168:=>>@FHJPTUVVVZ]\\[\]]]__^^_`]Y[V<04*/=BA>=:7554/.-+)('$"!"     -Z^C8@Onp=")-1:FLZwh6)2:>DJQq°°{`USSSSSVY\^^^`adiihjjhgiiigijjkjkkilprv{ЖОГj[VR;:NazrYTQC8FKdТѓ∞ИaZYUPLD<83' "$"%(),00132454557;9995254442017:8877879:764//-++++,+***'''%#%&$$" ###"#%#%%#%&'%&&$()+.++-,...1248;;=>96654.,-,*'%%$    8aX95BOmh7!(-3>GKZwb4,5:AAFGFJNMKPSSSUTUWWVWVVWWXYP:2;LАї≈Ъnb`_]XWWSME>4)/?ECB@;9:420..,*(&&&!   HeO59DSpc1!*.4@HK^w_3,7;=DKT~™ЩucUOQRSSTW[]`aabehkiijiiigfgffklhijikorsw~ГЖ|gXUM40BSfW>:<70:\w{|ЗРХ†≠ƒ№џµЖqmnpljptviUQTTUYZWY[[[]]]][[]]]^^]Z[]__cegsЗЬђ£РДЕУКqlnprvxnXWХе€€€€ээ€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€юэ€€€€€€€€€ээ€€ъщюэю€€ээюэююььээюьъььъьююэьээьью€ю€€€€€€€€€€€€€€€ы€ч“ФdWVTSRQPONONMLGEHLKHHGHFFDDIPTRRQPRQQSSSQi§ќћ™Юєй€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эќo=**-*)+(()'%$%##%! $!  &)$!&$ (NmU-!"  "#&')%!"&'&$$&%$$$%'# ! +6>IMcСЃЂГa]XTPJB;72(  #$$%',/,04332022251/010...//-./11357534356631/-,*))*,*'&&&%&$#%%%%$$$#%"!##"$%&&'&$')((*)*,.-.321248>?AEFGIHHNPMOQQSTUURPSTUUVL72=MВЊ…Юoba^\YXVSOF>3)2>CD@>=;;72/...+(%""!     UgG07ATq\+ ),3AIIawV.-5:>EMXГ™УqaUNOQSTTV[^abcadjjhijijjgeghghhhjijklptw|ДЖzeZYN4.:M^N845417Rktwywt|К©–Ў≤ДqonmnnqvtaQQQQSWZXWXZ\\\]]]\\\][XSOLNT[`chtЗЭ≤∞ЪЛДИСДpnnmu}zjVUРб€€юю€€€€€юю€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юю€€€€€юэюююююю€€эьэюьэюэ€юыьюэю€€эю€эыьэ€ю€юээьыьыыэ€€€€€€€€€€€€€€€€€х–ФeWTQRSPNSPJLPPJGJMOMHGGGHFFKQRSQMPQPQRTTPi§Ќ ™Ьєм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иЯW2(++'+)&((&%%$ !#!"!!#$$$$'* (LlZ1!!  &3<5( "%%&&$$%##$$%#!"! *5=HLeС∞∞Е`[WSPG=;91% "$$&'+./.0310./00321///,-/00.-/111378324333431/++,+++**(&'%$$$$%'%####"%" $$#$$$$$''&')+,,++,,.233149===>BDCCGHEHHJMONNPPQQPQRSTTI51,*,+(&%'&'%### !" !"!! #'$&(++ &Hq_0"#!!! !",UqT0!!%&%%%$! $&%#! (5??ADEEDEGKMKKMLLMMPQPRTSJ81:KЇ≈Ыpbaa^XWUSNG?4*1ADCDA<998410/.,(((%"    :^X8*39QnP#!)/3:AFasM-18;>GObТ®Кo`RORSRSX[^```cffhljfgifdggfhgfggghjlmpuxyБВud[YL1'/DXH1..131=R\`debm{К°®Тxopqtwz|wl\RRSSVWWY[ZXVPNONJD=93*# '7FT^ffgvТ™•ЫЧНИС†НplmoszweQNМ№ы€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юю€€€€€€€€€€€€€€ьэ€ыь€€юю€юььюээюююыщшщщыэъы€юыью€€эээъыюэььэ€€юэю€€€€€€€€€€€€€€€ъьш’УdXVUSQRTSONMNMJKLMKFGIKIGGFKRSRSSPORRQRQQlІЌћ®ШЈк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щЄ_4+,-,(&&&'%#"##! ! !!""  #%''',-(  #Gtb1#$  ""-_Бd5!#"$%%$"!$$#  &2;FIeЩµЃВ]XVURG<994% ##%')+,.,*./.1.+--.00.//.//--..-13122/25334122..//..-+*)***'''('&%$$#$$$"#$#$%&&'&##'&%))(*,-,--///5::9:==SB..--/,5MZZ]`]gv}РЮОxttvz}~zrgYTUVVWWTNJC>951/+%"2K[fklmzЩѓ•РДЗМХЯЙpnpry}udMLПџш€€юю€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€ээ€€юю€ю€€ю€€€€юю€юююыь€юэюыъъъььэ€€ыщъююььююю€эью€€€€юью€€€€€€€€€€€€€€ю€юЏФbVUTRRSRPOPPOKIJHJJEEHJIEDFJPTTQPOOQPORQRn®–…¶Эєй€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷~J1*)*+(()(&$##"##"! !! " !&'&)/+%  "Gp\0"" "$!!*K_P4& #$$%$$# !  $1>?>@LPLIECDEFGFEGKIFLMLOG4/;PЗјƒЧkba^\ZWUSLFA5)0=?>?=;:::50/0.+)&%$#      "OgX4$*4UpJ */5AHNkpD-18>:5+$ 5S`lrpp{ХЂ®СВЛЩЪАpporБДraKKРаь€€ээюю€€€€€юю€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€юььюю€€€юю€эьэюэюыэ€€ээ€юьээю€юэюъыээюээю€€юю€€ээюэыэ€€€€€€€€€€€€€€юыщ„РaUVTQQQONPQOLKLLJHGGHHGFEEELRSSSRONPPNPQRm©“…•ЯЊм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьє[5.--++*)&%$$$"" !#" !!"!!%)*,.,(  "GmY/""! %+"!"&>OE7*&'''&'&!   1?HLeЪї∞Г`[YTOF;896% $&')+++,,))++++,+,.-,./...--/./203436534579644310.--,,..,+)')&#('%&''%! "$$#$&'&%&'&&('&&(++,-,,01037765;>>>===?CDCBBDBAACFHIIIHIMONE40:MЗƒƒФibda^[WVQJE=1+4?>==>;;:73001/,*&%$"   .YbN/&+9[pG")/5AGMkk@,29;?GOhЩ£БhYORTTTVX\__`bdhfgijkkjhhigfgeegeggeimorv{АВye[YO5#);QH1,,*++*0@FFOWW[gВЩС}vxw{}yq`C-&#   !M\dpttr|МЩШМЕГН§†АppoqЕs_HGНџш€юэююэюю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€ю€юэю€€€€€€юэ€€ююю€юээюээээю€ьшыэ€ээюьью€€€€€юьэюээю€€€€€€€€€€€€€€€эх–РaUTRQSSRQQQNLMPRMJJHHHJJFDCJRRRTSRPMNPPQQk®”Ћ•Э≈у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Џ}@.--..,+)%%%%$#! ""  "$$'((*-/.   !EfT.## !#"!"$1>:0$ &&+9>81/.*$  .;FKh†њѓ~]ZXUOD<884$"$$')*+**,,**++,,++-,+-.-...-..142563686799985661/.-.-,./-+*)*(%&&$$%%%#""""%('&''&%%$&)()*((()-./0267536;<;;;<>?CEC??BDCBCEHHFGIHIKI@00>OЖƒƒТibca][YVSMG>1+2>@=>A=:9653//--*$#$!    4`\@(+5B_mA%+-3?ELke9-14:?FQkШЭ{eXPRUVVW[`caaefeggjljhiihigddccdbcegjmrtw{АДyeZXQ9"'6LJ2& &&&'.76=LST_}ЦП}uz{yvre@      :}§ВViuxxw}ЛУЙАБВУЄ∞ВonnsАВq[CCМЎц€э€€€ю€юэюэюэю€€€€€€юю€€€€€€€€€€€€€€юю€€€€€€эю€€€€€€€€€€€€€€€€€€ээ€€€€€эю€€€€€€€юэю€€юююыью€€ыььыэю€€€ьъэ€€юэ€€юю€эээ€€€€€€€€€€€€€€€э€ы”ПaVUTTRRRRTSQMHJRRMJHGKOJDDCJSSRSRRQNMNQRQi§—Ћ•ЬЋщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь≈`2-,))--('('%&%##"#!  $'*('*.11#  !EbO/&$ !"$%%%!##$>^ZD<;99;985*   1>EIeЫЊ≥В^[YUQI?;95& #%$&*)''*,('(+,+,*,--///00//.//1456558;9776898860.-,./--/-)*))*'&($##$&%%#"#)+&&))&#$&&())((*+*+-../25437:<<<;;>ACCA@ABCCDDDDEFIJFEIMB11;;75310.-*%"!!    <\N0"4EKbh:&*+1;BOma6,04;@FPmЪЭ{gWPSWXXZ\_a`beggfcdebceddb_^^[[[\]\_dltvw{АБyfZ[U=%&3JL6!'&%"#(+8IS^uМПГz|{voeI  QФ©…ъ€ЪMkzГ}{ЕШЬЖz|БУЃ°znnnxИАkY@BРбююьээьэ€юю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€ээ€€юю€€€€€€€€€€юэю€€€ыъю€€ю€€€ьыэюююю€€€€€эээю€€€€€€€€€€€€€€ь€э’СcXXURRQOPRSSQKGHHIHFFHKIDCEJPSTSQRPMQQOPOe°— £ЪЌы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аЗK0,)(())()('&&$!!#$" ##'*+,-20#  #IiR.&#"!!#! !$$+Mh\JDA?=>@IQK?60.# "/>=?>?BDEC?BGIHFGJFFJH@2.;RЙƒ«Уhbdb\ZXTROG=2+7CB@A@>;;52102/*(&##!     !GT<%%AUWgd8#(,4=@Pl]3*/4;AFMnЪЦxfVPG>?@@AGJFEGJJGEBBCCCCCBBEF=<>BEGMXerx{БАyg[]W@&$0JS;('+(#" '5BN_uЕВ~}ysfM)  SЪЎ€€€€оЖPlzЖВН§ЭБz}ВФҐОsnpp|З|iW?EХЏу€ю€юэью€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€юэ€€€€€ю€юьэ€€€€€€€ю€€юю€ээ€ьъюэьэюю€юьььыю€€€€€€юэю€€€€€€€€€€€€€€€€щмќФeXWUSSRPRRRSPLGDFIFFJMKIGDFKPRSRRSPPRQQQOe†ќ≈°Э«у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—e8/,)('&%$%&&$%#!#%""!!"!#%&(+.04/" "OoR+$! !!!#"!!#%.HXPIJGC@@@EKNSRPU_lX) 0=JNcЧљіБ\YWUOF>::4# #$#$%()%%('%%'**+-..-/0..234333689989<97:::99:95121--0.++,,)(&&)))('$$%&'(*(&&&$#''''&&(()+**)*,,-0113459<<<<>???>>ACBDCADHJKJFCFFBE@20;QЙ≈«Хjcfc][WUTOGQ_`j_1 '-4<=PnX/(-38>ENpЭФqaVI0"+4CSapy}АГГyf\]XH* ,EV=,:;)!  '0;NhrwztdH& 5tЂЁ€€€€€€џjXrЖМШІ≤Ъ}|ГЮ±Пopqp~Й{eTAA?>?DDBBBDEGGCEHEDDF?00;MЙ√ЅФjcea][WVSME:/,5?@?<87:841/..-*&""!!    $8EPWSPZdfm_-&/7=;MmV-).49>BNpЪСqbVF'   *DXbq{ВДВ{k]\\N0%?>;9:8343110./0.,-*(*'%$%(()&$%&'&&&%')'(('(*)'))&'())**+,.-047548=<<<;@>;9777610.+)'&"   )5IYa_UYhkoa/"(/7=:MjR+&-4;=BRtЦЙneXE$ ;[kqxЕЖГ}m][^T5 0US,#$! $5LZU<  MЃш€€€€ю€€€€чЊgNr†µґЃђї≠Иzz{Е££АnkmwЙЙr]K5DРбэ€юэ€€€юь€юэ€€юээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юю€эыю€€€€€юэ€эь€юэю€€юю€€ээю€юю€€€юю€эь€€€€€€€€€€€€€€€€€€€€€€€€ььф”ЧfWVTTRPQMPTOJMNHEHIHIGFFGGEIPSRQPQSSRQOPOh§ћ√°Эƒр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”[*+('*(&(%#$$&""$"!!#!  "$&)./3;7," LsV+    !!'5@DBABA@?<;9888438<5100-*-2?HKaФї∞|[YWTQS`V6.& ! !"$$#"$$$%%&&&%%'*)(+.+,-0/.0233469:::;<<====;<9654320/./0/.-+)&&'('()''((('&$%)('('&(&%'()'&')'),*+-,054348;<;::0*3;==<<97640.-*('%!!     "&/CR[]Y\imr_-$&*5:9PjN(%,5=@FUvУДmdXE" 3Xmuy~ДЕГ~p_Y\Y?$'J[6 !"#'.421Lii^ZS3   *@| зъ€€€€феежўЭ\PАє»¬њЇЄЮАxz{ОђЮxnmn|УОlYH1?Оўу€ь€юю€€юю€€€€€€€€€юю€ю€€€€юю€€€€€€€€€€€€€€€€€эыю€€€€€€€€€€€€ююю€€€€€€€€юю€юю€€€€ююэ€€€€€юэюьююююээ€ю€€ююээььэ€€€€€€€€€€€€€€€€€ээ€€€€ьющ÷ЬhWWUUSRPMMRQLLNJFHIIKGCFIGDJSSRSRRTTRPPRQj¶ќ…®Я»ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь∞F(+()*)(&""&%$"!!"#"  # !"!!$()/49?8*  Gvc0  )6=DD><<<=:7::874220-0242/13=GK`РЄ≥АZXVSNMRD0/% "!"#%$""$#"$$&(&'('())*)*--,-00//1444239:::9:=><:><79:85121000//.-*)(()'%')))()*(&%''''(((&'*((*(),)')--,-1641589;=<=?AACDCEGHIHFGKIDDHGECD@33@PЕјјРhcb_]ZXURLH?0*2::=><:873/.-**($     ""#,П‘р€ьэээ€€эьэ€€€€€€€ээ€€€€€€€€юээ€€€€€€€€€€€€€€€юю€ю€€€€€€юю€€€€юьэ€€€€€€€ээ€юю€€эю€юэ€юю€ююэюэю€€юэю€€€ююэээю€эыю€€€€€€€€€€юю€€€юю€€€€э€ыЏЫhYXVTSRPMLNMILJIJJJJHIHEGGEIPTRPRSRRQRTSQp≠—”≤Э»ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўt6'('''%&'$""#""# #$!## !!#**-7><4)  Is].  +7>CFA;;<=<8898630/.000//014@JN`Рє≤АZZXTLHJ?11( !#""#&$##"%%$%)*)&&(++,-,,----/10/22463488998:=?=9<<9;888322120...-++*')(&(++*(*))(''(''))))(**(++***(*+,--.3504879=<=?@@@DFFDDFGEEGFDDGIHFE>34@RГЄЉУjdb^][XUSNH>0+3=>>=98763/-,*(%#"    #""-M]XUTYago]-$'+28=SgH&'-4:?ALsРВm_N@!1Ur{ГБАВАvd^^\O4 +NQ,#"""!#&,?VcgrЩ•Дlo`6  "%*-3659BZvЖ£ҐХ™љЈ}MaШЌ№÷“ЋЂЗ|{zzЫєЦomlsРЫДkU='>П’пьъээ€юээ€€€€€€€ю€€ю€€€€€€€€€€ю€юю€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€ююю€€€€€€€€€€€€юьююююю€юэ€€юэ€€€€€ю€ю€€€€эю€юююыэ€€€€€€€€€€€эю€€€€€€€€€€щЎЮl][WVURPPNLKIHFFKIHHHJHEFEEKQRRQRSQQQPPRRjЯћЎЄЮ ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щіT+'(&&('%%$$! #$!! !" !!!&,.08>91)"JnR+   '5??@A=;==;998641./---.0---6DILbПґ±ZZYTPKI?21(!##"$#"%$#&%%&))))*)(()*-..,,...020.0256337;:9;<<=<::98;768511121....,+*)*+)(*++)*)*))*(')++)*---+-,())*--.-.//466437:;=@@>BBACEGGEBBFDCEGHHFD=11?QБї¬Ъodb_\ZXUSRL>=;97520.-+)%"$   #9=6*!!#%,OwВГББ}{\*!#*39V=&#!$#$(0@R_bpФЫАml^1 " #%&()+2458;?L\jzdLh¶’Џѕ–ќІВzyy}ЯґЛljjsОТ}hP8'=М–зюэ€юьююээ€€€€€ээ€€€€ю€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€ю€эю€€юь€€юэю€€€юэью€€ю€€€€эээю€€€€€€€€€€€€ю€€€€€€€€€ю€нћ†l\ZUVUPLJMQNIGGKJEFGEFFFECCIPRQRQPNPQOMQV\{Ј÷ґ°∆ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ё{?))*)'')&$$#" #!"" "#" %),28;=<3'" FoV* '6>>?><<<;:<;63300.,..---..2>FKbСЄ≥Б]]WQOJGD6/)%+,,,-++,*&&)(&*+***)()++,-,+-./0001004522248;<=<=>=:<:8::8550./02/0/..+)+,++*+,*)*((,+)'*,--*+/1-+++*+**-.-//./47535778;@?>A>>BEGIDBCDECCDGIGC<33>PДј…†sfd`\[YVTQH=2*2;==;;95430-,*(&!   ,O[WNF>92,((:_БЪ©≥Ј∞ТZ("%*4:9MdE%&,2:>ARwО{i^P? /ZxВГДЕГ}}|rb]\YK0 0KL-$$""$(/9@EDKjЛОubM'!#!!!!""#$&))),047;CHHDLxЄў’–„ЋЬ}{yА£ЂАkijuМНxbJ2&<Й–жь€€€€ю€€€€€€€ююю€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€ю€€€€юью€ююэыэюэ€€€ьь€юэ€€€ю€€€€ю€€€€€€€€€€€эю€€€р”ҐjYXVVSPOKKOKFEFKJGGHJFHHHECIQTTSROOQQQRQR^~іћ©Ю«ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юхЈW/*)(&%&&%&%"!!#$#  !"  "'),39:<=4(! Fs[+'5;=>?<::9889752/.-.-.--,-.4>DI_Мµ±Г][VROIE?3-&)2<@FPNHD:.()***)+,+)*+*+--+*-00/-.002544632499:;<>;9;;;;:85640/111/./0-**--,++,,((()-++,-./-+,//.,+,--,,/0//0//35443588:=?ACA@@DFFGGECCABFHHGC=45>OЕЅ §tcdb][WSSNG?3*2=>=987331...*)'#   *G\`bfd_YK?;8BXn|СЂ≤ТZ)#%*188MeF('+18=BRvМyjaR@ ,_ВЛЙЛД}}}we[][UD) :VB$$#%*)*//-,,>tЦ{U;#$$'%""!$#""! #$%"$'%'),355;RИ»џ”÷№ЊП||~|Ж©§xmlm~ЧРt\H1&:Зўъ€эюююэюэю€€€юэю€юью€€€€€€€€€ю€€€€€€€ю€€€€€€€€€ю€€€ю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€ю€€эюээю€юъы€€€ю€€ыы€€€€€ю€€€€€€€€€юю€ыыэяҐm\YUUSPMJIMMHCEJGGGIKFFHKFGMSTSQQQSTTRRRQk•ѕ»†ЫЌь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€я~A+'%&&%%$%&&# #"!!  $((,48:=:/'  DpY, &3;?>==<<:7775541,---..----2>DI]ЙіЃ}\[XUOG?91+%!&/5CQ]eghohJ=62.,--,+*,,,,++,,,,/.-/12233674467899;;;;;:<:996463143101.//-+./-,-,-**+++,---.0.,,,.//-++---./..///0243379<<;>CCAACCDDDFDDEFFEGGHE=23=PИЅ∆Юqcca_ZUUSMG=2*1=><986330-,-*(&"!    $9NX[dklkhebWMJKP]vД{X)!&*/49PcE)(,/5;>PuЛzibUB  -dКЪЩЧЛА{|~}m\\\YR;$&DN3$#%)'())()(1UvkD+ #')**,,(')')'&%#!##! #%$$%%*-3@[Тћ÷«Ћ‘ѓГxz}}КЂ°vnnoАХКqYC/'8Жўтцэюююэююэю€€€€€ююэю€€ю€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€ю€€€€€€€€€€ююэю€€€€€€юэ€€ю€€ю€ю€€ээ€€€€юю€€€€€€€€€€€€эъо÷¶q]YTRRPMKNONKIGGGHGFGFEGIHHJRRQOOQTSTSQQPl∞ў«ЬЪќы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щє]3.(%(''(&&'$"! ! !  ## &**/5;=;5+#  ?gS,!(8=?==>;:;984301/--...--...4?GO`Нє±~^]YUOG>755*$-7::AOYbmВЙtje\UF:61-)+-,*++,++,.,/221101674454899;;<===<:::64654432221../...-./.,+,.--.//..//--,,.0/--.0/---.00/1346889<1,29:7320-.-+'##"!!   "6EQUZcfdglpoh_YZ\ertX'"&)/5BJLQU_jq|ЕИО|e]OB80,+,00--//.+-00012332233379:<>>===;;<8678665452131010-./010,+,-/0/./01.//./..///1000/..//0244578:<>=>EDBCGGGHIKJHIKJHHKMJF?32>QГљЊЪnddb_\WTSMJA2,3=><9<;51/--*(&#$!""  "6DMRU[`^Z\agllknmkosV%!%(026Q`<&,-.38;SzК{k_TC&@А≠Їє¶Йyy{xvrh[\_^ZM4#&79/+**&%()(%/=6'&'&'&$&),..-.-+..,*+,(&$%#""$!#)4Hm§ќЋ¬∆іО{ywvzХЂЗnlmr}Е}eL:,(9Еќаь€€ю€эь€€€€ююю€ээюююэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээюю€€€€€юю€€€€€€€€€€€€€€€юююэ€€€€€€€€€юэюю€€€€€€€€ээыь€€€юэ€€€юю€р‘ЂsXWWSSROOPOKJJFHIGIGIHFFEEEHOSRRPNOQQQRRRh¶÷ЋЫХ…ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щфтсх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э…g2,-)#$%(&#!"$%"  !  "'*'+3>=542)%" Bv], -=@<;<<<::656332/--..,,--19:70,0=Xq\FKOPRRRPT]n}upopofSG?8890.00.../0..221105975:;<==;;;;;98889765553343111.01000..,,-011011310002///.120//001./0047:::;::;=ACA@EFEIKLHEHHIHJLIE>02?PЛ…ƒЩled`\YXWRMI?1+3=>;:;8300-**'%&#!!  $7AHOUX[[VVX[^`dinmjnU$!$*1/3Qb=$*,-158OwЖuh_SE+ &TХЊ«Ћ≤Нwvxvrroc]_^[YM:%(10,,+,.0318=6&""#&'&%&'*,,*,,./--,.,(()(&$&%),9Sv©—”’”ЂВxwvwБЯІolnqv|x`J1)'<КќЁф€€€€€ю€€ююю€€€€юэ€€ююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€юэ€€€€€€€€€юь€ю€ээ€юю€юээюю€€€юэ€€юэь€щЁЃv\[XSSRRONPJHGGGGHEDHFFFEFEFLQRQOOQSSSSTQdҐ”…ЫХ«х€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эыщпў∆ –и€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€у™N,,+(%&$&%#""" ! ! !"  #%(+*.28:65/'"!   Bt]. &' 0@@?=;89997465221-,,-,*--/67;FN_РЉЃyZXUROG=7/,1@b}dKRVTVZZZ^\YXTVZZ`ovtztaWRB60,./.01//0112466559:::99:;::988887534235732342111/./00///056212430/0151.0541/021242115;<:;<:9>?>ACCEIHFFGGHJLJJGJJ@13?VФ…√Щldd`^ZWURMI?2-5:<@<540.-**,)&($   $6?ENTVWXXXZYVVY\^_akY' #)135Pa<"(,.05:NvЕsg_RD-#& ,hҐƒ—ѕ≠Дtuutsqoh_\^][YP;*$$'++-3,-(%&%#$$#$%#! !&)),.139::6-#!"$ An[..OO* &4==ACFJHGGCDIHHJKIFKK?14BUЗЊјЯoee`]YXWSOG=1,4;<>;3220-*++('&$   $5=BIQTVZ]][[YWXYYX\jZ* !'069O`?#%+,028MsГsh`SF. BВ≤∆“≈Ьyrstrrspoh_^^][WQH=.'$%*06>HJHEDB- "##!"$&&&(+,)*****-.--/.../5Ne≠ ƒ«»Э|vuwyИ©ЩnokkТЗoO:*(&0ZЕР†і∆Ўипх€ююэ€€€€€€юю€€€€€€юэь€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€юьы€щцю€€€€€ююъь€юыэыъ€€€€€€и±xZVUUTSSRPPKKMKKHJHKJEHLKHHLOQRQQPRQPQQRRnЂ“≈ЭФЌ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€з„€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мЩM+,,)'&%(&$$$#"  !! !"!"%&'**05=F;95+#"#% ;=DK_Міђz[YVSME>7.((1>FB@S]OLOQ\bWPRSSSTTSQSUZgjhhea_UHB>62120010256767:98:98977984330213455452351.233553/1234388655598669::7530135324673789:<<<>1+2MC532+%!"% 5ir9*FF/  "(,167586274351-.-.---+6K@600253698:98655878652/.0212432310450136722156526;87989;99::;<:8786445576357<:;>A?<>DEDEGFJLIHJLLLLLLMJA54?QДЉїЪlcca\XUSNKE=2*2>@=895320.)+)&'$"!   %7?CGNVY[\\[[][XWZZ]fY/#&)035L^:#'+.36:RuЕujaVF." 5oЪ±ЇЉЯ~nhkosrqqpomd]\[\[Y[YXTRSSOPQKEILg•µЯЗv`K:)!"$&&%%$%'))**-+,--1C\oУ¬ћ∆ѕ±Дvvtu|Ч≠ЙjlkuМЦАaH1()&+CH=CJU]guБФІ±ј‘зръъыььюююэю€ю€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€юьъю€€€€€ьэ€€€€€ээ€юэюьэ€€€€€эююкґ~\WVUSQRROMLHHIGHKKIHEGGDFGKPRPLKMNPPNOQSq™≈јЯШ…ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€с§S.,+(''%#"#%%" !!! "#"  "(-/0;C5562)"!$"2co:"9<1#  $#),1225342/,+--.-.-:PD;724989:974456663/.11110132121461279402346779;:9;:;=><>;;<;=?;88968:9678<=?AB@>>BDGHIHIJHGKLHKMNLKLD33@R|∞їЭmcgd]XWSOMF=4+1>>;84321,,,,,)(&!!! .9BKWcfc`ZY[[YXY[\]eY/ $%*130I^;#(-.05=StДui`TE.  LyШ≤∆ЇЦxhfknrrqtqmmib]]ZXWYXWVTTTUUOJJLNe√€€€ыв«ђИpK+! !! """#$&&')(*+-3F^y©ќ∆≈ќ•~wvtt~ЯЂ~hkoБЩЩY?-*)$(><,14;?DLR]ksР£∞њѕ№мь€€€ю€€€€€юэю€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ю€€€€€€€€ю€ю€€€ю€€юьюэююю€юыь€ю€€ющы€ю€юээ€€юю€€ээю€€€€ющдґ[VUUSQQRPNORLGFHIFGGEFFGDCIQSQNMNPQPOOORp•≈≈†Хƒц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вu5+*&&%&%$!!$$$#!!!! #"##$"!$*/32255673)" #" 3bh8*1)   #&)*--./.,-.,,..9MC>?>?==@?>99>>98::8=?=@@@?BBCFFGHGGFGHIJKKLMLKLB34@P|≥їЮncgb]YVTRMF=1).;;57420/.+,+)'(&! &1;K`jjd]Y[\YWYZ\^f[/!%$(.11Ja;")+.046IrГsgaVF/  %^ГШ©ЊѓИnddilmprspkjgb]XSSRRROOSSUVTNLOOOaі€€€€€€€€тƒУ|gL0%!"##&'(/8IaЕЇЏЌЋЋЬyvtsuБ•¶xhltО™ЮS<*'("$87').0./16ELcСЈ•rY[XSNE<3,)&1?EB?EJIFEIGHHEIHFIMLGHLNOMPRONRRSRRRSQPT]gjhorpjaXSG<9644535850.02/01//26324212568326655459;<;:;<=?A@@@?@=<<;=@<;===>??CA>AEBEHEEKGGJIKGIMNNOLLME54BSВњњ†ndf`\YVTRNF=0)-6765362./,+*&&(%# !%/=ITXVSWYYWXZ[^f^0##%+/1Ib;',.146LrЕtdaYI3$"$"!9pО†≥ЉЮ}ja`dlnlpqqnlcYSLFJKJNOPUVURPPOQRQ^™€€€€€€€€€€€эж∆ЯЖlN-'%&'/>QjСЉ— ‘∆РwxxvwЙ™ЩrjoxЦЃЯxM6)(%#&43#'12+((--/49=CHR\eq|М£Є Џкцэ€€€€€ююю€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ю€€€€€ю€€€€€€€ю€€€€€€€€€эьэю€€ю€юю€€€ююьщю€ю€€€€€€€€юь€€юьюээ€юю€ыеїЖ_XVTSRRPOOLIHHHFHGDGHFDCCFKRSRQRTRRQQTNPoЂЋ≈ҐУ €€€€чп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йИA*'%)'%%%" !$#"#"!!!$#! "#$$').235532.)$   5fi6       :<*  &'*++7J@;EMdУЇ≠uYZVSOF=8.(%1CF@AHIFGIEEGFDECEIKHCDJKLJPRPNNPQPPSUTSRPNMQWZ_djmqoaXOE:30264//2201102214332401553233678659<======AABD@B?>@?<>><=@@?@AAB>BFBFHEGHINNKKOLIKMPMLLB12BS}ЄЉЩkaba^YVTQNE<1)+7:51241--,,(&%&$# "   #+27<>DIMSWYY\c]0#!%+13Ic>!%+-05:MuЙwf`XJ4%#!"! OwУ®ЊѓЙqga]agilpponib[RKNRVWY[YWVUUSSRRTV]°€€€€€€€€€€€€€€€€лЋҐТucR." '3G[v†√¬√÷ґДvxzx|ШђКnlo}ҐѓШjF0)*$!%63 !,/,&#'%&(+*./4;@JQ\fuДФІЄ Ўлш€€€ю€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ыью€ю€юю€ююэ€эъююью€ю€€€€€юэ€€€€€юэьюэ€экјО_VUUTSRPOMIGGGEFHGHHFFGDDGJRUTRPQQNNRTPOlђЌ»°У«э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЋg1**+*%#"%%%#%"!#!!# !! !!!"$(,/3424741(    5kq=       <:'  "4KB;CLhЫї∞wYXURNH<6,&&0CLBAKJHIGHHFHFDCEEIHGIJHFGMONKLOPQQQRSSQRSOQQMKMT\es||yqZHBB=5//130/.03211/33400325522555779==>><=>AB?AACACDBCDA>AB>AC@BA@ACCCDBCEIOPJLQOLONOSSI>/2AOyіЇЦibca]YXRPND=2),796230/./,*)%$'&%#"$""#$&" $$$(*.39DKMQTa]1"#%-:;Hb= #(+/49JsКyh_TJ5%$!!"#   .bЧЂєЯ}kc__`]eknqpmfmydNPX]_a`YTVTVUVUSVV[Х€€€€€€€€€€€€€€€€€€€€пяћ£Оk;*/;PeЗЃƒЉ ѕЮ}wxwwБ§І}mloЙ≠©П\=*('$ %42!#&'& #!"$&#%((*,16:ANVblwЕФ£≥Ќглщшюю€€€€€€€эю€э€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€ю€€€€€€€€€€€€€ю€юэьээю€€юьюю€€юьыюююэ€юэ€€€€€€€€юю€ьюэюэй¬СaXWTRSTQONJHKIEEGFFDFHECBDIRUVTPMMNNSRNPlђ“Ћ°У≈щ€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дЙC()++(%#"#23   !"" "$).12346420) 1js=     24+   %?@>DMhЦі©rXZXTNG>6,(-6JQB?AA>?AA@A??EDCAB??DDB@@CDCEE?@CEEHKJLNLKNRPW^H>12@Qz≥ЇЫmbaa]YXUSLC=0'-67631/..-+**&%)&$$%%#"""','# !"!"#$*+/38=E[^1!$(/=@H_> &,-47DoИyh^UJ1"  ApК°і∞Рwicba^_cgkmlhoЯЇМLMV^fib\YXXZZYXWZY[Ощ€€€€€€€€€€€€€€€€€€€€€€€€ењСOEYyҐµљґ…ЉМxwvwyКђЬsmmvЫµҐВQ8)'&(%'0/'&''&$###!"""#%$$%'+*048@IOT^gsЖЧ§µ»џвпшэю€€€€ю€ю€€€€€€€€€ю€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€юю€€€€эююю€€юэ€€€€юъэ€€э€€€э€€€€ю€юэъю€ю€ээюм»ФaXWSRRSQNNNKIIKGEGFCCGIEACLTSQQNNKOPQQPQm∞‘«ЬР∆ь€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ющќg0)((%%#"#%-,#! !!    ##$%+00357651,'  .ht<        (4.# >BADGJIIEDGEBAEEDDGGFFJJGHJJHHJKMNMJNMKQQQTUUVVTSPMPTY]^fqtp_SPH>623//0023333567336546:879<<;<==@A?><=BBAAA@CADC==@A@>>?@@ABA>BGCEFJIILMMPQNLGB13>MxЃЇЭnaa`[ZXSNJC<1&+662/0/.-,+(&'&&$$&%$"$#%')(&%$ "!"! ! #('&&)+5P^3!#%+6:F_B '+.04DnЖwgbXK5" U|ФІєҐ~mfcaa``cffhjk°щ€”_KUbmnh_ZY\^^YXZ\^\Вз€€€€€€€€€€€€€€€€€€€€€€€€€€дhKaС≥ЉЉі∆™Аvutv{УѓПolm|ІґЫrI4(&'&$'./)&'(&&%'##$##"#"! #(%'*.1259=BJT]fsВУЯЃ√’ёпщюю€€€€€€€ю€юэ€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€юью€€€€€€€ю€ээ€€€юьы€юэ€€€€ю€€юь€€ээь€€€€€ю€щ“ЦcWUSSRQPOONJHHJKFDHFCFGGDEMTRQQMPOPOONNPiЂ“≈ЩР»ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мРH+*('&%%%##%#$" #"!  "!#&(+-058778/(% -fs?            FE;ENfЫї©v[YTMHF?8-0?ADJFCDHKKGHFDFEAAEEDAEFGHHGHJJGGEHLJJIHIIJONMPPSUTUWVUTTSXWQV_lkggg^PJB700-02794453136999:::<<<99AA?>?AACD?>AD@=>?@@=>>@B??@=?CBCDGGHIGKPQQNLG64@MtЃЇЬjab^ZYYUOIB:/(,240.0/.-+(&&&&%&&'%##&'')*(**(&%$#!!!#%$##$'-F\6!#$)16B]C"!'*,.3FnЖyldSG7"   1gГЦ®≥Цyic``abbbcdgjСп€€уЮMX`lqk`\[\[ZZY[\`]v—€€€€€€€€€€€€€€€€€€€€€€€€€€„_PlШЃЉЊљ¬Шvtvuv{Ъ≠ВlloГѓ≤ЦfD/'%(%!",,&%''$#'*(%&$%&%#"!"&$$(++)),/236:DLR\ep~УЯђ¬яйсщээю€€€€€ю€€€€€ю€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€ю€эюэю€юыю€юююю€€ю€ююьэюю€€€€ююэы€ъ”ЧhWVTRQTQNKKKIJKKCGHFCFEEFFMRRROOQQQPLLPPh™—ЅХТ≈щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вs5*('%##%#" "!!!""! !!#'),-023563*%" ,co@          FE;FOgҐ√™t]YUNKE>8.5EAGNHDDINKJKFFIEDEFFEBFEDGHGJIGFGEEKKJGFHGHILKMLNSPPSUVXZ[^\UVSTX[]ceeidZNIH@6664533458;;9:;<:<:<;9>?=????@A??AA@@A?>?@==?A@=@??@>CBABHGEEDGLONQQPI33@Nq¶Ї†mddb\ZZVPIB92).64111---*())%%%%('&&''*,,+**,,,)'&$"! !#" #$',@Z9!#*26?[G$#&)-/5KoЕyjbQE9# JrДЧ≠¶Зrgecbccca_bd~ќ€€€€«^^dntmc\[ZZYY[]]]\oї€€€€€€€€€€€€€€€€€€€€€€€€€ьїQ\xЧЂљљ≈≥ЗusvvyЕ®£xonrМ≠°Ж\?*(&'% ",*%&%%$$%'(%&)())(&$&(&%**)')(*,*+,-037>CJU^kyЕФ§є—џанцъью€€€€€€юю€юю€€€€€€€€€€€€€€€€€€€€э€€€€€€€ю€ю€€€€€эююэю€€ю€€€€€юююэ€€эью€€€€€юэюэюьшЏЮjWURQRSPIHJHHMNGGKIDBHFGCCKNPQPQPPMMKJNQkЃ–ƒЧРЅщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЩR+)''&&%$#$"!!! " "#   &(+-12/046.,'"! -ewG         "C@;GQi†јђu[ZURLF?819MPUZSJKKMMKJHHJFEDDGGEEGDCEDGIFGIHDHLIIFFFHHKLKJILMKNNPSVYXY]b^WWWSQRYcktplslWLB53256535:::;;;;;<<;?@?@??>BB>>EDA?>?@??=<=A>?@>=>;85?lУЫФЕhYVSNKHIKMIHEDEFFFCBCFEIKHHECDGJJJGEEGJJHEFGIKILJLNPQPRV\^`ed_ZVWWX`dfs~xocTMLJC;748989;<=====>@@@??BA?AAAAAABC?<<=;;=;=?=:8<<=@B@ACCCDGLPQPNF35ALp•є°oc`^ZYWRROD<3*,113--+()(&'&'&&'+,,+--.0/01141/.,..,)&$" !#!!#%'6VA"$&+1>XK#"$&+05DhЖ~kbUJ;& !   HtКЯґ™ЗtiefecbcgdabЙм€€€€€щґesuwtl`\]ZZ[[Z\_^`Мщ€€€€€€€€€€€€€€€€€€€€€€€€ќPWpН•µєљЉНttuurwСЪymno}ЧЧН_D2))('$!$-(!""!$%%#!#$'('*)+,+./.---+)))*))&&''&()((+,.58=FNWam|ЙЩЃњ“арыэю€€€ю€€€€€€€€€€€€ю€€€€€€ююю€€€€€€€€€€ю€€€€ю€€€€эююьэю€€э€ю€€юьэ€€€€€€€€эээя§nWURRRPMPMLNMJGFHGBEFEDDFDIQSPPNLMMLNOPTuѓ»√ЭПЊф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЪX1+($%###%&% !!"" "! "!!#&'))(,010581/,$  &cR    6A)     DD@<<==?>==@@>?BAACB?A@<==<<<;979;;:9<>??A@?@CFIJLLMG43APn°єҐnabaZXYUQJC=4+,..--+)&((%&'((''*+-//.1412426542/330+'&%!!  $!"$1RC $$+4;WO&"#'*01=aДibXQA)"  9dТ©ЄЪ}pieaaa_dgc`h†€€€€€€э…ioquwpb[\Z\\Z\]\^_Би€€€€€€€€€€€€€€€€€€€€€€€щ∞Sb{Ч™іђі£Бvvuuv~ТЖmmpqЖ†ШАXC/)*&'%"#-% !!$ !%%&)&&('*+),./02//,/.-*(&&'*%''')))+-/059=CMV^o{ЗХЂЋ№зхщэю€ю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€ююююэ€€эю€€ю€€ююю€€€€€€€€€юи©qYVUURONOMKHHHHEFFACFDEHHFIPOPPNMLNOONNSx≥«ƒЮОЄк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џx?-,(%%%##### ##$##"$#!!! !##$(*),-034241.+$ #_|O   .7)     ;@>DPh†њЂqZXURLFA=8I†€€€€€€€€оЋ§Ф~eSKIIGIFEFFHFCDEHFGHGGIHEJcZDHDFKJEFGHIHGKGHKHIIMOOMOSVY]chf]\XWVUWVX_ehkoja\SKEC@;9;==A@<=???ACD@BB=AB?><>=;7645:9678:<>???@AECIKJLE32AOpҐЄ§odda\WVTPH@<2*.//.*()''(&&)&'(&),021276447789:97861.-+*%"  $# +QF$&*49PR,#%(*..=dЕАke[TD&  9iЕwsДЩЈЇСvhdbcaaacbbaЁ€€€€€€€а~mrtvpe\YZZ\[\^\`_xЎ€€€€€€€€€€€€€€€€€€€€€€€еwZnВЫЂђ≠ђНxuuuvzЛЬ~jjpwХ¶ХpP=+*(%(#"$+$  "##&'%'%$(((*--/012164/.,**++((&%'&&)'((+.--07>CKS\kАОЯ≥∆Џнрфь€€€€€€€€€€€€€€€€€ю€€€€ю€€€€€€€€€€€€€€€€€€€ююьъю€эю€€юэюэю€€€€€ю€€ыж∞xZXUTRPOMOMIEGIFCEFDFEFHECHNMNNNOOORQPPTvЈ–Ћ†КЄо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пСN1-,'%&#"%%#"#!!$%! !$%" !# ##$&*,-.025221-'" %azL    $1-    7@?HPiЪЉ™mXXVRNG@?:J§€€€€€€€€€€€€лєЦДjYSMGGFIJHFIHEDHHFIJHEJSRFGFFHJHFGHGHJKHGGFIJILNKJLNORSWZZ[\ab_WTQRUW[_adjrkea[XI@==??;?><=@BA@?D?>A@>;::9;957897898;;<=>==?BDDGKC26AMo†љ©n`c^ZWVTPJC;4*,..-('((&&%'(((*)--02459;::;<;<=<;:5451--*&!!(@2&MK!'*/7NT."$),,.EMhЭї•kXZXTNFB>8J•€€€€€€€€€€€€€€€л≈§С|qfRJIFEFGDEGGHKLHHGDHIHHEEFDA@ADHJFGEGGHHIIHHEFJJMNNNQ_\Y^_]]\YVVTRSVYbbcinreZYSKC>BB@>?>><<<:9974458:9;:<;<<9;ABDFHA14?MkЯЊЂsc`^ZYVSKFB<3*,+*+*'%$%'$'))(),0/03559<;<<<<<=><:7782...+$/sХH"HP!!#'.3NV. %'*,/;XВmbZTH-! EЯјЅЅ§~ГР©њЯ}mhfegb_abcay÷€€€€€€€€ь∆lrrvtj`[Z]_[\[\\^g¶€€€€€€€€€€€€€€€€€€€€€€хЭUiЦ™∞§™ТytvwstГЭОnkoq~ПУБYE2,*((,30/?G6)$" """$###&'&)'*,*..-.0.-.0431//..,,**%'%&&**()())*)+1:?>EOYdmzКЭ±≈ўкоъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€эю€эь€ю€эъэ€€€€€€€€€€€€ююэхЎЄZUSQNLMONKKLIIGGEDFFGGGCCMOQRQSOOQOPRQWw≥— ЬКЄо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рЪW5.')'&%%##!#""$! #! #"!##$"$'')-+,.01201000,&" S}M         EE=DNjҐє°j[\XSQMA;:K¶€€€€€€€€€€€€€€€€€€юв≈ЃЙVDBEGGECDFGHIJGEIJHEFEFFB?A@AECBHGHFFGJGDBCFFGGHHKPflMPTUXZZY[ZYXVSRSVX_hieoqhbXPICBCFCB<<:7:999:988:9:<;<;;=AEBEE22?LnҐљ™scb_\WTQKFC<4+*+**(&%''&$$&')(+.23579::<>=;>>>><<:89630+(%%17 Yљ™> AR& " &/:NY6!$&',.7S|ДoeYQJ2   RЂ«√√ІНОЩііОtiefgda`c`aeС€€€€€€€€€€№rtutwnb\Z^^ZZ[[]`_Ещ€€€€€€€€€€€€€€€€€€€€€вk]qЙЮҐ°¶ҐЕuuvusxНЮВknoqЖФПtS?0-,()*+*0s“ƒ®vR>/&#" $""#$%$$%&%&),-,-./.--0/../1112.-/,-*%'**(('&&(*)*./-05BDDCACFFGJGEJKFEFGFEEDFFEDCFHLHDFIJFEBCGDFEFEGLSYMMPPRTWWWY\\ZYXVURRTWXajjifb^[WPMLGCCGGDA?A@>@@>??<;;7;;9;=<=;=>=ABBE?12@Mo§ЉЂsbcc[WURPHC=2)*,)*'&&%&%$'*(+-..1469<9:>==<=<>=<=;<84403:JlОК;SЙ`! 9T* %/;N^CDIMPMNQPLOPQPRoЂ…«ЬЖЃд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЭT75*)&$$&#""%&$" " #"#"$#%$#'''+-10/+-11..-(! D{d$ "2%      AD@HPeШѓРfZXWTMIC=9IЬ€€€€€€€€€€€€€€€€€€€€€€€уФW<78<>=>GHEHIGIHCFGIFEGIIIFGFFDJIBDEIFCCDDEEEIGFHDDJKMLPNQTTVVXW[[XXYVRPPRTSY`fkngdb\VSQMMJGACIECEGEC><<<;=<;<>?@AD>04ALlЮє©rcea\XVQRJD=2*)*(+&%$&%'&&+,--.0025898;<:<=::<>::8868DMWbДЊЌ≥J"+  /S0"$*6M`A!$%&*-6RyЖse\OJ8& !  T≥Ќ»њ©ТЪґ≤РvjdecbebcbceЕу€€€€€€€€€€ф¶hqtvri][]`]]^^^`_}и€€€€€€€€€€€€€€€€€€€€рУ^mГЬ≠І£ІИwvttuuВЬКlikovДТАYD3-,+*(''&3О€€€€€ющпя ІsUB4,%&%'&$')%%%())*)+-.+*+----0.-000/0153-01-+*-,(*+*+++,-.-.07=@CLXcrБХ™…ўвучыю€€€€€€€€€ю€€€€€€ююэю€ю€€€€€€€€€ю€эюю€эь€юю€€эъъЋО_VUSROOOMNKJGFBBCCDCCBDBBFKLOLJNQRPOOOPkІ∆»†З©ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оВA45*(((&'$#%"#$%$"!!"!"$%$''()&')++,000-.24/2.&   Hh'5L1       AC>EPgЭґЧjXXUSOKF>;IЯ€€€€€€€€€€€€€€€€€€€€€€€€ъ§a2'(.24:?@FHFFEDCDFFEGHHIEGEDBEFCCCEE?DGCCDDFHEGDCEFFFKHLQRSTVUVWVYYWWRSSQPPTXYcennaaed^[WROMOIGIIKHBA?@=:?B@?A@>=@A?@A>47DIaТЄІpac_ZWURMIE:1+((+,(&&$$()(,.--./124977;;8;<::::418>K^mrjjСќ…С2  *T7!%)4H_H$%&%%-5KuЖui]PI<% !"   X≥ћ»ЇЬТІї≠ЕmfccdcdcbdecШ€€€€€€€€€€€ь≈gruzvk`\\^_^]\_`_x’€€€€€€€€€€€€€€€€€€€ю÷jgxУЭЯ§≤Э}uttsvwЙЩ~ijjrГРКnS@/,+))('''7Т€€€€€€€€€юшсж‘≥ЕWE5-((*(&&()((((+((**),,++-,-/0/0266564430.2.,..,-,,-+-,-,02018?AHN\l~ОЫ≤√–џнтх€€€€€€€€€€€€€€€€ю€э€€€€€€€€€€€€€€€€€юъюю€€€цЌЦaVVSOOPOOPJIGGDDCADA@@@A?FMOOOMNOONLQTQn≠ћ«ЭЕ§Ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ≈h6,.-+''&''&#"""" #$#! !#""'))(*-0/../-.0.20.1.'  Cv^' ,=/         @>=GPfЪґ£oYXWUOJE@9JҐ€€€€€€€€€€€€€€€€€€€€€€€€€юњu4""&-39=?ABDFDBEFFDCEFHFBCBDCDCABDIGCDDCEFACDACDDEFFKOKPSUTSTUXWUVSTTUURSQOUV[\X^efgdbb`YUOKGIMHHFCDA>?ECCDDCBEFCFEB57@LdХЄ•n_d_ZWUPLE>80**+*,*&(%%((*---/.1235789<888795239FV^jz{vlh{ЫЛP  &Q>!&*3I^M'#%'(,1BnЕwjaQF:'!   ZґЌ∆≤НХґЇЫziebaddba`bcp…€€€€€€€€€€€€Ёsstzvmc]^]^]^]]\al¶€€€€€€€€€€€€€€€€€€€щ≤anАЦЭШЯѓСwutssu{ТПtklkuРЦx^O9/-,++)*()8С€€€€€€€€€€€€€юъхк’Ѓy[I<2/+((--,*()**()**)+*,.1..00257657687:4134020/...,.-/0..15579@ELV]myЕУ®µјясффю€€€€€€€ю€€€€€ю€€€€€€ю€э€€€юэю€юшь€ьююэш‘ЩeXVSOQPROPIJHIEEGEDAADA?>GNLOPMMNPKIR[Rpі”ћЭВ£ў€€€€€€€€€юцш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рТS71.**)'''%$#$##!##" "!"$%&(),--+/./--./1.-.,'   >GPjҐЈ£p[YVTPLD>7J•€€€€€€€€€€€€€€€€€€€€€€€€€€€вМ:"*.59?HECEDFDCFIHGDCBCDDABADFGEEEFFD?BBDDHHFCEJIHNQSSQQTUUUTTSTUTVWWUVSQQPTWY]]`jpfbc[TUQJNIEKHBAFGFIKGGKMJOOG77COeЧє©obb\[WUPLF@:3++,(*(&%(('%*,,/0/1358678855533/4BXoqns|}sld\O<'  !NI!#(2K`R("&&*,0BiДziaRJ?)  Wіќ√•ЗЪ∞іТtgeeccdbda`aВр€€€€€€€€€€€€рХowxxrf[^^^__]^\`bДэ€€€€€€€€€€€€€€€€€€йcsЕХЬЩҐЭГttsstvЗЮЗnkmlsЙЛlUJ51.,*)'*'':Х€€€€€€€€€€€€€€€€€юъул„©hYE911-+,+**+*)')*('-,...0/140138;8:9798;675336412-////./000479=?FJOXdq|ХЃї≈џжш€€€€€ю€€€ю€€юю€€€€юэы€эю€эээ€ьэээь€ют–ЮjXVRQPRMKMJHFECCBCECDD@@AJONOQNPQKKMOPSp≥’ћЮГ®ў€€€€€€€€€эсх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э‘oB71-,,*),(&&%$'$$"#! !#&'$$()+,.,+/.-.-.01../)"  7mb--/#       :==GPfЪµ®sXWUTROF>8J£€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыЫM# '/8:>A>DDDIJIFEBFDCC@DCCBFGEFHFFDCAEEFFEGDJEFJOQPPPNSSRSSRTSUUWVXWVVUUVUSSST[_ZakkggcWSQOKIGEJJFJOKJLNPNND6:CIdЦє®pbb`\WSROHC:2.+-,*))''(()-.-//124398841..17>IUbmuojqwvhZMA.%   JR $2PbT'!''),2@bДyiaRJ@"  [Ј…ЇТЛ§ђ†Йmeebbcaaca`j§€€€€€€€€€€€€€шµmvxytjZ[]^^_\\^acДш€€€€€€€€€€€€€€€€€ь√YgyМЯ£Щ•Уzrrrtt{ХЮwjklkuБАdPA30/,*))+((=Щ€€€€€€€€€€€€€€€€€€€€€юъуећІsZJ>30-1-,*(())'-,*-.-+,1//18::::9;;::=;89<9:504321.0100104247:<@CIMYgrЕУ¶√÷ощь€€€€€€€€юээю€€юью€э€€€ю€€€юьюю€€ш÷§lWUOPPPOOKHFEEBD@ADDEEC@BFMPOPMNONPNNMTm≥’ ЭБ•÷€€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сРTA3-//**)*'''%#%$"$#!"$ !&&&&(*,-/.-.-./../1/30'   8l_,       9>=HQdЪЄ≠tWYXUPLD<7MІ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€©`+!&-25;=@DEEDCEHEBD@EFFECDEDDIKHFCABCBDKGFHGINMOPNINQPPQQOSTTSSWWWWYZZWUUUSQOMPSW]ehd`c_XROIKHHLIDEJIKIH?57@MgЦЄ®p_`_ZVSQMIE;2+,-++++($(&(,--0333788740,0;FP`iiklkfdd_^QD93+%  BS" $0L_S+ "%'-3?]xgaTHA! `Ї≈ЂНЬ∞ЃУyhdc_aa`ca^_й€€€€€€€€€€€€€э—ouw{vm`\^]]^\\^`_|к€€€€€€€€€€€€€€€€€сМZnЕЧ¶£ШЫЖtqrtttШПmklloВu[N;30/+())(**>†€€€€€€€€€€€€€€€€€€€€€€€€юэыши–©o`QE;50,,++)-.+**)(),,--04669779;:;<<=?=B=59<96346250/3014468::<@CFQ[izМ™¬”вфь€€€€€€€эю€€€ю€€€€€ююэ€€€юььээц‘©oYTQQPSTOMHGDDGC?@CACB@=@DKONKMPMMQPKLTmѓ”ћЯЮ’€€€€€€€€€€€юъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э‘oD=4/.-(((((()'&&%##!$%##!$))(,-+---/.,---.1131,(  8K£€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€√v7!&+-257;@@EFCDDAEGFGFCFEBGJIHEEDDDFHFEHHLMKMOLLMNMMNQMQPRONRVUTXXXXXYXYVTTRMJIOSZ^flikneZNHGE??FDA@A:05@NfЦЄ®o`a`ZWSQOGB;1),,((((('*'(-,.1765888304?SclkmmjkndY[UJF@80.'"  :V* #)=ST,"$(+0960.,)(*+*'((%$&###$%%%#%**+-.,+-,.0.,+,/0140+%!#  9mc6          :;=<42/0**-./-,,-//.12223::;=>>>@=@@BC@BB=;=:79858667:977866;CGOX`kwИЧ£ґЎрэ€€€э€€€€€э€€€юю€€€€€ю€€юйµ{XVVTSONNLIHGEBEFDEDAEEBDIOMLMKLOPLJPQTuµЌƒФyЩ–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€нxJ=8400,*+,)(()&%&$$##$$'&&%'*..-..-//1..--..21.*"1kf6          8>?FRfЯЅѓs[[YTNKE<9N•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€І[0 " "#%&'-49>CBDFGGHEGHDFGHFECGJIGGHEGHJMHLLJLLMONIIJKKLLNPQQSUUTVWVYVWVXXWVURROIDBFKPXdkkgf\YN?68408@NfЪЊµx\_\]XURMGA61-,+))((')(,-00/241.7EO\orwztklmj`XUNE<::71-*'   +T@ !#+@W;!$%(*1GqЕreXJE2   f≤ШГЪііРrgfdbacb_``eОш€€€€€€€€€€€€€€€щ≥ltw|vi]\]]^]^[^afМэ€€€€€€€€€€€€€€€бmb}ЧШЧУЭХ{pqropuГХ}lmmlxИГt[K;521/,*'$(+)AЃ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЏ±lWD=71/32.-,./--02113359767CDGEACEBCA???<;>;:==<;88747>AGKOU^irЙЭґћёсю€€€€€€€€ю€эью€€€ьээ€элє~XTVTQNKLIGIHEBCDDDECFC?DJLKNMKNOONIMPSu≥ ¬УyЧЌ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч§]@:820/.--*&&))(%'%%&%%#&$"%),,-,-.-0.0/0-+-151.+$ -ja8          ?==GSdЪЅѓoX[WTKHF=7OІ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€іy?(  "'/47;ADGGCFHDECGECDGGFHEECDIJGGIKKFKRQJHLKIILLKOPLOQQSRTTVTSVWUUVWVTTPJFDA><>GLSZdШІЖbA2/7@MgЪЊЃw_`^\WUQJFC9/((('''')*(.-..,.5>JXbfuБwtrkggg`QE?:;<941.'%%  %OE"!$*8QA#'().BkАrf]KI= XСГФЂЇҐ~lfecaabbaaasѕ€€€€€€€€€€€€€€€€э’qru|wk]\\]_]_\]``{у€€€€€€€€€€€€€€ъµ[jВРФУФЯИsnpqorxЛТukmnkАП~hSF;710.,**(*+)Fї€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щџ≠ГrXIA:5100/-,../-00453647>;=BIF@EFBFEDCDAA@@A@B>><:99;=>BCDIR[`lqxДС†є”ль€€€€€€€€€эю€€€э€ьэытњЖ^WTTTOKPNIJHCBBB@CBABEAAKLJLMMQNQMHKOQrђ«√ПvФ…€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€л}H;9;611..+(()*+*'&&'&&(&%)(((,-+..-.,+020--.1343.%    -jZ<      F;93214EzЯ°ТmD-4?LiЬњђp_`\XVVSGDB9.*(&&&&'*)),-2:AGWfhhgl}Аrb][ZTLD<898:52/-)&&&&!  GL! $-7OF"!#(((,9c~uh^OI?   KtГЭ®≤ЦwhdaacbbbdcfКх€€€€€€€€€€€€€€€€€кВssyypa[[^`^^][`^sЁ€€€€€€€€€€€€€€жyasЕФХМФФ|pnmopt{ЙolnoqБИx`RF:72/--+**(*'Eї€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шўђЕtbL>>9300-0.00033:82589;;>?ACBCGKGEDCCGHEGEB>:<<<>=>?>?GQW^flt|ГЛЬµѕпю€€€€юьюээ€€€юь€эшс√К_SRUTPNQKJKDBBBCADCCCA@AHIHHHJLJNKGKNRpђ…ЅЛsП∆€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цҐdD<77763.,.+)(+-*'((&%&%&%*+)*,,,-,-.*+//-+/1...1+#  .zlA          %Q?7542/03/312169:9;;=?=BEJICCAAFJPOMIBA><<==<==?@GIIIJHJIKMILNSuµ ¬ЛrО√ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юеГR@<;:7410-/.+++-+*)('(()()),,*++..0..+.0---03./--(" 4ЬЦL        >`C>CKbШњ©m[]XTQJG>9PЂ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€іn:(!  #%(+.3;>ABCFFFDCCFGHIIIJHJMPMEFJNROLLNLJNOKLNMPQOPPROLOOOOQSQOMPQOOHAA?<421/.,+*-6@LhЩїЃq_]][WQJKH@62,'#%$#$&0F`pnyujozwpeXTQIB<::8:9;654/+*+)&''$#  6W2!(0IU*#!'((/SzzhbUEC' (S{Ь©ЈЬ{mfb``abecac~и€€€€€€€€€€€€€€€€€€ъґlw{{si`^]^`_]__`bМ€€€€€€€€€€€€€тМeoЕФ°ХШТzspnnps{Ж}njmnpДxgTH>=830./)'&)**L≈€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чеєПhOA846614132/5:897:;:>@>CJRSRPJDBA=<<=<==ACKRY`hpvy~ЕЗН£√с€€эю€€€€€€€ююьюцћУaVURRQPLLJJHEFDEBCBCCC@>FKJILIMJHJIJMSv≤≈ЅРqЙљс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш®mJA>;;7841.0---,,,,,*++)++,,.,+-,-./00-.200--0010/( 7ЂѓS         Wn@6OІ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЌБB&! "  ""$%'*148>BCCECEEHJHIFEGLONJMLLOMLMNNKMPOQOOMOOQOMMLMKLKOPOKKMONJHFB@=:9:6432//7AOhШљ©k_^\ZWRLKE?;2*"! $/Ockpighlvna`WLB955569867:752,,))&%'%$! -T;"%1DW3!#%&&-Mt{kbWHC, 7bБШ±∞Оvjcba__`ccagЪ€€€€€€€€€€€€€€€€€€€э“luz|wnd^]___]^__b~ч€€€€€€€€€€€ю»ak}ПЦЪПЦЕtqqrrsvГКvolnpsА~p]QB?>931.,*')(+*J«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еђМt`QC;88;625976568;9:<<9;>??DJOPPKBBF@A>===:=BFMW_gmtx|БВЕУ°њн€€€ю€€€€€€€ьтърќЫeUUSSSNKKKHHFFFGCBDCDB@@FNLJIIKKKMIMJSxі…јНpЗЈк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уРVD@?<;871100..-,,+++,-*+,+,,+-*-,,,+/.,,.0/,--,-0/'  &ОЯG         'rxB@EK_Хљ®jXZXTPMF?9P•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кЫG(! !!"" "! #&*1449BDEFIKHIHEDLLINONLONMKMNPNQRPPMMMMOOLNOLLMLNNJJJJJKNKKA@?9<<=8863/3APgЫЉІk_`ZZVSRICC=3+ !(A^_bjfeheYEBF?72,-/.36659:62/+*))'%%%#  )RC!"+==;9:>AIT\elsx}ЖЙПЧЮєд€€€€€€€€€€ющщщ№°jWSQTRPMIJIFDDFE@ACDC>>BGNMKKKKJMOLMKQwЈЌ¬ЗlЕґт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы∆tRLA>>:746003/./-*,/---,,+,,++/,-.++,-*,-/-.,.,+.00( Zs5#!        9МВD@GNaХЉ®lYYWTQJG?:QІ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э™U-!!! !!#$%*158>DBIJJJLIIIIHKKOQq≥“«ЖhВµэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шХ[MC=<;96253200///,*++-.,*+++)--,+-,-,*(,--,-,---.1-"  .B)         L§ЕD@IScФЈ£hZ[WSNRP=<;98788:6/3AOgЦЉІm^_[XYWQKB?82-"!%+5:<@?>=<:;8700---+*,..142020.,(,-(&'&'&" $$EW* !#,NM  &(.Ffzrf`PHC :dС©¶Мrfab`a`aaagr¬€€€€€€€€€€€€€€€€€€€€€ы≥nxz}wi][^^]\]_]^dЂ€€€€€€€€€€уОblПРПЫЫ}rqoqqsyГ|mkmosy|ymXMC_Z>732.-*+,(+*M÷€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъџµЫИq]HD@?><=959999:=@C?;?<=:;;::99:@BAHKLIJKMMKIMLNTpґ÷»ЕhВ∞о€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь—sIFAA<9:74683251/---+,-*****+(+,,*/.,-*,---/-0.,+*.+            fіЛEDIOdЦґ£jZYXTQUL@:Q®€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дР?%"  """"##"&*,4;@AEHHKLNMIKMNLLLQPLNNMOPMPMNMNKMHJIHHCFGCDCA@<;94348974/6@OgЦЄЂn]`\YVTLIB>93.$$#*19>??=95021200-*-,)**++*../,,+*')-(&&('&$  $(9]8 !'ET& &&,>\zvgaQJF% ImЕЭіЪ}mcbb`_ba`cd~о€€€€€€€€€€€€€€€€€€€€€эѕnvxyvj]\_^^\]]^^bНю€€€€€€€€юƒ\euИФКЕФОtqsqrsuГrjkmns{zweWH8\iA710-*---))+QЏ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыбЅЯЙp\KDA?<<<;:;:=>>;<9;<9=;7667<>BNW^gt~ЖЗЙЛТЧХТЪЄв€€€юю€€ьючща±tWUTSRSOMJJGDCC?>@@@BB>?EOOMKILNOLLPQSqє÷∆ЖhВ™џ€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чЯ\E?=?<<<63622441-..-,--***+-,(*-,+.,++-,+,/.-00/--,(          'ДЊОJBJQdЪЄ•jYZXSOJC>=R¶€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш®S,   !#"!!"!$&+06:@BGLPLKLLKQNSOMNQPOQSPMMNNMIFJIJDCGGEEC@@>98426:751-2AQdФЈ©l]_\YUSQKF?:8+(*&/1;=<<9321/0.--+,-+'(+*)*,./*&&''(+(&(*)&# !  &* 0YD$=V.%%*4QwxhcVJI-.XxТ∞∞Кsjbcc^_`a`bjҐ€€€€€€€€€€€€€€€€€€€€€€южxvvuwmb`^\]]\__^b}щ€€€€€€€€н~^nВПМЗЛК|rrtqruyД|mhikmvzxp`Z@3XlB80/.,-+()*+SЁ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чёЉ†КoUJECA?>=?>>>;::<:=;64559;>FRYaq~ЗЙЙНЦХСРТЦµвчююью€€ющъбґ{ZTTUQPRNLJKFCECB@>B??=?FNNLKIHLMNOQOQl≤—∆Вd}£‘€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юб}NB<<:;89841104200/...-+.--++*),,**-)*),++,-*--/0/.)$          :ЭЊЙHBISdЮЇ¶iXYUQOGC@=RІ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љn1 !!"$!!"! !!$(+.26=EGLNPOLONLMPPOONNQNLOMNMGHJJHHJIFDC?>>:534;:74/-7@LcЦє¶m_^\XWTROHA;7-(*,/389994...-.-*+,,,-'*,**,,+++)&%))(((*)&%$"#$  '+ *RN$4U;#%(0Ls|peXLI6  :`АЪі•}kdccaac_``czж€€€€€€€€€€€€€€€€€€€€€€€хУrwvyrgaa^\\Z]]^avн€€€€€€€эњ[hxЙОЙЛТБrqrrpsx~Вrjiilp{xtdbR7B^iA810/..+'),,Uа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш„ѓ£Сw^PGEFCAA>;9<<;97789959=GPYi~ИМНУЩШТНИzДѓџфщюээыэюшџЉ\VTTPNMLJIIFFGC@AAAA>>DHKJJMJGJIKONPQhЃћЅБbz†”€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ•`GA99;8788564/20-/....-,,*+,,+*(*+*+(**+,+*,,-,.0/.,$         Q±ЊЗHBIQd†Њ©pYZVSKED@>SІ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷Л="   !$& !!"! !"%&"%*-3=AGKMMMKKNMMMLNOOPNMOMJJLMIDKJHDB@>@<4637377./8?IdХЄІm_^[YYVPJDA<4+%&*.365540-,-,,,)+,-**()+**,*((*)'()'''()(&%$##  (*'GY+!+OL !!#$*Bi{sg\OLA #JoИ£Ј§|gd`cakg^__hХ€€€€€€€€€€€€€€€€€€€€€€€€ыЈpwy{vkbc]]\Y\[_am”€€€€€€€сДbrДНЗГЙКzpqrrqrzБzllkkntzvoZ^A4F\lD8420-.,)+,+Sд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыяљ¶СzZQJEDC=<;8778876478EHJNOOQORQMNOQQLHKHKNOFGFEIEA?>:436753623>=IaФЈђo]\ZYVUQNHA:4,#$&*.2001/,--.,+**+,+**+)*,*'(*))'(('&((*('&  )*!#8]; &EU( "$$'8b|ug_QJF) 4\БТђ±Ъxiea_`ec___r”€€€€€€€€€€€€€€€€€€€€€€€€эѕnsv|zoc_\\\[[[_afµ€€€€€€€√aj}ОСЕЗ}trrqssu}БskmlmouwrbSO86AeuF731/-.-'*+*Wз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цёі¶ХzbTICA=;9677799;86?PiБТЬЭЫФЙ{cG?PТќх€€€€щщэх≈Л_WVWUQPRQLJGDCBAD>?><>BJMLILJIOMLHJMRl∞” ЛayЪќ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь®gHC?=;551111732//..--0.--,,,+-+-)*,,-+)*++*'+--,,//.*          !*В¬¬УIFMSdЯЅ≥v][XTNMHA>S•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хґ_,""! "! !!!$!!!##(,19AGJNNRQKJMRNKKKKIIJEHEFF@><=:4157744:1;@JaТЄЂm^^\ZUSOMK?;5-$&*--.///.+++.,*)+,+++*+*)+''****(())(1()% (+ !/ZG #:W1 %''3Zywi`UJK3CjЛШІЪАlhcbaaabbagЗш€€€€€€€€€€€€€€€€€€€€€€€€юзxsu{zrf`][\[][^dbХ€€€€€€уГcpГПКГЖГurqrrut{Бzlilnlovui\iS47SЙ{H6510-.,*)(,Xи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цёƒ≠ЫkQIC=9988;<@967CaАЧЯЬЧО{eI629hЈац€€€эъ€ъўХeYWUSRSRPKHFDBEA?=>@GJJIKJLMMLKLLOk≠ѕћЛ_uХ…€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юдДVGA:9?;4353261010/-+./0/--.,..++(++..,,-,,*+/-1//00,&          !#"$7Х≈јУNHKTcЫЅѓr[[XTOOJA?R•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈m3  !!""! !! ""!! $&-4;@KONMLPHJKKLKIGEFDCDC@>=934265844-6CO`Уї™na_[YVUNGCB;5/%$).-../-,**),+)**+))+((+,)('*)+*&(**,0!#  (+!""(LS""1V<!%$&1PrzmbXJI? 'PyЦЃ∞Лqffbacccccdr“€€€€€€€€€€€€€€€€€€€€€€€€€€фОquyzre^^^\[]\[_^yщ€€€€юњalyЗИДЙ|qqqqsvvААphhlkmrus_rЫc1:h•МN75//.+)*+*+Wи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шЌЃШyUJ@9;ACGD=7DhКЬЫТЕ{fL5/,/LЬ‘х€э€€ю€ц÷ЭfYUSQQRQKKDDDCC?AA=>A=?EHHLPJHFIKLMJOl≠Ћ…М^pТ∆€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыЂkK@>99<875255261/0//.001.-,../-*+++-*,,+,,,,.2/21131(          $&%'O∞ЋЅТMEMS_ШЊђoZ\WRLNGB>Q¶€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–ТC# ! !!"# ! !"$"!!).5=@FKNKKIKKIFCFEDC@@?<97414742/-8DMaХї©n^_]YVURLIC>6/'%)/----.+(*)(++((''++((**))())()%&('&"  ('"!""@X,"-OH"!%-En|rc^NGD$5aЖЭЄ¶jgdcabcbacfЕъ€€€€€€€€€€€€€€€€€€€€€€€€€€эЃnsv|vi`_^[Z\Z[]^mв€€€€еydvВМББКВtnnqqrv}Жyjgjlkpvvn^Сґe3??CHIKPPKHHMKLLMRjЃ– Н`rР√€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъУ`D?<;:98653223<41/14/0//0---,(.,-+)+),))+,,-//..--.-&       !'+*-bЇ»ЅРKDIR^ХЉЂo[[YTNLFD?U©€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф∞X, !" $ "! "! #"!"$(/6AGKKNOHEDDC@A>?>:9673363/.-9AL`Уµ®p\_]XTTPKKB>;/$$+.-//.0+))+()*)('(*')+*++))**)&%$#!! )' !/V:!&CS&"$'?>=DGEHMJHIKLJJKNTmѓ–ЋЛ`qЛњэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЃuRC@<9:879974/00001-/..-./-.+,)*,,-,,*.+++..-/-/.-,*'"       $(++3|ƒ »УLHJP_Фї®n[ZXSNLGCAUІ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∆v6  " # !! !!! #&-48BJLIHGGA>>?<:724763112/5@J^Пµ©o\\[VUTOLFA=;/&#),-/1//,(+)+)(++'*)((++,,)+,)(#! )(  &PK!"4V0"" #4Z~kaTKO; *U}Щљ≥Иrfcbadaabdfzн€€€€€€€€€€€€€€€€€€€€€€€€€€€юиzsv|zqf_[\Z\\[]]a∞€€€–^hw~Аz~Е}rqqrrtv|Аsghikkqvuj_СдЎd4D{Ќ§L713/-+*+)))Tк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЛjht{БЖБvЕЂ¶{A,,.1.,1`Јдюэ€€ют””±v]YVTSRMJJIGBCDEA>@??>BGHKIJLHIHKKMQRn≥“ћЙVkИЉщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тНWF>=97678935413/-,,,--/,+--*+,+(+-,,,--)*),-,,----/*%      !'+1@Щ» ∆ОJFINaЧЄ£j[YWRNKFA?V¶€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№ЬL' ## !!!!"" ! !"!)08:BIIFDB@<96204323011:?J_УЈ™m^]ZVTSPG@A=:/'&(+/0211-)*-/))*))*)*&*+**'')$     '% "?S+ )Q?!!!#*IxДtdULQH  5_БЪЄ°ykb_]_`ccbekђ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шУpuyzui`^[[\\Z\]^Мы€нВ_r~Д{Аtppprsuzxgefeimqso_n÷€оb8MМ–°N823/.,-*)**Wп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю¶ЙЕЖ}oe^p{V9-.//.,+2aЈаэь€ющшя„Є|_ZVTRPPKGJIFD@FBBA@>:?FJKLMMLKLONNORm≥“ЋЖUhДґы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эµrLA=<964757152051,,----/-*+,++,,--*-----')*,-*,..-./+$)        !$+6W≠Ќ»√ИIDIOaЬЊІj[WTTOIHB@X•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щЉ^)#! ""!"!!$ ! $"!!"!+679>CB?;634442./436@K]ТЄ©o`^\YVTNEA?;8,''),/./0/.*+.0',)'*))*&**(&#!     '&-P8!%DM! #(?nДzgYPRK3 DiРЂ®Иocb__baaabf|к€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юіquvzwja]ZZ\\Z[\\lо€£Vjv~~{Бxpopqruv}}pfhhghnssf`•€€й_;X°”°M642.-,-)+,,[р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шзЭМДresgLKA2,,...,,+3aЈўю€€ьъыьгљ`[WUSSQONLJGCDA?@A?>>>HKHJKMNLLPNPNOhЃѕ∆ВSfѓю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эТZB=96657594121/50+01...-.,.,-+,10*)*--*,)+,,-,.,-/.+(!         ##,>tЊ……√ЙJAHQ`Юј£j\XUSOMJC=S¶€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ќg/ !!!#!"!"!! "  !! #&!#(08;<;9:876-1935?I]СЈ®n]_[WVSMFA?9;2)(),.0/0//,,./)+)&()+)()&" '' "ED!3R- (9`Г~j_MNM> &MuФ®Ц{fb_^accda`k¬€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юћqss{znb[[[][YZ\\c¬–[_puwv|Д|qnooptty{vkhjiilqvo^uи€€лe=_І–ђT73/.-,.*)+,_т€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эиЉ™Жznaa}ФjB821.//-,*+*3cє№€€юю€ююг√З`ZWVSSPORMHDEFCD>@?@?AGKKGKKLJJLINMOgђѕ«ДQdА≠ч€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЄoHB:;;8864412////...-../,--.-,+-/-*((+-,+,+++*-,-/0+'!       %+2EП∆ћ…ƒПJAHRb°љЬi]XTSNKGA@S£€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќq9!   !" !  ! "'(,28==;44=88?HaХґђr\\\WUTRGA=;82&&(,.010/0.+-+*)((()*%%!  )' 2J'&L: !&2S|Бn`RHIF) 3bАЫ§Жpfd`_cbcbbdwо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иwrsz|qc\[\^\ZZZ]]~zXejqqs|Аvnomnpsx~xmggjhiqtuddє€€€лd>d¶ ІU:5//.,,+),.dч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъкЅ®Дwj^WVwЧ{P9//0/0/,++++4m√л€юьщюыэс»Нc[WUROPPMHEHFHDEB@@@>BGKLJMIKMIHKMLOfІћ«ЙSb}®и€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЬWB@<<9874541540,10/0+,0.--/-.,*,+*-**+****+,,),,+,.)"    %,7PҐ∆ …ƒНKEJRbЫїЯi\XVTRNFC@TЯ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷ЭJ#"! !   $-36:>J=6>IeЪє©n\\[ZVSPGF@<71'))+0211///-,--,+,,'#  ,( !J2 >G  #"%.EpВraWKJO8 GnЗІЮ~hc``abbc`dj≥€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъОnsy{qc\\\]]\YYZ\aY[cgmouxxqonmort}Аufefhjkrun^|ц€€€лb@e£≈†S981./,+,+,-dш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щл»є£~pcYY[]]d^D730////-,,,*/BГѕпыющхэчффћШf\XWTQROMJHGKFFDB?C>;AFHKKLMMLJHKMNPd¶  ЙPayЯ”€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мЗN>;;99945654252./1.24-0---,,+,-.)',-+,))*+++..,,-,+&       "%*3_≤ Ћ»≈ИIHJQaЮї†iZXWRPKD@?U¶€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хѓV+ !  !!!!! ! $&)2D;5>JgЪі™n\\\XWWOHGA<;4/+,.0231/200140-*%#    *( ;C 4Q/ "!%+9`~xf[OKQD"'PsЯ≤Нqga_`bb```e~н€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€њmpuzsh^^\\^]YXZ\VTZ^glqyxtqpppruy|ulgefhnqsqbpЋ€€€€л`@d†ј¶T9750.-,,,+,hъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьпј™Вwi`\fkc_XI;32012./-+***(+5SЫ„чьюьэьэжўЌЮi[YXWTRPNJLKIGGE@@C@<@EHLJJGJJIFIKKNe©ќЋЙM]vЬћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€§^A;<=586103332/..,656<.-..*+..,--+'*,,+(+*)++,(+-.+&#     "&,4nї » ∆ЗKGKPb†ЄЬh[ZXUNMG@@XІ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ≈h1!  !!!# ! !394>KfЧ≤™q^\ZWVSOHEA==70-,./34336650,'" !   ('! !  #E,!)F? # $(-Mw~n`VJLN?(:]{°Чvhc_`_``^`drў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аpnsxulb^[[[ZYZZYYY[^gpv}yspooqsz}vkfhffjqrsgdђ€€€€€лdCdЭЅ©[9640,-,++,-eц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шо«≥Иvl^X`}Х{UG:20210/,,-+&'&')0ADJMHGHKJHGGKIMdІќ…ЙLZuЧЋ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€„q:8?<96452510101./.132/,+-.,)-/-+,,++*,-+***,*,)),.(#        %-AК∆   ≈ЗLIIPeҐїЮj]\YVOOI?@S§€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘•U/# ! ! !!!!""#"! !!!375@LfЩЇђm[\ZVVRLFC@>;3*+,./2:6640)!# (("#!" 8:!0E'!"#*>hАqdZLJPK?Jd}И}na^___^_abfХш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш{mtwvpc]ZXYZYYXWZ]]cmtx|xsonnps|zmjfffhmpni\xн€€€€€кeEh°√©Z730/,-,+*--dх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юълјµЛАoZU]r~ИxP:4/000//,*-+)&('+07MЛЌрьюэююъшй„“Ѓv^XWUTTROONKJHABAA?=@CEEHIFIKJJMGHILb•ѕ ЙKXtШ«€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЬM8><755356654//2.../.0.,-0--,--,*+-,++*+,*-*,,.*-+)&#   &.N£ƒ««∆≈ИIGMQa°ЊЯi]ZXSPPKB>T£э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕm>"! !  "!! " !"#%! !  065=IaТєЃr\YYWSRNHDC>:2*%+.0270)% #  *)!$"%?%#B2 %(2W{vf\NHMQNSdvxmd]_____bddqЁю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Оktuvrf_[XWZXXYYY^_itxzxuqoppqxyofgcfflpqm_dњ€€€€€€в]BkҐ¬ЃY82.//,+-,-.gч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ычж∆≤Й~vbV[n||gP=200/10.---)++)''-04CkЃбъ€юэ€€ю€ьа’єaYYYWTRONLJKJDA@AA>BDBDILJFKLKJIJKOb®ѕќНLUsЯ∆ю€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Њi@B><:76574300/1////../.-.,/-./,,.,+-.,)***,---/-.*&%   '-^њпццу≈МIDKQa§ЊЬi]YVSPPHB?W£э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€„Д@#!  " !!!!#     377>GcЦµ≠r^YYWSOLJE?>>4'#%*,,&" !  -*""!70!5<  ##&1KsyfaWMPPQS_hke_]^__aaccf≠ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≠npturi_ZWYZXYXXZdfqv{zvrqpoptyofefdghprogaНщ€€€€€€џ\?o®ƒ™U:4.0/-+,,+0hш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юцгњЃИ|tdXXm|{iN;0.0/.-.-,-*+))(())15?[Р…ою€€€юыэыъсбЅИaZZXVURRQNMHKDEDA@@@>EFGMLHGIJHIMNPb¶—ѕНMToФЅю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ШK>A<<;635333.2412000-./,/,+0/--++-,,,,,)+,,+,.--.+($"  %.oџю€€ь∆ЙKHMPbЯЊЮj_YUSPOHA@V§э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€б§N'"" !!! "! !"" !!" !! 6:8@EdФЈѓq\\YXSQMHC@@?5$  # 0*%" +:  )A(##'/Bgzh_\LMRQQW\[]ZZZ^ac``asе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∆nlruul^YYYYYYYY_tvwyyvtsrpnrusifhgghlqph]vё€€€€€€€”Y=l®≈ҐO;400--,),,,mъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эхѕЉЃЗ|pbXWe|БlN:22/./0/,-++-+),)%'*,2@X±жы€э€€юэьфъ€н«Чi\ZYXXTTPOLIIEHECAA@ADGGMNGHIMKIKNN`ҐЌЌЛKRjВєэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Њr><<<=:633...031/211/./0,,-+,,----,,-,**))*+-.-//-'$!    $1{йы€€ь∆КIGKO`Ьњ°j\\YRNMFC@W•э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чƒ_/## #!"!" ! " "! !    8<9>IeХєЃp^]YVTSKFA@?<3" +)# /'$!!  6-!95#!!)6Vupf`TOOORUUUWX[\]^a_ab≠ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№xtxxxpaY[ZY\`abgИТД}xtsssqruslfgghikponafї€€€€€€€€ќX?iЮ¬ҐN:320./-(++-oш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьрќљНВxoaVTatДyV=10/./.-.,+,)+-.))*()09CWx¶—х€€э€€ььыч€ш№»Ыk][YWUTSQRLIFEFEAB@@BFIHJIHHGJIKNOOdІЌћПNPiАіъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЮXB?:>@:5331./04.2/.01-//-.-*++,,,....+.-)))-.--/0.)#   "6Ййю€€ь»ЛKEHRcЭЇЮh[[YSOKGC@X©э€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—t;! !! !  ! !""  8;9>IbУЇЃr^[WVUQIF?@>;4!"+)' ,(!! (8/=!" ",Akvhc]PLQUTRSTWZ\\^ba`iЎю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иЕЖАzrcXYYYbggpoИІО}vssqqsvulffgijkoqph^Жц€€€€€€€€–XAmЮљ°N663/.-.,*+/rщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юысЌµЛБ}m]QU]nyt_D2///--.,,,,*,+--.+*-06CQ^x†Ћпы€€€эюэюэ€€ъи—Юo]ZWWTSSRPHKJFGECBC@CEGHIHIHHHIKMOPbҐ…ћПMMd|∞ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ё~IA=;=<753341-,/./1..0/,,-+-+,*+*,,,*++,-+(+-+,./-+($      ">Цх€€ы€ МIELS`Ц≠Шh]WVURLHD=T•ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ё£O("!    !!%!  !!!7>8. #1[xmbbTLNRSROQRWYY^b__Др€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лЗМФЙБtc[WYYa[_ntyУЙxssrpquvoddggjklqrl]m“€€€€€€€€€ЅTAr†ЉЬO8630.,-+-,/qщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъм ЄЙ}ui_TTixwn[C30.-..+--*+,*+++--,-/7?L[h}Ґ«пюю€€€€ю€ьююыьы’Ђt`[VXVSRRQPPLILHDEFBBDIIIIGHKJJIMOO_Э»ћНLKax®ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞bD><9::855641../-+--.-.,,,,,,++*-))*,,,-.,)(**+,*('$    #O•ч€€э–∆ЛKFHO`Х™Чj]WVSRPG@=T¶ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цƒc.!"   ! ""!  ""8<;751//-,+*.Шщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш№¬К|ui^USWhqrbF93/./,.,*(+()(*+***,-4=FS_nЦ≤≈аь€ю€€€€€€€ью€€€€нљЖf`[YYWWUTQPOLIGFDDBFFIIGEDEFEIKKNN]Юƒ…ОMDZqЩЌэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃiJD@<98:77833211.///331-,.-,**-.-.-,+)*++,*)+,-+-,($    $jЁэю€€€нМJFHPaЦЄ°n][WROJFEUҐщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пЈ\)""!"!! !! ! !! !   8;9=FcЪњ£gZ\YVTOGFFB;;3$! 0'"#!#;* &;)" (Iqthd_QLNRUTQTUW\ccЈы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≥О™¬іСtaZ_eksvvvvtrrommtqlhhebeilsuockƒ€€€€€€€€€€€€ЂMBtЮЅІS9442./.,,,/Лш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ючбњєУ|vg\WXjvtjV?1-//.--.++*(),,--+*-04=HR\hvКҐ∆кчтю€€€€€€€€€€э€€ээющв∆Хi]]YZYWTTSMMMMGJGEFGHJJHIIGFFKJJNO[Ь…ћЧO@UlМљы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€їiJB?;;6;841353//030010-/0/-,+**+,+,-,*+,+-,*,-.+-,*$4Кп€€€€€хЛKDHOaЭЇђpZ[YTMLJAFdЧЉЯf[[ZVSQIEF@=<4"&# /&#" !  /8 44" !$6bwmfaVPNSTURQSV\^hяю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъНЩЈ’√Рpa^gmqvyyvtqqqlkqwnhgfecejoutga©э€€€€€€€€€€€€•MAw†√£P:621...-++-Пш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эъзЅ•Бpne^[grs|uVC4.--,.,+)+**((07342.36AGS]guЙҐЋдч€€ь€€€€€€€€€€€€€€ю€€€кЋЭo`_ZYYXWVSRNLOMNJFFFHJLIHGGDELLLLMZЭ»ќХO?OjЙЇы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ШSHB:::59962430..1////2///.-,,+),,--,+-++,*+*+-+)+*'" ?Шф€€€€ьрКJCIPd•ЊЂnZYWTNJHB>W£щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вНF$ #"!$ #   $"!!!!  9>8=FdШЇЮf^ZXWSRMFA><=2%&$ 0'!  6+ ':)!"*Jpqe^[RQTVXVSQVWXsп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жТ™√”±ЖqcdousuyxtronmknqnifecfgjousjcУр€€€€€€€€€€€€€ҐKAx£ЅЪK=82-.0+++)/Тш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьф‘«ЃДvi\XXbxХКdL;04.-..-+-+&'''(/>B9459BJT\hxЙЮ√аъ€€€€€€€€€€€€€€ю€э€€эю€€ф—Іta^][ZYWVRSQMNQPMJHEEHIHGGGDFHKKJK[Ю…ѕЧO=MfГєы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€¬pFD@;732763300..-,.-..//./-+)**,*+--*+,+,)**+,+*)+(!   L¶цы€€€€пНLFJQgђЅЂo[XVTOMIC@S°щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кє_0 #!""!""  !  6=:=962573200210..+-.//-,0+++-+,,,,,,***(*,+*-+*+()"""  [≈фю€ы€€пМJDGN`Ґ√®n^YWUQMIC<;5   $# .&"$#"4/ %;+ !)JoodaYTRTTVXWUU[∆ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гЩНЯђ§М{pwztwvusmmjiknqldbfiffkpstl_gЉ€€€€€€€€€€€€€€€£ICp§∞tF94300--,.*/Нц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ън–ЉЛ}zoeZU[myypX@92/..,+,,,+))&%))))8KKHKTakyЛ†Ѕбч€€€шь€€€€€€€€€€€€ю€э€ьююэээюгЈАe_\\ZZYWSUSPPMJJEDACHJIJEIKJIFJLM]Ю —ЫSW§ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еДB"!!" !!!#!! ! ""488;HcТє†f\[ZUSPIFA=>:0    $! /&!"#  8%-5  "#"7`qga`WPRTVVWXWWЇъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юмЫ|ЖФШСВwuАГxvsqniliknplgddflihovun`^≠э€€€€€€€€€€€€€€€§JBwҐЯfA744.10,-.+/Шш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъпћіК~{mcZV_lАБgN<0044/-,*))*'(+)('&)*-=OSWakyК™ƒЏу€€ыююыэ€€€€€€€€€€ю€€€э€ю€юь€€юйјИh_\\\[XWTUVSQPNJHFCFJKIIFIHGHHHKL\Щ»ќЬU;E^v§м€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ђ[?>?<70223651.10/.0/-..--+0.-++--*,))*%'*)-)')*+*+(#! !! (xк€€€€€€тНPFJP^ЫЅ®l\YVQJMLC@Z¶ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йІU'!%% ! ! !! $$!  ! 8=6;FbУЈЭe[ZYVSRLHFA=:1    " %" 0# "!12 3+#$#(Iooba^UQTUSTYWRЬч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьвЯz|БЗДГ}wxzyvrlkieggmolgdffglijrwp`ZОх€€€€€€€€€€€€€€€€ЯGCА£Эf?961.00-..,/Яш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьмЋЈИ}wme\Y_hy{jM710.0/-++)(')(%'+)(((+2>KXal|О©«йц€€€юыюю€€€€€ю€€€€€€€€ю€ю€€ьюю€юъг≈Тj`^\[[XXVSTTQKNKHHFHHIHFEIGFFHKKMZЦƒ ЫRIX^k|Р™ иъ€€€€€€€€€€€€€€эю€€€€€€€€ю€€€ю€ююэ€тЌЭpa``\\YVWSTUPLLKJJHGJHGHDGFFGHLIKZЪ«ѕ†S=A[oШ’ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ wJB?:844342100/.--0./0.----*+,.+,+**)+*+***)))*+./)%!   (DЭч€ю€€€€сКKFMT_Ґ¬Ьh[YWTOMKIAW£ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еЕB#$"""  !! !$!" ! 6:6>;2  "  !" # 0& ! 9& .1 !%$%Agla__XTSTVUT^Бе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъя≤yotuttuzzwusnjhheghiijkfacbbfoorvtg\k√€€€€€€€€€€€€€€€€€€ЩBF}ЯХe?4350...--)3ђщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юып“√М{tla[eor|{eL8310/20.-,,,,('()(')+.6>FS]n|М©«еъ€€€€€юыю€€€€€€€€ю€€€€€€ю€€э€ю€€юь€эыы‘§tb`_]]ZVWWUTTOMLMMJHIGHGGGHHJHFIL]Я…–£[A?SiОЅъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€іcF@?;:8:832242.0/010220,+,,,,,/-,*,+*,,)*,++*+,--+(# "   J≤щ€€€€€€шСPGNS\Я√†h\YWTOQMIATЯц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€к°S)"! !! !    7?8:EeЧљ¶l\XWTSQMFCA>;2#  %# 2(   */ 5)#$"/Ulh`^]YUUTVXW`љы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щн≈~nqqqrrrttvuqmjghfehkkihhbbdbcjywxui[cµэ€€€€€€€€€€€€€€€€€€ЫEGВЫЦm@533/./.-.*5іъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьйѕЇПxl`]`oКМq^J9.0010//.+***))((&)(*-3=GQXesЛ≠…дч€€€€€€€€ъю€€€€€€€€€€€ю€€€€€€€€€ьэьь€ььчЎ±|e_`]\ZZYYWSSQLOQPMJGHFEGGFFECFIK\Э»–•_B>QhЖєч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЩTA<;;8592252330/.//../.+*,-.,-,-+++,,+,+./.)++,.-)&!!   P«ь€ыю€€€щСPLOS^ЫЊ°jZYXSQRLC>U°ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€у√d+#2! ! ! ! ! "  9@;9FgЦї§m\[YURROIBBA>2!   *% !7)"!0)!'3& "%"%9cpb__^WSUVWXZn”ю€€€€€€€€€€€€€€€€€€€€€€€€€юъиЊЩtpqqpqurtsttskgggffbekkidd`beeglyzvk^]§ы€€€€€€€€€€€€€€€€€€€ЩEDЯЪj=761...-..+5µъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыкќґЛzmb\cp{В~bB300///,/,),+)))*)')'*.6=GR[fsЕЪ√иы€€€€€€€юююью€€€€€€€€€€€€€€€€ю€€€€эююэыээуЏЇЕga_]][YYYWTRPOPPOLHHHHIIIFEFFEHN\Щ≈–ҐZA?Oe~∞ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЉoH=<;:7333112/30.../.00--,----,,,,)+-/,++/0,*+,+,+'#  # ! ^–щ€ю€€€€хНMFKR\ЦЊ£k[YVRPSOF?WҐц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь№u82% !!" ##" ! "" " 4>::0$ !!'$ "3'" "0%+/"%&"'Kkg``_[VUUWWY\qєзъ€€€€€€€€€€€€€€€€€€€€€ьуџЊХtmpsopqsrsuspppjgfccfegjgeadbcehhmtul]\Ыс€€€€€€€€€€€€€€€€€€€€ЦBAx†Щb>8430/--0.*4Єы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ющв«≥Нzlb^gwБАpXB941310.../+()))+)++(*08@JSZguЖЬєѕх€€юю€юыэююэюэээю€€€€€€€€€ю€€€ю€€ююю€юьюцшюуЁ√Мlc]^]][\ZXWVUUOMMGJFCHJHHHJMHCFKZШƒ ЭZB>K`w≠ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЧR@;;:84313020/123011100//,,-)*.-+-+,+-..*,,--,,,*)%#  !  !!# !!!"'pбю€€€€€€фЛNDIR^ХїҐlYVUQOQPF@X§ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дКF$ # !" !!!!  4896345000/.-/,)((&'*)*,/7CKT\fvИ†Ї’нщ€юю€€€ьъью€€€€юэю€€€€€€€€€€€€€€€€€ююэ€юьюэээм»Цnc_]``]][XWWVVROPHDCGJHHHFPKEDILVФљ∆ЯZ>:H]v™у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€¬mJ?=:516631/031..;720/010,+*-)),+-/-+,.36-+*-,+-,*&# "  !! " !*|нью€€€€€фИNEKQ_ФµЬhWWVRNQPD>XҐц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€н¶Y-!#"   "   !4::>HdЦї†hZZXTSRMECA>=4! "#")& 0$"  %.! "*! !%"";bnb_^]YVVZXXY[_eouСЉЎестчььыыщупв÷ƒЂ~pklmpoporpommkffjhjjhfeghedc`bddfedejqqj_YКя€€€€€€€€€€€€€€€€€€€€€€ЧED|°Ш^=6312.00--)4єы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юуё»ФВАxmcai{ХЦД]@402422..-,-.,**')()*,06ANV]hvИ†Їўрю€€€эю€€€ьью€€€€эю€€юю€€€€€€€€€€€€€ы€ьэю€ээюююючѕЭoba_aa^][ZYXVVTRRKEHIIIJKHHEGIIHSПЇƒ†\@9BYtҐн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЮYF?;<236520022.0-2//1/.21,*++)+))*,,,/.42.,)+----'" !#! 1Йт€€€€€€€сЛKHLP]РіЮjXYXOPOOH>XЯф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€х„{3 !#!%81#!! ! 4<;>IeФїЮg[YWVQQMFDA=;3" # ! !('! $1&""#!(.#*'#$#'Ikka^``ZUWWWVVX\addku|ВГҐ≥єґґѓМАxrlikjloopopnnlgdcb`ffgjhfcbhgb```cfceggglnh]YЗа€€€€€€€€€€€€€€€€€€€€€€€СABzҐЭZ=5321/./.-*8¬э€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юф№љРД~uia`qПЧШЕ\B543030//.-,+,,+)+')+.3:DLVakyЛЮЊ÷м€€ьь€ыю€€€€ющь€эьээю€€э€€€€€€€€€€€€€€щ€€€€€ю€€ээ€х’©xfaa_^\]\YYXWVTSRIGJHJHIHHFDDHEFRНЉ¬Я]B;?VnЧею€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»|P>:9;;5464036410/-,/310//.-,)+*(),,--..-+-,,,,,-*%!     #$$ D™ф€€€€€€€рЛLEKP]ХµЬjZXVTPMIGAW°ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€л~2 ##1dG/!!! !! 6<;>HcУЉШf\ZYSPOKGEA>>1 $#! '*$ $.#&$$ +.&$-&"!#"-Vpf__a\WTUVWWX[_baefdfhhiklkihhgjjjmllqmjjjif`]__`adffhigfddfabacdebcgikjf[WАџ€€€€€€€€€€€€€€€€€€€€€€€€УCF~•ЮY;432/1.0/.+9јь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эхЎЅЦЕ|skdgsИЩ°ИbD63453////--,.-)+**(,-4>GQXakyМ†Њ÷р€€€ющщъщюэь€эърь€юэю€€€€ю€€€€€€€€€€€€ю€юю€€€эюээюъычџі~hec`^[[ZXXXXXUTRGDJJJHJHFEECGHGRЛљ∆£^A:99=;365730120...//0//-/0/-,*()-./-,---,,)+-./+($!    !$$%$WЌщ€€€€€€€мИLFJQ`ЩЄЧe[XVSNLJIAX°ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ж~8 !# &1*$ "#  6=:>GeШїХc[ZWURNIDCA>;1   !#%!()" %.'$""   +/-("+#!"""9`lc__^YUSSUXWY\Z[bggdbfecdfghiijijjjlmgfdaa][[[\]aaceggfdb`b`_bbabcegije\Uq–€€€€€€€€€€€€€€€€€€€€€€€€€ТBHІ£^;33100020-*5љэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юн–ЉТГuhbgwСЭСx\B7222210/-----,,+)+)*-8AIRZam}Н•Њ„п€€€ыюэьщхш€ьхюющфю€€юю€€€юэ€€€€€€€€€€€€€€€€ююю€€э€ээ€ъаЊДjgd_]]]\ZXZXXVUSKDHJLKIJHGHGGHJSЛЊ ™_B9>ShНЊч€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕЕT@;:=963635332/.1/./.11-*+.0/.--/-,,,+,.+,.,*,-.-(!  #  ! !##!"$#&))lдю€€€€€€€зДLIKPcЬґПdYWUSOKLG@Y£х€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еРN%!""!"!!!!"  9=:@KiЩЉФd\ZWVRQOGFD?80" !  !'!!&&! &11*""" -/-)##' !##)@ema_`\XSQSXTWZXW\`cfgghcbgfghhhefdbbgc_\]][YXY]]^acbffc__`b``babbdijhd]Wy√ю€€€€€€€€€€€€€€€€€€€€€€€€€О?EАЂ°_:5543/22/.*5љэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юо–іМА|siaaxЦЬКiP?64730/0.,-+-+,,,+*),/4@JT[bm}С¶Ѕёф€€€ю€шююъыщш€эшьюю€ы€ээю€€€юю€€€€€€€€€€€€ю€€эю€€€€€€€юэг÷ƒМmib^]^\[[ZYYWVVRLDHLMLGGGHIHEGMTКјћІ^C:;OfДЄц€€ыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЄnI==;;997:755231162.-/0/--...---.--,,-,,-++*+.-.-(%!  !!!   #$" %$$&(:Йн€€€€€€€€бЗNEGNcЬЄСdZXVRNNMF=Y£у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щр•\)""# ! !  7<8?IiЩЇХe[\XUSQLIGC><4   $"#%'! (3./""! #)+)!#"#%+Hjjb]\\UTUXTTXWWZXY]cflihfgfcbabbb^^^`^][Z\[Z[a`_bfeed``a`baadeffekjbZV|–€€€€€€€€€€€€€€€€€€€€€€€€€€€О@EВЂ°b;7442220..)5Ѕю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юкќШЕvnfcizИРНnM:93232//./.,+****)*+,07?HSZbn|Р©¬Џц€€€эюь€ь€ъчюъшэы€чъ€юцэюэээ€€ыю€€щю€€€€€€€€€€юэью€€€€€€€ья÷ЋЧqhca__[[ZYYZYVVTKFDJJGHFGHFGEKLQЙљ ¶`C<;Ka{Ѓх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гЭ_E<;;<9437430/311/.../..0-,..-+,,***--..--,+,,++,'% !!   ! ! "####"%'%++Sґф€€€€€€€€зКOGHOfҐіМbYXVPLNOG>[°у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€фѕy8 !%"  !2<HЕ©Юc>62543/.-.)9»€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъл∆ХГ~vob`kЖЧЩЕeJ>956520/..-..,,*)*)(+37@MT[eqР®Ѕёх€€€€€€ю€ъщъчшюьъщььшьшьыюьэъъю€ь€€ращ€€€€€€€€€€€€э€€€€ююючшх擆rbb``^Z[[ZYZXVXSJFFDFDEGFFFJKKIMЕЄ∆ђcC>;F^v®ою€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ѕ|RA;9;<:555221/3010,.0///-,,/,+,*),-*,+,.,,+)(+,++'"   !#$ !!!" !  #"#$"$%)(+0lЏю€€€€€€€€зЗMEMQf†ЈПcXVSSOKNG@[Ґу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юєМU. " !!  " 4:9>KiЪЄПd\\XUTRMD>>><3$   "  #&#%)&"  ,4&$   %'$ #$$$1Sif_][ZYXTVVVWWXYXYYZ\`fmnooqqiifcdc`_`^``babb`]]_ab`_``baachiifcZX}–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€И644120/..)?ѕ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эе∆ХД{tjdcnЗ°∞СdJ<6975302121-+,--,+,++18FNS\gtЕХѓƒ№у€€€€€€€€€€чшхшээ€щкхь€ьць€юьюьью€ьююрпь€€€€€€€€€€€ююю€ююю€€юэ€эЁ™vdda]][\[ZXXXYZUMGGFEHFCFEFHLJHNЕЄ…≥jE>;E\q†Ёь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дЩaK?;88<:30212315/,0/100..,+.0*)++,-+,./,,**,*(*,,)%! !&     "#$$$&%(*)@Ми€€€€€€€€€иЗLDLQeЮЈХcXWUSOMLGAZ£у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€этм«ЕF#"  !499AMlЫЈМc[[YTTSLD@?>91 " $'"%+)$"!,3'$ "!  $#"%$$#0Tga]^]][YVUVUWXX\ZXY[Z[``a`dfda_]`bb^acaa`^_^^_`````_aaabehiie^\W~‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€З=IГЂШZ:796//00//(?ѕ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъяјУБzrjddoК††РtO:965771/0/0.,,-,..--/28DNV\esЕЧ≠≈зш€€€€ю€€юю€€€ь€ыь€ю€р№сььыэщъююэ€€€€э€€э€€€€€€€€€€€€э€€ээю€ю€€э€€фЁ≥~hb_^]\\\ZYY[ZWWOFFEFIFCDHFIJHJPИЊЌіiD=Ќ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч„њФВzrhdpЕРЪШДcK;66521410./...-*++,.02 €€€€€€€€€€€€€€€€€€€€€€€€€€€у’ЈОВyoikrЗ†¶СpYD9415663140..-/.,,,*+.1OdЖЅч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒrOC>=:67:862213300/././0.--//.+-,-/-,+()-+***+*,+*$#! !  "' !$$"#%&)((+,,,@Пбщю€€€€€€€€ёЕMDHNgЪѓРeXWQPQQJEC[Яс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈h$ !!)2:@CJiЯЊУcZ[WVQNHDC?;9/  #+&  $**'#/6% ##   !(% #!%%-K__\[]WSQRUVVXXYXZY[[]]\]^^`_^___^]]^]\Z[[Z[_`_abfhjlf`][[Xx«ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пy8IД•ЦT;6595242/.*> €€€€€€€€€€€€€€€€€€€€€€€€€ч‘≤ПАvmfiАХ®¶МlN>:54300451.0.---+,-,./3=ENWaivЖЫѓƒды€€€€€€€€€€€€ю€€ю€€€€€€€€€эцтъыээю€юыэ€€ыэю€€€ыэ€€€€€€€€€€ю€ю€€€€€ъюююь€оќЪshd`]^\\\]\[YYVOHHDEGEHJGEHMJIPДЉ—ЉpB><>Lb≥ф€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃbH?>:843671/1/0/-00-,-/-/.-..-,,,-,)++()+)*)*++(+*# !$ ! !##$# %''(&%+-//Z£л€€€€€€€€€€дИOFKQhЮ≥УgYWSQPMHEA[ђх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЂF" "19=EMiЬїОa]\ZUQKHF@?:9/ (   ! %,% %+)'#-7&!%#  #  !!#+B[^\[[\WUQTVWVXWXZ[\]]\^]^_]]^\\[[\^]\]\Z[Z]aaehlljh`[\[_К‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тz7HЕѓЩR8747311/..)?Ќ€€€€€€€€€€€€€€€€€€€€€€€эа≥М}vldeyХ•ЮОnM;5440/.0/1.++/-.,)*,*-4=FPX`kvИЬ≤Ћ№ч€€ьэ€€€€ю€€ю€эъэьщью€€€€€€эчхфычыю€€эээ€€ю€€€юэьюю€€€€юю€€€€€€€€€€эю€юээюм“•ufc``_^^\\\Y[[YPKJGFGFGFGHFHFGPГї–єmD@=;7433233.//00.11/,,....,.----,.-,.,*,,+*++,.*)*% +& ! !!!%$!$'&'&&,,,5vћц€€€€€€€€€€яДMHNShЬµФeYVSQOQJD>[≠х€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЕ0/:;7/ "  !  $($$,)&%#.9' #$#   !!"&9W`\Z\^YTQQSVWVWXZZZ[]]\\_^][[[ZZ\][\\]_^^^bhlnmga][ZYdЦи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оz8HЗіЪT9:6353//..(@Ќ€€€€€€€€€€€€€€€€€€€€€ые√Т{nddpАХІ†bM?:844321/--.,-...-,+-.19BNXajyНҐµЋеъ€€€€ююю€юю€€ю€€ыъъчщъььь€€€эцфьющщы€€ю€ю€€ю€€ююэюююэю€€€э€€€€€ьэю€эю€€ээ€ю€р„Ѓ~id_^aa_[\^[\[WNFGKIEFCGGGHIGGNДЉћґmC@=;F\uҐн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€єiI@<888886332//12//0--*,..-,,-0.)*.,-.-++..*+,,,)&'%!   $$!!! " """$%$#$%)))--+IУдю€€€€€€€€€€яЗRLPQfЫЉЪgZXUNKQKA>ZЊъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЅV&.:=EPjЫїХe[YYTPOKGD?<9/""   "! $(& $*+('%#25&""##!   !"!%6P_]\^^\XSQSUTUWYZ[]]\\__^\[]]]__^_\\]bcddikmlc\ZWX^|≠у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йu6IИіЫW::866310//*A–€€€€€€€€€€€€€€€€€€€у–©МxidfsЙЬЧЙy[C9632645430.++.---.-,-27@JSZarДЧЃ«Ёлэ€€€ю€€€€эюэ€€€ю€€юэъъэыщшъю€ючшчочъъъыэ€€€€€ыююъь€€ююю€€€€€€€€€€эю€€€€ю€€€€€элџЊЙjc`__`]\]]]YXWMFFHGGHDDFFIHHJPЕљћЄp@<>9@ZoШг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€„П]F=:766:564201/10-/0/-+,-//-+.-++,/+*+)+,++*++++($#$#" !  ! ! ###$%%%*+-./03f®м€€€€€€€€€€€ўЕOIMRjЮЄЧfWXTLKNJE?ZЄш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цП7# 0=>CNjЪЇЧf[\YTRQMID@=:-$ %  ! !"##(,(  ',,($##37(#"""    "$$#-CV\^]\]\XVRRSUUWY][Z\]]_^]_^]_^^_^`_bcbdeb_]ZY[_w°÷€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Џk4KЖіЭV:;765411/.(AЌ€€€€€€€€€€€€€€€€тќЯГtg\ViЙШХЗpQ;62/../33/22/-,*,.-,+./4:?XmТ—ы€€€€€€€€€€€€€€€€€€лх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€±jQB;:764560/0/../,,13/,,.-/.---++,.-+,++((**,+)*+(! "#""  ! !!##$#"$&,59996@Дґо€€€€€€€€€€€‘OHLRlЭіХeXWSOPRMF@Wƒэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЉS&" !5;=@LnЮЈТdZZWTTRIGE@<9.#$   !  "! "")-%!(-+&" !37'$#$"    )) $(&*5JY_]\]^^XUUSQVXVVWZ__]]\]]^^]_^^`__^\\XXWX[btЩ–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“g4NИ≥ЫU=<775751.-)E“€€€€€€€€€€€€€€о«Чzj^VXezЩШxZE:20./0/000/--.,+,+,.-+/8?HRX`htЗЫђќл€€€€€€ю€ю€€эью€€ьъьюю€ю€€ююыьычь€€юуфыыьыыэъщь€€€э€ююьээььюю€€€€€€€€€€€ьыю€€€€€€€€ю€с”Эqdba]]\\\\[\[VJCEIGGEGFEJJHHKOИ≈”єo?;B;>TjКєу€€€€€€€€€€€€€€€€€€йх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷АSE;:<:;7663320-./--23/--,--.-..+,-./--,-()+*,+*,,(#" " "%!"$ %# "#!    ""!""$%%&'*-9??@8VЭЇн€€€€€€€€€€€аВMGLRn£њЫeWXTPMOOJC[»ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷q0 3::CLo£ЇПcZYURPPFAB@=;-   '  !! '-$ (+)&# 34%!!"  +uГaD2&%'+7:?MZ]]\[[[\ZWTTUWZ[^__][[]^_^\^\\\\[YYYZ]cvЪју€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷h6OИ≤ЫU;=;83442/,'G“€€€€€€€€€€€€ліЛxeXTVhЕЫЯЕY?5/-.//01120-.,+++.-,,--3;JUY]gxЙЪ∞≈Џщ€€€ээ€€ююэю€юьюю€ээьэыюю€€ьэъъьэ€ээхфцщ€€щъюцхыэю€€€ъьэьююююэю€€€€€€€€€€эю€€€€€ю€€€ю€п”§vcaa^^]\\[ZZZVHCGGFIDBCFIHGGINИ¬’њu@;@;=>L`u¶р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”{M@?>;996559;3/32//0.0-,..,,,,-/.-.-,,+*,-++---+**'"   ! "!!!&%)*'()+.011R°р€€€€€€€€€€€€€”~NGLQn•ЊЧeZXRPKLLGC[≈ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘q0$"   .9=?KfЦЈУfZXXUOMGA?><9. . !"!(+$&-+&$#" 36)$#"  <«€€юэфџ•Иs]ND729KUY\[\]^^^\]]\\Z\]][[_]]\[[]]\coИ§√п€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќi7RН≥ШT==8574442,%J‘€€€€€€€€Ё°БjXSScuЕМДkN>410-/...--..-+++,-,-+,16BMTZ^lyЖЫ±њўр€€€ю€ю€€€эыь€€ю€эыыь€€ьььэю€€юээьэюэю€эюыээээчъэ€ющшэ€ю€юэю€€€эюю€€€€€€€€€€э€€€ю€€€€юьээээу»Кjebbb_]^]\\ZWLHIFFEEHFFGHIGENЛЅ”∆C:>?=G]pЬл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µaC@>=;75101431-/30//0010.,**,.01/+---,+*)**+-,++**'#  !!  !!" !#%&)(&'),/09oƒщ€€€€€€€€€€€€€–~RHMPj£ЅШdVWTNLQMFC[ €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃF$  -:;BLgЫЈТgZWWUQNHCBA=:.  $(! "!! ! ")+$ !%,*&$%#$ 47($""! =ќ€€€€€юэюцё±СqS=7>HQXZ[\\^`^_^^]]__][]][``^cmЧ±№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒ`6RР≤ПP<<:777542,%M’€€€€€€”Э|cUQKPhБДu_I;30--/.--++.++-,*+*----07@KT[clwНЮ∞∆ўн€€€ю€€€€€€€ымуь€ю€шчээ€€э€эъэ€ю€ю€€ьэыэ€€€щьюьыэ€юэ€€€€€ючыэью€юю€€€€€€€€€€ю€ююю€€€€ю€ю€€ю€€ъ’Щoea_`^\^]]ZYVNHEFGECDDCGIHGGOМј–Ѕ}@5=>;CZkРўь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўЙTGA=834520/110.0341/0/0/,+,-,.0-,*,-+,,+**)****)'&$" !!!" !   !! !"$#()(*)+-0NП‘ы€€€€€€€€€€€€€ѕ|RIOSk•јТaVVRONNJGC[Ћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€’o/"!  .8;BMkЮЄРdYYXTPLJHB??>/   /  !"" !$ "! *-%  &-*'&%#!!35(#""#  A“€€€€€€€€€€€€х–°БiTIINRTVWZ]aa]]_]]^^cceo}МЮѓ”ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€√]5RН≠ТT<==98961./(N“€€€щ…ШydWQOSW`haP@51/.-,-.-.-*(++*,+,-,.,07?HQYcl{КЬ≥«Џф€€€€€€€€€€€эюшнцью€€ъь€эьыэ€€эю€€€эю€эюю€€€€юэююыэ€€ю€юэю€€щэьъюэюыь€ю€€€€€€юэюээю€€€юэ€эю€юю€юЁ•we`_`]\^[[\ZULFGGFGHCCFEEDGHNИњ—µm;3=?;?VhИњх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЅkLF=9512640.3200222/10/-,,,,-,,.-.++..+,++,+*+*(*'%#"" ""# !"   " ! !"##$$#$''(,,-/1LМвю€€€€€€€€€€€€€–zOINRm™ЅП_VVRONNJGB[Ћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЂF'" -68BOjЪЈСdYYWUTPMIA==>, '0!! ! " "*-%!(-+*'$$"!!43&#$"" A €€€€€€€€€€€€€€€€ч ЯИ}ohfeiikgcfnqwАДОЪІђѕр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€¬\6TН≠УV>==<9862.-&O№€фµВm_XUJHSTOH@;4.++,---.-+,+*&(,++*,*+27BNRX_iyКЬѓњ„ф€€€€€€€€€€ю€€ю€очюю€эююээьщфъ€€ьы€€€ъь€€€€€€€€€€€юшээь€€юю€э€€цщэ€ьюььээюъэ€€€€ю€э€€€€€€€€ыэюэ€шчя±~hb]_`_\\[]\XOGFGHHFDDDFDBDGMВЄћµl;4>@;=Pd}∞с€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ёЩ]D?::31364415761032//10/.,-,+-,,-.++-/*+*)*,+*+-)((# $  ! !"  "#    #"$&%$&&()+,--1Vѓх€€€€€€€€€€€€€€”yLJNQkІњТcVTPMMNMGAX…€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№v4&" +89@KnЫЄСbXYXUQLJGC@:<&   1'  !  !(+# !!)/.+'" !###65&$"""  BЌ€€€€€€€€€€€€€€€€€€€€эоа—ƒї≥©Ґ§™∞Њ“жмщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€њZ7UР∞ТU<;=<:8631,&SЯ£ДfUSNLFA?A:72...+**-,-.-+***'')*)**+09DKTY^ixЗЭ±√–н€€€€€€€€€€€€€€€€ьшььь€эцсцьычуъ€€ъыю€эщччы€€€€€ю€€ьшчъшъю€ыыьэ€€ох€€ю€€ээююыэ€€€€€€ю€€€€€€эьщь€€€ъмбјИia^]a`^]]^^ZMFEEFGBBBEGEFHJL|≥»≥k94;?;HT[bo{КЯ≥јёц€€€€€€ю€€€€ююьээю€€€€€€€ыьъчь€€€юэ€€€€€€юээъкуэ€€€ъьэъшэюэ€ьыююю€€€щы€эыю€ю€€ю€€ю€€€€€€€юэюююю€€€€юэюьюп–Ъodb_``^\[\\XLEEEFIGHEGIEFHIKoЂ«≤j<57>?@>8872/..)',-./,)++)))),,*)),+)('(''()'(*+.28BJPX_l~П°∞ƒбц€€€€€€€ю€€€ю€€€ыыыью€€юююььэюьэ€€€юью€€€юю€ээыэ€€ьюю€€эыъюэыэшчэююю€€ыэ€эю€€юээ€€эю€€€€€€€€юэюьэ€€€€ээщъыъЁ¶vda^_`^[\[[WKFDDGHGFEIJGGHKLj¶ƒЉr;39@B=@UiЛЋщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зҐ`F@<;76423343/132//2231/00/-.,,+./--....+,+++,-+*'&#!   !$#"!!! "#$%$%&(*+)*,-EФн€€€€€€€€€€€€€€€€’|MGLOjІ¬ЦeYXUPNNLKEZ∆€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ўs5&$!   ,<=AKn£ЄИ^ZYWTNLIDB@<7 ( !" !""$!  #"$+,&# !(//*(&$ "%$(86(%'%"    Uў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЅZ6SС≥НP=?;:;862.,*('%&())*-***+,*+*)+-)''('&)*))*0:EKRY`jyП•ґ»Ёф€€€€€€€€€€ю€€€€€€€юэюю€€ю€€эью€ъщэ€юэююю€€ээ€€э€€ююьэ€€ьююэю€юэшъ€€юыэ€€€€ю€€ю€юэюьэ€€€€€€€э€юю€€€€€€€€ьыьы€е≤~ib]_`^\]][WKGGEDFHEEEFKJFIJi£∆ƒ}@27AE@>PeГір€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“|RA=:885///10.,-0//..010,-//.--..-,,./-.-*+-,++.-(&$#! ! !"!"# !! !#"##"$')**),*.]∆э€€€€€€€€€€€€€€€€‘zLGOQi•јЧfYWSNQOJE@Y∆€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЂK-)&  +8>BMoҐЄИ]XYXURLFBA@<9"+ " "#$ !" !!#"$+-'# ")12+''#!-,#(96(''%!    Tў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љT3XТЂЕO<>:9;8741-'%#"%(++,--++*++*)*)('&%%'&'),26@LUY`kyМ†≤ЅЁщ€€€€€€юю€€€€€€€€€€€ю€ю€ююююэю€юь€шщю€ээюью€ющыэю€€ыы€€€ьххы€€эчщ€ьэ€€эьэ€€€€€€ъъююэьью€€€€€€€€€€€€€€юю€ю€ю€€ю€с√Лmda`]\]][[VLEFFCFFCEIFDGILKfЮ≈ƒЖF66;D?;Nd{Ђо€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иҐeIB>:873020/..-..-,,-1.,,---.-*-.....-+,,(+.,)),-(%#!!  #($ !!!   !  "!"$$&'(*++,--@Жж€€€€€€€€€€€€€€€€€÷~MHLSiҐњЦdWVSQQPKFDZ√€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“k5*'$   )<9!0  !!#""!! !"""*,$ "(0,'(&$"+#$97'!$$% Xџ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€њS5]ХґФR@@==;9960*&(&"$((**)*+)''))&(*&%%'''-7ELSY]iyКЯіƒеъю€€€€€€€€€€€€€ю€€ю€€юю€ю€€юэю€ыьюэю€ью€€юю€эъщы€ытхыэщтизчьъсшюэю€€€ю€€э€€ььэю€€ююююю€€€€€€€€€€€€ээ€ыь€€€€€€€€ычыющџ£sa_^^^]\\ZTKGDBILGDEFEEEEGIhҐƒƒЕB47:@A>F^oХв€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чЉrL?;;=:655310000132-,-/0/......--/-+,-*+-,,-,,++*'%$   !!!  "#!"!$'((+)*,-14EКи€€€€€€€€€€€€€€€€€€”zMFKThШЈХeYZWQKMMGC[њю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘i0'+,#  '7;AMp•ЉИZWXVSNFDCA@>;")  ""!  #%%! !"$%%++%#)/-)*&#  %87'"#$#  Xў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љS6\ЩїХT@A@=;862-+'&%$&)*(*+++()((((()(&&(.5=IRV]htК°≥љ”у€€€€€€ю€€€€€€€€€€ююью€ююью€эююэ€ю€€€юэьыь€ыъюъчсфээчфы€ьфцъь€чоцэ€€€ю€€€€юю€€€€€€€эь€ююю€€€€€€€€юыэ€€€€€€€€€€€€€эъъээв≠|hb]]^^\[\YNGDCGGEBCCDGHEFGj£јЇ|@367?D=AZkЙ»щ€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џТ^B<:76447531,.43/130--,,..-../,+**-++,((--,*),)*,(#"   !  !  ""  #%'(*')-/38^√ь€€€€€€€€€€€€€€€€€€’yJGKRgХєШeXXVPLMMIFXЅ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µD%(+'!   $7=DMmІїЖ[WWTSPJFC@><8  &  " "! !  "$&#"###%&+*%! #)0/-+($ !# %65("!"! Yў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЉR5[ЫЉСUAA@=;73/-,&&%#&***+,,*)+,(&%&('),3BWjГ∞о€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т≥qSB9:8651110/.0210/0.-..,/.+-..*+,+-++,**,,**()*((#!        """"$$&'&(,15F~я€€€€€€€€€€€€€€€€€€€‘{MFMRdЧЉЧcWWTQPMJFBW«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЛ4&(('!   !6;AKm•ЄД[WXUQNMG@><=:!* ! !"!"  """"#$#$$#$+*# $+/.+)(%""#"'85(#"#"  V„€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€єL4\ЭЊТTABA@>;73.+%%$$&+,,,+-,,,*)(')+.5=EMPVeuК§≤¬џсь€€€ю€€€€€€юю€€€€€€€€€€ю€юююьчъ€ъчэьью€юэючфщыь€фуэюэъфы€юуръюэхцщъю€эююышхью€€€эь€€€€ююэььэ€€€€€ю€€€€€€€ээюэюю€€ыьюэьэьым Тmfa]^^\[\VHCEFEGFFFDFEEGJLp§ЉЂj7144;@?>Qg{Іл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўКZE?85894//1002400/......//.,,..+,-,,++,,*)++***+*&$!  !"! !  "#$%&())+15Zјъ€€€€€€€€€€€€€€€€€€€’zLFLRhЩіПcWUQOOMLJCW»€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∆Y*'&"  288:;;4241../31./.-./.-,-+,,+---,-,+,*(+++**,,)'&"    ! """"! "$" !%%%&((+,-?{в€€€€€€€€€€€€€€€€€€€€÷{KEJSlЫ≥ПbVUQQOLIGD[ћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еЛ@**&  2>BLm†ЄИ]YYVTOHFCA@=7 ! !#!  !"$""""##%-+%&-..,('&"#$"&84%###"    Y„€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЉN9aЮєНTCAA>;:82,)('$"),***,./.-+,14:GKRZalШ≠ј’рю€€€€€€€€юю€юю€€ььюэюээ€ьь€ю€€щы€юъьэыъыю€цнхьхчююэхцьъыюэ€ъхшьюыцчшщыю€€ьщьюэ€€ю€ююьььэ€юю€€€€юю€€€€€ю€€€€ью€ю€€€€€ю€€€ыъьэ€ювђzea_][ZZZUJBCFGGEFDDGFFHIJr©јµv;167>C?:H]lОб€€€€€€€€€€€€€€€€€€ью€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁС\E?989745551.-.11//-,--.,,,)+--,,+*,-,,++-+***++)&%""   $"!"!" "#!  !  &&&&(),.0VЊъ€€€€€€€€€€€€€€€€€€€€„}NFKTn°ЇЦeXWTQNMKEB\Ѕ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒ\3*)&" 2;AMk†ЄЙ]XWURJGEA>==8  !"" !  !!"$#"" #$&+,& !&,0.+)'%"$$ %64%"   0 ]ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЇM8bЪіЛTBABA>;93-,(()%+.,,+,../157E\mЕ»щ€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»uOA=<961/2110/00110.--.--.,+**,--+)+.---++++)+---+&%" !" !!!  "!  "$&%&'*.><6   ""!! !!#" !$%#! ##&+,&#"%,0.,+)%! ! &63$"!!   _Ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µH:jЬ≤ПUDDCA<::5.*'+0++-+++-/-078"    !"!!!!!""!! "$"#**&$"$+/-,,*&! !!'60#"!!  c№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€іF9mЯЃИRDCBA=<;70+),0,)*,++.//9?DNV^nДЪЂЄѕрэ€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€эю€юыэ€юю€юью€€€€€€эйн€эшчуцю€чшььщьющыычцъэ€эъщью€ю€€ьэ€юю€€€юю€€€юээю€€€€€€€€€€€€€€€€€ю€€эю€ю€€ььэ€и Эodb_^_]YXMCCEFDCFFFGCADFMt™ј∞n5098;CFABQcu£к€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷КZC<68899643122-,---.-.-*+-,-.,**,..,,.-+**,--+,,(%##"    "!!"!!  !$$""$%&)**,=pЎ€€€€€€€€€€€€€€€€€€€€€€‘zMHNUr©√ЩeWWVRNQPGEZ√€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вКE/*($!  4;ALmІЉЖZXWSQPIC?>?>7  !!! "! "!!" "$!#**%%$&-1.**)&""%!&71$$##" jа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µG8i°ђАQEBACB>=7/)(.0)'*,+,.27@JQ\kЧђЄќпыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююэю€€€ююьэээ€юэьэ€юъцщюъфщыщьэыъшыэъхцэъъщщээхч€юю€€€€ю€€€€€€€ю€€€€€юю€€€€€€€€€€€€юю€€€€€€€€€юююээюэыж“™ye_^^^[[VK@?CDDFBBFGEEGHKp®ј≠k9247;:;:86432110./2/,./0.-,-,+-..,---,-.-+,+,-,,,)'%#!  #%# "" ! !"#  !!$&()++.Nіш€€€€€€€€€€€€€€€€€€€€€€—yKFKSs•њЧbUVWSLOPJB\Ќ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€єY6.*&#"  6=CNk§єЖ\YUUSLGB=>?=9" !  !!!"#" ##"#+,&##'.30*)('"!$"%74%$&$! qд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞F8h£ѓ~RFABA?>=6.*).0*)+,/17>DKWiБЩ™ї’мъ€€€€€€юю€€€€€€€€€€€€€€€€ээ€€€€ыь€ююыьююыээщь€€€щффъюыхчшщыээщццщ€эьыцуфъюыцшьэчуъ€ю€€ээюыэ€ю€€юьэюююю€€€юю€€€€€€€€€€э€€€€€ээ€€юэюэььэьыз‘ґВe_[\[\]UJCBBADFCCHHFEFJLo™ƒ∞p?4247>GC@H[lЛ«ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏЛZB>:::531//00./.052././/---,++-...--,+,,+,-+++,-)&#"" !!!  " "#%')(),9nЎ€€€€€€€€€€€€€€€€€€€€€€€„zKELSp°ЃЗaVUVPJMLGB]Ћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№z>.+'%#!!  7=@Jk•їЗ]XWUPIFD@>><6!!!!$" !"!""),$""&+20+**'###!'73$"%# }л€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€±F8j§іЕSECD@===80*)--((+-4=EKTdzФ™њ—еъю€€€€€€€€€€€€€€€€€€€€€€€€юююэю€юэю€€эьыыэююыыыэ€ючцыъьщцыцфь€€€€ъхъьюыцшьэъъшы€€ыьюэ€€юыъышььь€€эью€эью€€€€юю€€€€€€€€€эюээ€ююьыю€ю€€€€€юьчв¬Пg^^^[Z[TJCCBACBCEGGFFHFJnЂ∆±s@6864;EE?EYi∞л€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€яё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€з•mL@;:;<600/1/-00//21/--//----.-,-..-+++-,+--)*++)&$#!   !!!    !!"$%%&'-OЃш€€€€€€€€€€€€€€€€€€€€€€€’zICJRpҐ™Б^VVUPJLMGC] €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЈU2+)$!   8<77842410/.11/00--..///,,--+*,,+,)),,,--,,,*)*&$!  " !! !!!  !#$&()7m’€€€€€€€€€€€€€€€€€€€€€€€€’wGDMRl§їМ^TUTQKJMIB^Ћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ё{@-*($  5<5 !  ""#" ! !!! "#"#++%$%)041-+)&" !'43&!   yз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃE;pІ≥ИREHGB@?>80+,1/+07EP\oМ§їЎоъ€€ю€€€€€€€€€€€€€€€юю€€€€€ььью€ю€€€€эь€€ьь€€€ючушю€ъъ€ю€€ъьюцтшчць€ющцэъчыэю€ьъщфчьыщыыы€э€ююэъэюю€€юээ€€€юююьэ€€€€€€€€€€€€€ююююььююэю€€юю€€ю€оў—ђyb`\[]]UIDBDHHGFHHGEEGFHs≠њ≤s907<;<@CCAObrЦё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ж•iD:?>724631/021///.-..-,+./+)++))*+--+*,,**+,--,,)#" ! " " ! " !"%)*-J™ч€€€€€€€€€€€€€€€€€€€€€€€€’yIEMSnІњР_VVTQLKOKC^Ћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф£L.&&'%"  7=CQn•љК\WVUQIEDC@?<7   !"!!%$ #"!!!!""$*+%""(161+**(%" '53%"! nг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃE=l°∞ЗRFIFABC@:1,,7=8?HSgВЫґЏфы€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юьэ€ээ€юъшью€€€эыыщъ€€ю€€€ээьъюхкуччэююэыь€шмхю€ююшухфхуцычъээьыэюьь€€юю€€€€€€€€€ьэ€€€€€€€€€€€€€€эююэьью€ю€€€юью€€уЁ‘ЇГd_[Y[\SKDAEHEEGDCDEJJHLu≠∆Їs2.:=<=@DD?J^kЛ∆ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џМ_@<<;:5650/120//..--..,++,*(++)'*+*+)(+((+*+,,,*)%"#    !""!# "  !! !#%*,5h“€€€€€€€€€€€€€€€€€€€€€€€€€„yKFKUo£їН^YWRNLNNLG\«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”f5*&$$#"  7o°∞ЙSEJFABDB91,,=HDPc|Щі‘оъ€€€€ю€€€€€€€€€ю€€€юю€€€€ю€€€юю€€€ююю€€€ьъэююююю€€€€€€€€€ээщтцьпйчэъыээюъы€шсшью€эъцчцщъыыщыыэщчъэюю€€эю€€€€€€€€€€€€€€€€€€€€€€€€€ю€юю€юю€€€€€€ююэъхб’≈Сg_]Y]^WMFEFEDFDBBDKSLGNw≤ Љp((7:;=BGB=FYhАЃк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ц√АS@=98;:51122/--/....-,+-..,+,,**+*+,++*(*,*+,+*)&#       &&! !""    $$%),H§ч€€€€€€€€€€€€€€€€€€€€€€€€€„vECLVq§ЈК^XVTNJOQLG\≈€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рЬD-+'$## 7<@Mo§ЄЛ[UVSOJFEC@><4 ! !"  !!! "*+'('(/53-+*($""",4-"!!"#  \’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы£@:s©ЃЕSEHEBABA:3-0DRYvФ™≈иы€ю€€€€€€€€€€€€€юю€€€€€€€€€ю€€ю€€€€€ээ€€€€ээююю€€€€ээ€€юю€€€юыфшюэ€ющъ€эьэъьэъщъъьющцышч€ю€шшъы€эээю€юэю€€юю€ю€€€€€€ю€€€юю€€€€€€€€€€€юю€юэ€€юю€€эю€ъщпЁѕ§qa_]\YTMIGEDEEDDFFHMKINx≥…єr+'37;;@GC?DWgvҐж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вШhI>;8466310101000..,./+),---,,+*,,+*)++*+,--,++)&'%!! !!! "# %'"!!!!"#  ! !!#"&)2dѕ€€€€€€€€€€€€€€€€€€€€€€€€€€’tEFPWr®ЊО\UURQLLMKG\ƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—h6+(%#""  5;BMhЭєН]UVTNJGFC@?=6"!!!!!""" ! #)*&(('/52-,(&$!!#+6/!     b’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю™B?t©≠БTKIDC@@B<2,1LqО≠Ћвфю€€€€€€€€юю€€€€€€€€€€€юю€€ю€юэ€€€€€юю€€€€€€ьыээю€юююьэьэ€€€€€€€ъыэ€ъфцъ€ьъшщъчхщщчщыышьъцэьыщъээ€ююю€€эью€€юю€юэ€€€юэю€юююэ€€€€€€€€€€€юэыь€€€юэюю€€€юю€рЎ±z`__^]WNGFEABGIIHFEHIGLyґЋЄq6135;9;AD@ARdpХб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ«zM@;8<>:51/02111//0/-,-,*+..-,--+,,+,+*)++*,-+++)$##!"! !" !""#($! !!" ! !!%,E£ц€€€€€€€€€€€€€€€€€€€€€€€€€€„tHHPWuђјР^VUQNMOLEE`»€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€х†E.*'&" 4;ANkЭЄП_VVSKGIIE@@>6 !  !! "! "" #(+&'()/73-+(#""#"'50!!  pа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≤FCt¶ђАUMKEB?AC=4,9oҐƒзшэ€ю€€€€€€€€€€€€€€€€€юю€€€€€€€€€юю€€ююю€€€€€юююьыью€юыьэююю€€€€€юэычшэфт€€эцч€ъцщъыъъьъъю€юю€юэ€€ю€ээюэ€€€€€€€€€€€ю€€€ээ€€€ю€€€€€€€€€€€€юьэ€€юыюэыююэ€€€ьюсўњЙc]][\UJEEEEGFGKHEFGFHNwі…ѓm@:68:7:>A?=K`lЙ“э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гЧaA986LlЮЉПZSVULEIHBA??7    #""$" #)+(('*064.++&""#!'4/"!! !   tж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыІEAs≠∞АUMJD@ADA<4+BП’ую€€ю€€€€€€€€€€€€€юю€юю€€юю€€€€€€€€€€ю€€ю€ю€€€ъъюьюююэьшы€юьэ€€€€€ъшэьшцотэююыыюшш€эщцчьыщююю€юю€ююэюэю€€€€€€ю€юю€€€€юю€€€€€€€€€€€€€€€€€€€ыъэю€€ю€€ю€€€€юььык„»Щl^][ZTKIHEFGDDFFDEECGNy≥∆≠j>98::99>CC?G\kВєс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чјwL;<<754200/0/--/1/-,..,+,..-*(,.,++)())),,*))*))'"  !"#&,+$!  !   ""!&+EЬу€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏtDBKXv©ЉН[UVTPKLMMJ^≈€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зЗA.*++&"!! "9;BNeЭЅУ[QTTOJFEEA<<:!  "$"!" #**'&&*362.-,)#""!(4/" ! Жу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хЫAAw≥≥АUKIFCBB?;4+AЧм€€€€€€€€€€€€€€€юю€€€€€юю€€€€€юю€€€юю€€ю€€ььюэюэю€€ююьщь€€€ьь€€€€€юшчьюющуфхэ€€юъыюю€эээ€юю€€€ьщьюэю€юьэ€€€€€ю€€эю€€ююю€€€€€€€€€€€€€€€€€€€€ююэъэ€юю€€ю€€€юэючв÷–≠ya^]\VLECBDFDDEHEBCCCK{і«Ѓj8468;:7>DEADVhz§е€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вХbB97763573230.../.+.-,-,-,,/-+*+,,--+()*),/.++,*($!!  ! ! ""&**+&!!!!! ! "!#$#%0c…€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўsEEMWx∞јО^WWWQLMNMH^ƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЇM0/*&#!!#  67>LgЮїН\UWRNKHDA?<:5 ! #$!! "),'%&,484//,(%#""*6-!   Йч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фЩAF~іµSLIEBBBA<6.CЫт€ю€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€юыъ€€€€€€эъь€юьэ€юэююэ€€€€юю€€€юыыюьэ€ьчы€ь€ююыфцъэю€€ю€эююьэщшэю€€€ьъэ€€€€эь€€э€юююээ€ю€€€€€€€€€€€€€€€€€€€€юьэ€юю€€€€юэььюэн№„їДc_^]WIBCCCDDCDDCBEE@OЕЇ»™d5149:76:BC?AQdrХ№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”|U@87765670.00/-//..,,,,+**,+,.--,**-.,)*---,+*+*(%##! "#!! !!'**,& "$"!""   !" #$$=Фр€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷tEDMX}ґ¬Р_XXUQOOLHD^≈€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бq3*,+%!!##" !8:?OlҐЊР\UVTRKHFA?=;5  "&'!   #$$!!#*.(&(,3981/,'%"$*/4+ !!   Оъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЦCH~≥ґБQLJFECCB=82EХд€€ю€€€€€юю€€€€€€€€юю€€€€€€€€эыю€ю€ю€€€€€€юьэ€юьююэюъчэ€€€€€€юэюыфрцээьыщэьыььюышпмыээ€€€ьююшшэьью€€юээ€€€эыюэюю€€юьээээ€€€€€€€€€€€€€€€€€€юю€ьь€€ю€€юю€юээъъ€у№Ў»Цj^\ZTIEFGGCCCCDEDBFEQЗЉ»І`74467547CGBAMboИћэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€к©kG=8784341//../-+-.*+,,-)(+--,+*+*((),-,))+)*,-,)&#!  ""  ")*)*& !"!"" !!  !!#")X≈€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏuDDMW{≥јН]WVVSNOQJEa«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ц§D-+)&$"   "8==6!(("!" !#*+&%'+4962/,)$ %-14,  !Пь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пФAHА≥≥АSLJHFDDB;63GУа€€юю€юю€€€€€€€€€€€€€€€юю€юю€юю€эыэюьыю€ю€юьь€€ьыьь€ъхщ€€€€€эъщыьшрфыцхю€€ыфуцщ€€цръ€€юэээ€€эы€ыхэюю€€€ююэыыюьь€€ю€ьыююэ€€€€€€€юю€ю€€€€€€€ыы€ыщьэю€€€€€€ььюэ€ыв”–™u^][SHFGIGEDBACECCGHSКЊƒ°]85566536BGB>J_kµр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”ДS=<98646411/////,-,,-,,+*)**,,))-.*))*+++*+*+--,*%$"   !  !)+)+'! "#"#  !""9Пс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€„sEGPVw±≈У_WWTQPOOKF`ƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–b1-+&%"! !69AKeЮєИYTUSQMF??@?<5  #!!! !()&$',4960/-*%#&',5-    #Рь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мО?IБ±≠}UNMJFCED>81IЫк€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€ээююээ€€€€€эыюьыюыъыюьыю€€эъчухыцщю€ъчщы€€юъфщъьюэ€€€юьъь€юэ€€€ьщыэюю€юыыыь€эьэ€€€€юэюю€€€€€€€€€€€эъэ€€€€€ююю€ээ€€€€€€€€юю€эь€пџ”іa][UJDFHDCEDDDFFFGHVОј∆ЭV66664567>C?;EYh|Іг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€л§kE<;78988411//00/.,,..--,,-,,-,**+,,**--)'*,**)(($!#! ("    &(#'&!! "#!! !#&Pј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎpDFOVsЂ¬Т`YXTOKLNJGc≈€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мВ<,+)&&$  #;?>4    !$$"#"" "(*&%(,5;70..*$$&%+3+    $Х€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кЛAJ±ѓ|UQMMLFDF@60IҐф€ю€€€€€юю€€€€€€юю€€€€€€ю€юь€€€юю€эыщъ€юь€€ыщ€ыпф€ыщьющчь€€хзсъьъщээчщщшююэчсщюьыэээ€€эь€€€ээ€юююэюю€€юъыюю€ю€€юю€€юю€€юю€€€€€€€€€юээ€€€€эъь€€юю€€€юэ€€€€юю€эыььдЊРf]\VKFFIFFHGFFHHGIHUНƒ ЯW78522688=CA=CUey°б€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хадч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќvR@=9545971..////-,-...-++--,***)+*(+++**++**(()(% !2%  ! #$"'" """   ##,Ас€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”qEDLWuЂЇМ^XYVPOPMJJdƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мХD-+(&&#  (;=DNl¶≥{WVSSOIGF@>><6!   ! !!#" "!$*)$$'+5<72/-)#"$%*4+   'Э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жЕAJ~±±}UQMJLHDHA60GҐх€€€€€€€€€€€€юю€€€юю€€€€юююю€€€€€€€ээю€эыю€€€€ынрюээь€€€ю€€штыэшщьшъщыыюю€юьююэюэюьэ€юыы€€ю€юээыью€€юю€юэю€ю€€€€ю€€э€€€юю€€€€€€€€€€€ьь€€€€юю€€юэюэыю€ю€€€€юыэшшыг…Ґn\[VKCFGFEEDHGEEEHHVПƒ §[5732466894"  # ! !!*-)((.7871/-*%%'$,7/"!!!  /•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дАBPЖ±®uUTQKIIIFA85RЂщ€€ю€€€ээ€€€€€€€ю€€€€юю€€€€€юэю€€ю€€€€эыьэюю€€€€ю€€€€€€€€юьшчш€чтъъыэыю€€ьщыы€юэьэю€юьэ€€юшц€€ыыюю€€€юэ€ьъю€ью€€€€€€€€€€€юю€€€ьъюэю€юю€€€€€€эьююэ€€€€€ю€€€€€юшчшолаЇД`VLFEDHIFDEFIGEFHaЩЅ√ШT844:<6676>GID@Kbmњц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кЦ`C=;9542./0001/.--//.+*)()./.-*),*)*))**+-++,**+(%$"!"  !! !! " !! "##!#"!""  ! !%$B£ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎmACKY±єЛYUUSONPLIGa¬€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оНB,*)&$!  .?A::FQmҐЄЖWUUSOKJHFB=:3&   ! ! ! &.+(().7:61/-*&&'%,90!! !   1¶€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аwCSДѓІvXURMJJJJC90M©ч€€€€€€€ю€€€€€€€€€€€€€€ю€€юьэ€ю€€€эшъ€юююээ€€€ю€€€€€€€€€ычэыфчэщрч€эыъ€юыююээюьыэюэ€юыы€€€€юьююэ€€€€€юююююэюэ€€€€€€€€€€€€€э€€€эююъьюыы€€€€€€€€ээ€эыюююю€€€€€юььь€юз«ЬgTLHFEFIFCDEFFFHKbЩ¬∆ЪR435776973:EJF@E\jw£г€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш∆vL;962120../0/010.-./+)+)(,..+++()*(('())++*++''('%"! !! !  !! ""!"  !  !".cћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”l?AKXЄњЙZWVSONRPKGc√€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыїV0+)(&# #2?@;9BPpҐґЖXTTQNMHFFC?;1(" !!# !  )9+%()/7:;4.-+'%%#)6/   1£€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁqDTД™£uVSROKLLKC:4O™ч€€€€€€€€€€€€€€€€ю€€€€€юээээ€ю€€€€юэщыэ€€€ю€ющщ€€€€€€€€€ьь€цу€€€€ъшэююющъюю€ююъъ€€ююэ€€€€€ющч€€€€€€€€€€ьщюю€€€€€€€€€€€€€€€€€€€€€юьююшъ€ю€юю€€ьь€€юэ€юю€€€€€€€€юыьшгЌ®pXMHGEGFEEDEGEEFJbЩЅƒЦN444689996:EIEABTerЫя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лЩdC96300100..///0.-,--)(),-,++++,)()+)(()*,,+*(&&'$!  !  ! !"""!   "#AЫу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€’nDELX{µ¬П]XVUQOQNJHbј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вy9*+('%!  #.68;;;@Pv™ЄМXSURMKEB@B@92*"!  $*#  ! !! %3+%&(-4=F=AQtІЇОYPTSNIB?A@><6*!!! !$/../!! ! &-)%'-7=>910,%!&%,9/"!   5±€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁoGVЗ∞¶rSSRPKIKJB94T≠щ€€€€€€€€€€€€€€€€€ю€€ю€€€€ю€€€ююээ€юээю€€€€€€€€€€€€ьхцэ€€юьшыьщюээщшшцшъыщэьыююээ€€эыэью€€юьэыьююю€€юээ€€€юэ€€юэююю€€€€€€€€€€€€€эыэьычэ€ээшъ€€€€эыэюю€юэьюю€€€ьы€эщм≈Т`NMKIHHEFFEFCCFIbЧњњТM888:;98:;9@EJE?J`i|єу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€м°hHB=5236620.,.-,..-,*),,+,+-,/IK.*,.+))*+*))*)('%" ! !!""! ! ! !"!!!!  !    ""#9Ут€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷i?CLWx≤ЊКZUVTQNNJIIc¬€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шљ_2((&'&%#!  #.53(2<;ARs§≥ЕYQRRNJGDDC><6*" !"  $..!  "  "! (,'''.::630.+%$&&.9, !  6ѓ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џlCTЙіђvUSQOJHKKA94R≠ч€€€€€€€€€€€ю€€€€эь€€€€€€юю€€ю€€ьщю€ю€€€€€€€€€€€€€юшпмш€ююэъыю€ъчюьшэ€ъчшъьщъэъ€ю€€эъ€ю€юэ€€ээю€€€€€€€ю€€€€€€€€юю€€€€€€€€€€€€€€€ээыэюэ€€ъю€€€€€€ышююююэю€€€€€€юээъъы№™qTNJHJLHHIEGGCFLgЪљљМG7:89::6567=CFB?GYgwҐа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бАUB@:5245420.--..--,+)+,++,-,).AG0---,)),+)*+++*&&#!   ! ! ! " "! "!! "$)Yƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€„k?AIWu≠ЇЕXWVSPPPLIJdЅ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№}>'('%%%#!   04-'#.8:DSxЃµВWSVTPID@@D>=6*!!,0)-"!! &+(').7:960.+%&%%.6*     8Ѓ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№lCTЛµІqVTRNIHJMA72P™у€ю€€ю€€€€€€€€€€€эьэ€€€ююю€€€€ю€€€юэь€€€€€€€€€€ю€€чпшыыьъю€ьшьэщхц€ьщюьшэыщэ€ьь€юыэ€€ыыээь€€юэ€ю€€€€€€ююю€€€ю€юэь€€€€€€€€€€€€€€€€€эюььэ€ъы€€€€€€эъью€€€€€€€€€юэ€эыэуўјРdNIKKFFHJGEFGHKhЮїЉЛE7;98577::8:@CB@EUfqХ№€€€€€€€юь€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЈuG;96412211/---..,+,,*-,+-*+-++-.-..,,)())()))*(&#!    !!" ""!  !    " #%6Ст€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€’iAELXzђіБXXVTQOOKIJf√€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьїT,)*'$%%"   &15, *7:ATАіЈЗVRVTOFCACC><6*! %,+   $+*&(/8;983.*$$&$*1*!!   7©€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁmGWОЄҐmUTTOJHJMD92R™ц€€€€€€€€€€€юэ€ю€€€ю€€ю€эь€€€€€€€€€юю€€€юэююээ€ю€юхухсшххыьщъшюыышьэчш€юцц€€ююююэъщьъхъшщ€€€€€юэю€€€€€ээюю€€ю€€эыээ€€€€€€€€€€€ююю€€€ььэ€€€ю€€€€€€€ю€€эююю€€€ю€€€юььц№»™vNMLIFEDFFGHHIJi°ЊЉОG7><74798:96=GHABQdlЖЌ€€€€€€€юэ€юэ€€€€€€€юь€€€€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№Рf@96540.00...-/.-,*+,,+,++)*,+-,+++.,)()(()*)'))&"!!!%!!""   ##! ! !  "$+Rљ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€„jBDIVyЃµАYWUUQMPMHIeј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЕ9(+*&$$!"   #*00*)6;ATzЃґАWUTSQJECB?@=8*  !  "(*(').6=9430*%#&&)3,"  :і€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№kEUРЄ°mVUSQKGMME84Uію€ю€€€€ю€€€ю€ююю€ээ€€ю€€€€€€€эьюю€€€€€€ъущхимэъхщ€ьщъцьъфщюычыъхшщъюъююьъъ€юээыьююшуъыюычьэ€€ю€юьэ€€ююьь€ю€€€€€юыыю€€€€€€€€€€€юь€€юыъ€€юыььэ€€€€юыэ€€€юэю€€ээ€€эю€€ша–µwNMKJJFFDCDEEILi°ЊЉРL59;65776620:HLC@L^i|ґс€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЃxO:65420/-/.,.....*+,*+,+)')*,,--,++,,*)+**(*()'%"!!    # "  !" ""  " #$"9Мм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕjBAEU{Ѓ∞{XXVSQOOMFGdј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ц≠Q+**'$#!       /0..&)76APl§ґ|SSTRNLIC@??=4(   " !  !$,*'*+-7>:442,&#&'-8,!!    :Ѓ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№kFYПґҐmUUTQLIMJC96WЈ€€€ю€€€€€€ю€€эыэ€юююэю€ююююю€ыщь€€€€эы€юь€цяешухшэы€ю€юьффющщъшшыэ€ю€€€€эщю€юэю€юьщш€€ь€юыщэ€€юэьэ€€ыщьэю€€ююэээью€€€€€€€€€€€ююю€ююъэ€€ю€эь€€€€€€€€юээ€€юю€э€€ьью€€хё“¬ЖPJIIIHGGECEGKMj§ЅїЗF533348555319EKGFHWfsЯя€€€€€€€€€€€€€€€€€€€€€€€€€€€€эъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бЗ]?7551/.0./----,,-+,.+)++*'*+)*,-+(,.,**)*)'*+'$"!! ! ! ""  "    " ')*Wљ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—g@DHW~ѓЃyWWUSPNPNEFfЅ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“g4(*(&$%"   *45/,"*87CQl§ґxQTSPOMHDAA@;3(!"! !! "!"!!!   $,,),-0:?:762+%"'(0:,! ""   7™€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ёjFXНµҐoVUSNNKJGC83V≤ч€€€юэю€€€€ю€ююэ€€€ьъэюю€эчы€ьэ€€€€€€ю€€эшчцьышыъь€€юю€ыцююэээщэъюэы€ьыю€эюээыь€ээю€€эъюю€ьыю€эыью€€ыщю€ю€€юьъьъю€€€€€€€€ю€эээъ€€юэю€€€€ы€юы€€€€€€юэьэ€€ээюэ€юэю€€€н‘”ЋЬ\LJGGIIHFGIKKMj§¬ЊЖC862477579649BJKGFSemПў€€€€€€€€€€€€€€€€€€юь€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€у∞sM;74210////---.,--*,.,*+(),-***))++**)*++*)'&'(%! !" ! !! !"   !"" ! "!! ! &&;Пр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЌhAGMY≥≥}XWUQQONMJKh√€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЙA)'&&'#$#    ",56.! (7:ESo•µySUSSRMGBABB=8) !!   !! ! !"  !$,-))+0:@;683+&#&(-7.!!!!!  8ђ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№fEUМЇ®tWUROLNMJD93Wґэ€€€€€€€ю€эьююю€€€эщэюъы€юэюэы€€€€€€€ьщююъщььььюъчю€юььщфюэыэюьэ€ээ€эчъыююэээ€э€ю€ю€€€ьээ€юэюююьюэюююююю€юээьъюь€ю€€€€€€эъэюэюэ€эъэюэ€€€ыыъю€€€€€€€ююююэюю€ю€€юэ€юэуё÷Ќ£eIJJJIDEFGLKIKj°¬¬МF9;758635864:AKLFDMckВЋ€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№ИaC9861/12.-.,-.-,-,*)++,,*(,,+*)'*+*+++*+*(()(''&!! "  "! !"# !"!#! ! ""!!%*TЉ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–h?EKYБґµ|UXVSOOPJEJiЅ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чІO,''$#&"!!   &+13+(9;ASrІґ~TVUPOLFABA><8+   !  !!!  $+,'(+/9>:893.'&&'-7- !!   :ђ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎdGWНЄ®tXXUQOPONF94Yµь€€€ююю€€€€€юю€ющы€ю€юэ€ююьюьюю€юъь€€€эю€юьъщъээьъ€ю€ьшъьщьщыэыъююю€юьььщыюыш€юю€€€€юю€ьь€€ю€ю€юэюэ€эээю€юээюэ€€€€€€€€€€юьь€€€€€эшьюэ€€€эышью€€€€€€€эьэю€эь€€€€ю€юъър’ЋЩ_JJILIEGHGHGEIj§ƒЅРJ8;7453144369?INHBH^iw±п€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уѓzR<8774./0.-+-.,,..+-+),.,+)*+*(*),+*,,***(()*+)%$"  !!  !!!! ! "!"  ! ! !&8Жл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–h?BI[Еґ≤yVXVRMNNJHIgј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю–d5')(&$$"    !&,22' &9:>Sx≠µ~STTPJIHDA@@=5,!   !  !# !!! %+*'(-17=9773.'''(1:.! !  ;≠€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўcH[Пі†pXYTQPOOMC97[Єю€€€€€€€€€€юююьшфэ€€€€ю€€€€€€юээ€эю€€€€€юээыук€юшчюээыюьюыыъцч€€юю€ю€€€юыъ€ьъ€юэю€э€ьы€э€€эю€€эыь€€юэюэью€юэ€€€€€€€€€€€€€€ю€ю€€ю€эю€€ю€€ьэшчю€€€€€ю€эъюююэью€€€юэьщхм÷≈ЙRMKHHHFFKKGEHNi£≈њЛH697631462268:865.&'()0;/" !  8Ђ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џcH[МіҐpXURPONLLC97\Љ€€€€€€юэь€€юююыщщ€€юээью€€€€€ююю€€юэю€€€ытхщшрчьхьью€€юююыьхфчю€ээээюэюэ€€э€ю€юю€юю€ьъ€юююююэюэююэ€ььэьщю€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€э€€€€€€€€€юю€€€юю€€юььююыюэъшж√ЖQNPIHJFGJIFFGLg°≈љЗD596534785224;FKIDCOfpН‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЊ}R=<4.1210.-.0-*,.,**+,)'((*))+%(+-++(()+**&((&'($ !      "#   !     "4Бж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќd>BJ[ЗЈѓuVXUSQQQNKKeј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хѓR.)+*&%##"  !')+-$ &69ATz±іvSUTOLHC@@A>:4) ! !!! # !   #**(*,/7=;776-%&'(1:/!!"!  8ђ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎdGUЗ≥©tWTRQOOQLB:7\Јъ€€€€ээъъ€юэюю€юэюьэъыьь€€€€€€€€€€€ю€€€€юьщты€эъчюююыщ€€ээщььэююээю€ыш€€€€эюыююэ€э€юььэюэ€ю€эы€€юю€ээьэью€€€€€€€юэю€€€€ююю€ю€€€€юъъь€€€€€€ю€ю€€€€юыьэьюэю€€юэю€€юььюшбЅЖTPNIJGDEFFFGHKi•¬љЖC8733575564139ELHCCI`mВ∆€€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мЯrE881.032-.,-10+--,*++**,-++,-+&%*.,++,)(*)&%%&''#"!   "!""! ! !"!!"!! !! "&K±€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю c>CI^ЛЄ∞tTVUSPQPPNKfњ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еl6+**)'&$##!"  #)/0' (;:CSt≠іvRUVQJFDA?>??5( " !$  " !# #),')-07::661*'#')4?4'!  # ! !! !!$!!&,(',28;;86.+'&&(3<-!"  7°€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘^H[Оµ™tYWTROPSOG:;bЅ€€€€€эь€€ююю€юю€ю€эьщъ€€ю€юэю€€€€€€€€€€ющш€юъщэ€€€юыъыьъъюэыюэ€€€€€€ю€юэ€€€ьш€ю€€юю€€€€€юэ€€€ю€€€€юююь€ю€юэ€€€€€€€€€€€€ээ€€ыъ€ююэ€€€€юю€€юэ€€€€€€эыююэ€ю€э€€€€юэ€юъъм÷¬БSNMNLJHKJHHEHOk§ЅљЗC8733683476546:FPKAAPcpУ„€€€€ьяо€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чƒ|I74144210---,,,,,,+++++))-,++)'(+-**(++)'()'%&%$%##     "    #! !! !"!  !!!"!"#"*Pѓ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”iBDI`ПЉЄ{UWTQONPLGIdљ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь»V/+,*(&&$$! '*+-(  '89FVoІ≠rQUTQMJD?>>==6*     !  ! ! !" !""',)(-2;>>;93-'(((1:.!"    6Эщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќ^I\НµђwZXSQNOROC:>fњь€€ю€€€€эьюю€€эьюэьэььюю€€€ээ€€€€€€€€€€€€€€€€юышэчщь€ьэьью€€ээюыэю€€юээ€юьэыц€ю€€юэююю€ю€юэ€юю€€ю€эыюэюю€юю€€€€€€€€€€€€юэюььь€ююю€€€€ьъ€юью€€€€€€€юэ€эьэюэ€€€€юэюэыхв‘јАQOLLKKHHGFDFJOkІ«љВ@6842565367438:EPMEDL`mИЌ€€€щ“ђƒф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тХ`@;8233100,,..-*,-+*+*()')*,-+%%()*)+')+*(())&##"$" "" #!""! !!   !  # !! ""$6|а€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эќk@ELaУЉ±wVWWTNLOKGHdљ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€о~8*,++(&'$!   $),+&  ,99FUo•ҐiQURPNJECA>>=7* ##  $!!! !"   %)!"" #"$**)+,1<@>=;4-'())08,#$#!   7°€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ќ[GYНЇђxZWSPNMPLC>?e√ю€€€€€€эюю€€€юыш€€юью€€€€€€€€эю€€€€€€€€€€€€€ььььэчшщы€ю€юэ€ьшъюьэь€эьюю€юъы€эюэю€€юььэ€эьюю€€€€€€€ээ€€€€€€€€€€€€€€€€€€юююэъю€юъю€€€€€юэ€€ьщъ€€€€€€€€ююююю€€€€юээьфныфЎњOONLIJHGGGHGHMm™ƒЉВ@576667746536;?DMMGDI\j~Єч€€уљ¶ЃЁ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч…БJ994202//0,,,,-+++*(*)(*()*+(''&')(')(+*((')&$#$"! $ !" ! !"!! " "$"  !! ###)M≠э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЌk@?JcУЄ±xWZUTMLPKHJeЉ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы™L/++**''''!   "&++-%  ,;9CUq•°gQTSROJF@A@?=7( ' "! #    *)!"#!$*'),-1:@?<:2-(''(0:+$&&#   5£€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕ[G[РЉЂuYXSPOQQKE>>e¬€€ю€€€€€ээ€юъьшшэюю€эыэ€ытц€юэ€ыъ€€€€€€эь€€€юююыъюььъыщэ€€ььью€€€€€€юьщю€€€€€€€€€€€ээюююэю€ю€ю€€ээ€€€юю€€€€€€€€€€€€€€€юэьъэ€ю€э€€€€€€€€€ьъъы€€€€€€€юыъь€€ю€€€€€ююыфсщёљ~NMKGJIGIGHKHGLi•њЉЗA6658999743368?@JOKFHWjvЬб€€ые»–о€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЬr@77332231./,*+.,+,+*+*,-*-,*()('(+*)(((+,*'&($"# !!  ! !! !" !!!"$""!  ""%3vг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘iBORaПЇґ{WWVSMKNMILeє€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЋ]4,-+**'&&%#    $')-,) +9:DUvђІeRUTQJICAB@?=5&!   !"&!!! "$%()*,.2=dЅ€€€€€€ю€€€юыэ€эь€эъы€ыцыюыыюьь€€ю€€€€€€юъ€€€€юьээ€€ьцюьыэюшюю€€€юэ€€€юы€€ю€юэ€эьэыьюэюэь€€эээью€ьэ€эээю€€€€€€€€€€€€€€€€юыщ€€€€€юь€€€€€€€эьэ€€€€€€€€юыюю€€€€€€€€€€€щжЁ”ј}PMILMIHFFHJIKOi§ЅљЕ@75345666454659=JRNHFOfpИ“€€€€хъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы’Е]:3632101/-.-+,,)),---+++(+*'*))&*,+)*)(*(')('#"    # !!   "!!!"" "    !""(F•€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўf?OU_Сї∞zXXTROLMNFGcЇ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€м=/,-,+*(&&#!!  &(-+'# +:;DXА±Ю^RUURNICBA?>;4&!   !" ""$$)+(*,1;@@><5/'$')3<.##$"    !  IЇ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э≈WI^ПЈ≠wYVTROPQQI?>h≈€€€€€€€€ю€€ю€€€эююэчь€ьэ€€€эыю€€€€€€€€€€€€€€юэшщшь€€юьью€юьыъю€€€€юэюэь€€ю€€€€юэъуш€€ээ€€юююээююэьюыью€€€€€€€€€€€€€€€€€€юэ€€ю€€€э€€€€€€€ьью€€€€€€€€юыыююэ€юэ€юэ€юьхд„‘љzNNJJHHKFFIJJLOnЂ∆љВ?77663343443357;GROGFI^j{ƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€у¶rH60240,,.,--,,-+*)*--.,()')&')('(+*((**()&%'$"##!""!     ! !!!$$"""   !!##0pЁ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э—h?GN`СЇ™tWVVSQMLMGGeЉ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч©K10-*,*)'&&"!   &)(*&"  *9;BW~ѓЭ\QUSPNHFEBA>71%   !  ! !)+((+18??<<3-&&'(2:-$$$ !   "+ [ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЅUJ`Ує™uXXUQNPQPH=Ao…€€€ю€€€€ю€€€€€€ю€€юъщэээью€юью€€€€€€€€€€€€€€€€эхую€€ьчыщ€€ю€ьш€€€юьььэ€€€эююэ€€€€ю€€ээю€ээ€€юю€€юээьэю€€€€€€€€€€€€€€€€€€€€€€€€€ююь€€€€€€€€€€€€€€€€€юэээ€ю€€юью€€ьъъчя‘ј}ONKIGGJHHHFIINoЃ»љ~>74153363573/39;CQRJDEVfrµ€€€€€€€€ь€€€€€€€€юь€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дОd<4014.**,,,.+-.-+++,--,(*++(&(((),,)()***'%$$%$""""# !  !  !#! !#&"!!   #&D•ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э–j>CM^Рљ∞vTUUSOPPMKFgЊ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юѕ_61/-)*(&%%%#  $'++$  +99CY|∞Ю]QTVSLGCA??@;4(     !  '))+.2:=?;94-')))3:,$"!"!   bб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь≈XG_Хї™tXWSQNPQNE=Bo»€€€€€€€юъэ€€€€эыююю€эъщьыю€э€€€€€€€€€€€€€€€€€€€ысэ€ьтш€€€э€юэю€€юэю€ю€€€€€ю€юю€€€€€€€€€€юэ€€€€€€€€ююэю€€€€€€€€€€€юю€ю€€€€€€€юю€€юю€€€ю€€€юью€€€€€€ьшюэю€€€€€€ю€€ьъыып‘ј}OMMKHHFHJJHHNSsѓ«їz=52/22342364238;DORIDBNbo†с€€€€€юьэ€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щіАQ74124/,,-.,,,-++*,*,-*))(**'&)')(*,,+*+*)&%$$$ !!     !#!!!"$#!"  !%-l÷€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўk@DL_Тљ≥yVWVRNNQLFGeЉ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЙ@222.*)'&%"!$     ((.,% )9;FX|∞Э\SSURNIDBB>>;2) "" !   '(',/2<@@<83,&'))29+$$ !   ^а€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы√XI`ЦЈ®tWUUQLPRMF@Bp €€ю€€ююэьы€€эьэююъэюэъьььюышю€€€€€€€€€€ю€эь€€€эцщюю€юэ€€€юьщьюю€€€€€€э€€€€€€юь€€€€€€ю€€€€эээюэ€€€€€€€€€€€€€€€€€€€эююю€€€€€ээ€€€€€€€€€€€€ю€ю€€€€€€€€ю€ю€€€€€€€€€юююьыс÷їyOKJKGGGHINKKNTuѓ«Љ{=42144220124457<83,(%'(3:,!""!  `в€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЊWI_ШЈ£u[WURRRQQL=Ap»€€€€€э€€э€ю€€€ьъы€€€юю€ююьююыьью€€€€€эщ€юьычэээщ€ъщюэы€€€э€€€€€€€ю€€€ю€юю€€ээ€€€эъэюээы€€€€ююьэюэю€€€€€€€€€€€€€€€€€€юэю€€ю€ю€ю€ю€€€ю€€ю€ю€€€€€€€юъэыюю€€ю€ьщ€€€€ю€эшнЁЇwNMIIKIIKHHHIPUvЃјЇv9441342/34532379=COQPHBNatђо€€€€€€€€€€€€€€€€€€€€€€€€€€юы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЧrD<6-,.0//-/.,,),*,++)*+(()(()(()&&''''#()'('$! !    !  "   !"" "! " !#$(@Ыщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы»fAHNaЧЋљxXVVSQPPNGFeї€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оИA220---+*(%$"#!"    $$%*(!  /==:5.('()3;+ "!   dй€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъїXKaЪє¶x]XVTRRRQI?Bp…€€€ююъ€€юыюъэю€ьэюьэ€€юьюыэъэюью€€€€ыуцюъчыхщщ€эъьыюэ€€€€э€€€€€€ю€€€ю€€юэ€юю€€ю€юэ€ьэюю€ююэю€э€€ю€€€€€€€€€€€€€€€€€€юэью€€€юю€ю€€ю€€€€€€€€€€ююю€€€юыэъ€€э€€ээю€ю€ю€ют÷“ЇsNMGGKGIKIIGHMUxЂƒЇr71225230.54/.354;DOQOGAF]lМѕ€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шЅН_@:4-./...,-,--')*+++*)))((*,))'('()')(&&%#%$""  "    ! !!!!!"#'(0mў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьћgDDIbЩ∆ЄrUXSSQQPOHFdї€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю©M3./.---))'##"#      #&$($ +7:DUx™МTRTSQMGAA@?><1& !!! ')'+,1JcrЧ”€€€€€€€€€€€€э€€€€€€юы€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ»Оb;5830,,./,,---,,,(**(+,++*'('(-()+)&)*'$&'&&##    "! ! "!  !!  "#(*,9mЌ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы…d@FNbЩ≈ЄqVWTONONJDHeЈ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€нxB20/,,)'')($"   "%%"  -87EXxђМTTSQPKHB@??<<6( !! %*)+.3?B?==:1*'*(3:(    [Ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч≠SLeЯє®v^[XUSSRQMDGtќ€€€€€€€юююьыю€эш€€€€€эю€ю€€€€ю€€€€€€ышфщхююшэ€€э€юьююьюэ€эь€юьюыю€€€€€€юы€эью€€€€ю€€эээьююэ€юэю€€э€€€€€€€€€€€юэ€€€€€€€юь€юью€€€€€€€€€€€€€€юэ€€€€€€эээ€€э€э€€€ющюэю€юьйєrONKJKILWUVVMMS|ї–љs964220112/.2458:@HIPTNE@F_nЙћ€€€€€€€€€€€€€€€€€€€€эюыэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЩP924510/-/-,.,,+,+(+)'),-*+('((*++)%&**(%(%%&#  !!!   !! $%).6OХх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы…c>HQbЫ»≤oWWTQMMPMFGeЈ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЂL//-,,+'''((%#    !!!  -95CXy≠ЖPSRROJGEA@?<81)! !"!'**+.5?AA?=:2('))37'     `д€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цІTMdЪЇІx]ZVVTSQOJ@Ft €€€€€€ьщ€э€ьшю€ыю€€ю€€эъы€€€ю€€€юшм€эыыъы€юыьюыъ€€ююю€€€эъ€€ыщюыэю€€ю€€эыюэю€€€€юю€€эээюэ€€юью€€€€€€эю€€€€€€€€э€€€€€€€€€€юь€€юэ€€€€€€€€€юю€ю€€€€€ю€эюэюэ€э€ьььээъьъуп„≥kPMILKLJTOOUKJRvЇѕїl940/10341//0248<>ADLOMGDCZlzґу€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ ПjB5002200-/-+*,+,+*++,*-,,++*(*'(*+)'&))(&((&!!" " !! ! !$-;Qtє€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЌc>EPcЩ≈іnUVUUQOPJFHcЈ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э∆]4,.,++*)('&%%!      ""!  /9;FX~≠АOSRQMHFEEA?=93' !! !   '+*)-7A@@?<82))*,15&##    _ж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч©TNbЩЇ™x\XUTQQQNF>Er…€€ью€€юыэщэ€ю€€ю€€€юю€юшюыю€€€€ьыщхрээыш€ьфэьыь€эъ€ьэ€€ю€ээ€€€ьэ€€€€юьэ€€э€ююю€юю€ээ€€ю€ю€€€€€ю€€€€€юю€€€€€€€€юю€€€€€€€€€ь€€€€э€€€€€€€€€ююю€€€€€€ююьююю€юю€ююю€€ююыышЁ≥lOKLNKHEHFEGIKQv≥«єm645011141100266;=>BGNKHEBRhpЩЏ€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фШ~S940/00..---**++,*()*,+,,*+)&&'&'&'*'%'(&'&&" " !!! &3LiХд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эѕfDGMaЦј≥nUXTSPNONGHdЈ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юд{A00/,,++)(&'##!         .:8FYЖЃ}TUTRNIGDCAA?=5)    "! #! &*((.8A@@A=60,+,-38'##   _ж€€€€€€€€€€€€€€€юц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч£SMaЧЈЃ{]YVTRRSNE?Erћ€€э€€€€юээю€юь€€€€€€ю€€эщшфю€€эхфччуъ€ю€€эщэыцюъюь€€€юэью€юю€эъюю€€юэыь€юю€ыэъюь€эыь€€€ю€€€€€эыэ€€€€€€€€€€€€€€€€€€€€€€€юэю€ью€€€€€€€€€€€€юю€€€€€€€€€эюю€юэ€ь€€€ю€€€эт÷ЈnPMMKKHGFGIJINUx≥√Јs448.1101241258;=FQQNHEBWfoУЎ€€€€€€€€€€€€€€€€€э€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€юцш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эяРfB94011..-,.,,-,,)++*)*(((*()(''&)*)('%%%'&%$" #  !!!  !"!$)>ENQPKD@N`jБ¬€€€€€€€€€€€€€€€€€€€€€€€€€€€юъэ€€€€€€€€€юъ€€€€€€€€€€€€€€€€юч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЂБT=73/.---,,,--,+,+**,**&&(+)'(())(&(''&&&''$#  #  ! #!  !"##%0PЩс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъјaAHNaЧ√±oWWVSLLNLFHhљ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сВI100/,+,(&(&%&$     #"!'   -57G\Кі}RTSRROHHDBA?=7+#""!" !!   ()')-8CDFDC?3++).78,%#"!   !hь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хНTM`ЧіІv\XTQSTRMGALzё€€€€€€€€€€€€€ьцщ€€юфърюьчььыэ€€€€эюььчюыычю€юэю€€€€ю€юьь€€€€€€€юью€€ы€юь€ю€€€€эюэю€€€€€€€€€юю€€€€€€€€€€€€€€юэ€€€€€€ю€ю€юь€€€€юыю€€€€€€€€€€€€ююэ€€€€€юю€ю€юэы€€€э€ыюэх’µlQNLLKIIGJIJNOTt±»Љw:110279688;9:978:?BDKPSNGBDYhs°и€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь‘Д`C:72.-,,---*,,**+*+++++*()++*+++,*()()*&#"%#  ! !! ! !"#+At”€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы¬eBDNcЧ≈µrXXVSLIONGIeЄ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≠T?21..+),)'%$$$!     !#!"!   -77E[Ж≥QQRQNNGD>?@<<5)##%#"##!""!!'*').9BDFFC@8-,+/9;)$##$       jь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хНUOaЦі£s\XUSSURMEBM{а€€€€юэщэы€€€€€ьь€эьпьпцыыюышыэ€щфэюэ€€ыьь€€€€э€юьэ€€€юююююю€€€ю€ээ€€юыщююъ€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€€юю€€€ью€€€€ыюю€€€€€€€ю€€€эю€юъэ€€€ююэъьюью€ю€€юэюф”ґnROMLHGJKJJLKNTu≠¬Њy;331477778879888>ACDJPRQJD?PdjБЊ€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЮnF9830/.,.-,-*++),**,*(),(&())*****)''))'&!! ! ! ! !"&1XЮы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы¬fADQaЧ√±oYWUTPNNKHJeЈ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€«[A:00,.,,***'$$#! ! !   !    ,48EZЗ≤БQRSQNKFDB@?;:5+&"$" !#"!!!&'))/:EHFGB?6,-,-;?+#%%%     !kф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хЙTOcЩЄ¶s\YURUUSMGDN~а€€€юьюэъъ€€ь€юю€€юээъшшэтъ€чъэ€ъф€€€€€ыцшэю€эю€€ююю€€€€ээ€€эээь€€€ю€€юэю€эю€эюэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ю€€€€€€€€€€€€€€€ы€ыюэююэш€€€€э€€юэ€€€€э€€ььюр–µlROLKJKIKIHINQTz≤≈Їo:53022345568:79;?@BDIOPRKE?G_frҐи€€€юь€€€€€€€€€€€€€€€€€€€€€€€€юы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э÷И\;5830/-,/-,-+,,),*)*('),('''*+,*+,+'(''($"% !      !""$(7xё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыЅc?GP`ФјЃl`YTSQMJIFIdµ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЏmB;20/,,+-*'*)&'# "!   !   ,47C[ИЃ~OQSRMICCC@?=<7,'!"$!#" &')*.9FFDFB?4*,,.:=-&$&%!    pэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фДQNhЫі£u]ZTSURRPICJВж€€€э€€€ыш€ььэь€€€ючшъпшъхщьъэыпъэ€€€€ююэ€ю€€€эю€€€€€€€€ыээ€юыю€€юэыэ€ююю€€юю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€ю€€€€€€€€€€€€€€€€ю€ыюььщю€ью€€€€€ю€€€юэ€€€€ээу’≤lRONIHMMIGIJOPU~є«ґk9621224645;C>:;;=?CCFKOTNF@BYgnЙ«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ°yM6862.-,...-.,+,,)(')(())(*'',.,(+,*(*')*%##"!     !!"!$'CЭ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь»d@FP`УЊЂh_\VRNOOIGLfі€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цИF95100.--,)'((&'#  !      -3:E^Р≥{PSSSOGBA@B><=5+$#"#"!$$!   ',*-.9CCCFB?7+-./:;*%#$#        v€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЖROiЭ∞Яs\YVUSSSQJEK}з€€€эшэюэюыььэю€€€юьь€щшыыъсчэшы€ъъ€ю€€€€ю€€€€юю€€€€€эю€ючю€€€€€€€ыюыэ€€€€ю€ю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€ью€€€€ююь€€€€€ю€юью€юю€ьъ€€€€€€э€ю€ююю€€€€юцё∞iQPPLLKNJHLJNOXВї√≤f84434556849FA=;=:5,&###%$!!-13/1=JLIHC>6.-00::+'%"      qы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чДOOf°ї®v\XWWUSSPIEOГз€€€€€€эщюью€€щюю€ючрь€юьчтчььшчхю€ю€€€ьщю€€€€ю€ю€ю€юэ€юю€ю€€€€€€€€ю€€ььюьъюю€€€€€ю€€э€€ю€€€€€€€€€€€€€€€€эьлян€ччюююэ€юэ€€€€€€€ю€€€€ю€€€€€€ю€эъю€€€€€€€€ю€ю€€€эюыээьус„ЃfPOLLKNIJKKLNOWБЈ ґg96516555899;;8<>AA?CDIORSNG>>UhjБЈщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юдО`B;82///,++,,,-++)))*),*)++)&*)&'+**+*+*(&&&# !      !# !"*Z €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь≈aAGOaЧ√ђkYXVTOMLLFFdЄ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€’m?:@53/--,*****('""$            $067B\П≥xTTPONIGAA<@=99-$#$$#""#*15/2;GKKGC?7//02<;)$$#"        %sь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цАNMi£єЯo]YVVTUPMGCOЕи€€€€эюшо€ю€€юъ€ычюъф€ьь€ччщш€щшцюэю€€эъ€€€€€ю€€€ющ€€€€ь€юыьэ€юэ€€€ю€€ю€€эшэ€€ю€€€€€юю€юэ€€€€€€€€€€€€€€€€ьыпхэ€€эюю€€€юэ€€€€€€€€юэ€ю€€€€€€ющю€юэ€эю€€€э€€€ю€эю€юьэюэюы№ѓhPPLNILIIKMOOPXЗЉ ґg98814677:7;;:9?@ABDECIMPNPI@:MejuЂп€€€€€€€€€€€€€€€ьь€€€€€€€€€€€€€€€€€€€€€€€€€€ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞wR<73201.-+)+++++,****'*)'*,((-+&((),)(**&&#%#!!  ! ""!!"""$&=Нъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыЈbAHRcЪј©iZYVTMLNJFHfЈ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йzF325320+++,.*()(' "#!     $178C\Р∞wUUPMPMFBCA??:7,'#$$&#!#"(.0.3:DHJIDB8/0/1<:%##"!    tы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шВNNi†µЬk\XVUTVQOGEOГг€€эююээшю€€€€ю€ьпэющчьэытщьээюуч€ю€€юэ€€€юь€эюэю€€€€эю€€ю€эыююэ€€ь€€€€€€€€€€€юю€€€€э€€€эю€€€€€€€€€€€€€€юэыю€ю€€€€ью€€€€€€€€€€€€€ъю€€€€€€€€ю€€€ю€€€ю€€юэ€ююэшю€юь€€ю€ьёђkRPMPIKKKKMOPQYЛј ≥d8:52698;75:;9:AAACFGGIMOOPIDSfuҐќю€€€€€€€€€€€€€€ээ€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы•nG7420/0/------,*++*,****'*+*)('++,-*'(()%(%!" !     "!!$(9Иц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЅh?ENaЧј§eYURTQOPIEJgЈ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ї]8212000.-+)+,,'(%%#""!!#         &444@VИµPSQJPJDB?A@<;4*$!$&$%'#!!'))+07CIJJGA7//13@;(#"%"    "nы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ~LKdТ≠Ыl\ZXVVUROLDOДз€ю€ю€ээю€€€€€юэчхшш€эфнсю€ъчюээш€ььюэю€ю€€ю€€€€ю€эюю€€эюэъэю€€€€ээю€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€ьчюю€юю€€€€€ю€€ю€эю€€€€€€€€€€€€€€€€€€€€€€ющыы€€€€€€€€ю€€€€€юююэьэёЃgSTQNOJJNOOQQSYГљ…≤^0/58:;;::;<=;<;?CEFFFGKQQRODA:IalАЃг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щНVA863.///.-,+-+)***')()))'**))(*)*+*'(&'*()%"#    "" #"'*Sє€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьєf>DPaЬ√†aXWTRRPPFDGfЈ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аs@42/30/....-'(*''$&#"#"!         $205>XНµ|QTNPRHDBA@A;;7-#$##%&'%"  ""   (,,+2<'#!"!     #p€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ}NMaСЂЩl][YVTTRPKEPЕж€€€€€юь€€€€€€ъкффыыхцфыыюхцъш€€ьэчьюъю€ю€юэ€€€€€€€€€€ь€€ююъыэь€€€€€эю€€€€э€€€€€€€€€€€€€€€€€€€юэ€€€€€€щь€юээээю€ьюююыю€€€€ю€€€€€€€€€€€€€€€ъь€€юэъю€€€€€€€€э€€€юююю€юых„™fTRNMLKMNNJPQQVЕљћ≥[,*28:9<99;=@98;@ADGGEEKMNRPED<@YhwЩ»€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЌuG:562.0010.+*+*(***'()*)*&*+*(***,)**)(()*'$!##   #!"##'4~п€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эјd@BNd†¬ЮdYXTQNNPJGDeµ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йМN422/0/../--+(('&(%%##          %113A[ЦЈvQRQRPIECAA@?=6-%%#"#$&$"" ! "!"  &*,.1:8;=>=:<@?FHIGEJMMSQKE?;PerЕґд€€€€€€€€€ы€€€€€€€€€€€€€€€€€ю€€€ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЭhA634/.010.,+**+*+,,)+++))'*++))*)''*,*)*(&#!!""!       "%(,R≥€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э¬bCEPdЫ√†aYWVRPPOLFHgЄ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЯU84101/.///-))+*%&($% "     #415?ZЦЈtNPQQQKD??A??>5-&"$$$"%'!!%"! #"!#!!" '*).1:BEELK@:2/.2=;)#     #x€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шzNKdЦ≠Фg]\YUVVSQIGNДж€€ющэю€ююьъюю€€€юцсшы€щээю€юыэю€€€эъ€€€ьь€э€€€ээ€€€эю€э€юэю€€€юэээь€€€€€€€€€€€€эы€€€€€€€€€€€€€€€€€€ююю€ыъъюю€€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююю€€€€€€€€€€€€€€€эьюющ’™hRPOLLLJJOLPNOVАіЅ™P$)+2;<=;9;<=A?>>CIGFFGHNNSTNEBC?=>DGEEHIKMMQUQG?>CZjn|ђо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЩlG9341.041.,,,+,,*((***)+***,))*-'(*'&'&'%&(&" !  ! !$#%0P™€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЉd663221.1.--,,&')*&&$#    "&%973AbЫїuNPQOLGFDB@A=<9-&# "#$&%$" !!!! "!#% """ ""!!" "!'+),5=EGILNG=2313><($" "     :€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хwPKeЦІЪm`]ZYVWTLIIQИг€ьююэ€ьыю€юэю€€ыфцэщььцыьэь€ьшъ€ыю€€€ююьъ€эухююэхъ€€юшэ€э€€ыю€юююью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эющюэ€ю€€€ээ€€€€€юь€€€€€ю€€€€€€€€€€€€юы€эю€€€€€€ю€€€€€€€€€€€эцыр„ђjQRMLKMMOJMKLNVЙ≤ј®N" &'-7999:>?@@AAGGIKPPOSTTPGD=F^ghАЄъ€€€€€ыы€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ҐqG::6012.././.*,**)+&&**+('(((**(*+&&())"#$!"! !  !!  ! !!$,PЂ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЉ`?IRfЫњЩ_WWXTOOMKGJfЈ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€нK6422210//-,-++(''&(###!   $3B55BaЦ∞iOSRPIJFBABA>>9."" !#!%##'%!"#"""#" !"%#"!"$ %%" !#"%)'*1;DJKLJE>51.2?9*&%$!"     "pь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фwMLeЯЃЫmc_ZWVVTPHDPМв€€€€юэ€€€€€€€€€€чхзкъс€эълцыч€€щущ€ю€юэ€€э€э€€ю€€€€€€€юэьэ€€€э€€€€€€€€€€€€€€€€€€€€€€щыээ€€€€€€€€€€€€ьюю€€€€юь€юьэю€€€€€€€€€€ю€€€€€€€€€€€€€€€юююью€эю€€€€€юэ€€€юэь€эщу“ЂcRQPMKNKKJIIJOU}≥Ѕ™Q $$)-/17;<>>?@?AAB@GILIMRUSSKF?>ScdoЯ№€€€€€ээ€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юиС]>:623021//./.*-/0,.()**,)))((**)+*('(&&$%%%# !!  ! !! ! !!!  !! !  ""$"$%#)3sй€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эµ^@HOeЬљУ_YXUSNOOLJJfЈ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю®V:742301/./0-,)*(&$%&!$##"     ,853B]РѓiOPQOJKCDBD?;<8/$ "$$$"%&%#$"!"#""!$#"!!!##!"$#"!#%!!&))*4>EMNMLF?4312><*%&$""      #iь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тxNOhҐЈФib^XYVUUQIGRЙв€€€ююю€€ю€€€эюэючиЏёъщюээыъпъ€€ч€цхюч€€€ью€€эых€€ю€€€€€ьэы€€э€€ю€€€€€€€€€€€€€€€€€€€€ыщъэю€€€€€€€€€€€€€ююю€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эьюььюю€€€€€€€ю€ээ€€эьъ󹓩cTRNLMLONKKJINT}ЈƒЂQ!!$(,/2147;A??AACCCCGIIHMPRSTMEB;H^diЖљ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≥yJ7521441.00/.,-,/1/5,+,)(*),+'*+*,*)*+&$&&%$#"#!! ! ! !#!       !!"#$%%'.IЬ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Їc?DOeЪјТ_WVSRPNONKIgі€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќgB63222/.-..-,**()$#%$!$!#"    $222A]СЂfNQQLFHABCD@>9:,#!!$&%"!#%'%$##""!!"&#""" "!#$###" ("!%)**3?FJMRPG>4333A>)%$$"    $nь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рxONh£љХhb]XYVVUOKIQЙе€ю€€юю€юэ€€€юэпычшчрчуюъььюьъю€фэцщ€ыь€ээ€шцюыьюьь€€€ьэээ€€юью€€€ю€€эю€€€€€€€€€€€€€€€шыь€€€€€€€€э€€€€€€€€€€€€€€€€юэюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€юэ€€€€€ю€€€ъыюу÷“®eSNLMMNNLKKMMPSБљ«ђQ$$&+037434:?BCDFHIFHKJLJOPMSUPGC=@Weit£в€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фФb>6144130./0/---,++/5,*)**,*++((,,,()))&%$#$#"  !" !"! ! !!&$)6oё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы€≥d>ALf†ЅТ]XWSRNQQJEFiі€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џrG942020//.--,*()&(%$'$!""  #22/>_Ц™fNPOLHFCB?CA?=<+%##%%#$###&'$%% ###$##&$"""!#!##$$#&$"&**,1?EGMSPE=6545E@*%&$#$      "oь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пwOMd†љЩhb^[XUWUPJGQКж€ьыю€€€€€ью€€€ъьлрыщхчью€юью€ьыьючы€€юэ€€€фшээ€ююэ€€€€ью€€€ю€€€€€€€€ю€€€€€€€€€€€€€€ю€€юь€€€€€€€юь€ью€€€юэююэ€€€€€€ююю€€€€€€€€€€€€€€€€€€€€чы€€€юю€€€€€юыыю€€€€€ь€юъщч№“ІgRMJKPPKKNMLOQTДљ»≠Q%%*17::6357;BGIKNNJKMMLJLOLRUPID@;NbgkЙЊ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЅtK:735000../,-++-++)*.++)*+**))&'*+-)'&&$$"#"!!" !!  !  !  !!  !$&*GЧ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы±`>FOh®ЅР[XXSQLNQLGGgµ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€к|L962124/.//.,-)((&'$$%#!  #31/@_Т™iNPNNKFAAAECA>:-$##%'$%&%$%&%$$""%&%#$%&$$!!%$$$#$%%%"'---5>GJLNMC<8835@<*&'##$     !qь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рsLMbЪЄШfa]\XUWTNIHSОс€юьэ€€€€€ю€€€ыхющыюэщыъ€ъшцээ€ъчюю€эцэюю€€€ю€ььы€€юь€€ююэюю€€€€€€€€€€€€€€€€€€€€€€юыыэьыю€€€€€€€€ю€ыю€€€ююьэь€€€ю€ю€€€€€эю€€€€€€€€€€€€€€€€юэ€ьэ€€€€€€€€ююэю€€ы€€€эьь€ж“≠iSQNNLPNLMMJKOUЕЄ…ЃQ((-49;<8976647?<+%'$!        "n€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€мrKK`ЦЈХeb^[ZXTSOIEQРт€€э€€€€€ю€€€€ццыь€€дц€цщэфътшхьыью€юью€€€ю€€€€€эю€ээ€€€€€€ь€€€€€€€€€€€€€€€€€€€€€€эшэьээь€€€€€€€эю€€€€€€€€э€€ььюю€ю€€€€€эю€€€€€€€€€€€юь€€ю€ьююэ€€ю€€€€юю€эь€€эю€ю€€€эд”™dQPNLMNMKMKKINUЙљЋђK&),59;><:510310---.-+-+-,,,-,,***,+,'(,)())$#&$"!$!!!""!!""!!!"! ""  ! #! "" " #$%*CР€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞]?DPnђ»Ф]XUSPNOQKGHgіэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю≥[=73303300110.-,)''&$#"# " "!  $5.0B]Р™lLMMMKGGBBDA?><0$##$$"$$"$$$$%%!"!"$#$##%$$#%"%$&%&%&$(,++4>BJPPPK@:636@<-&&(!     %qь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кqJJ`ЧµРec^[YWUTPJGQМею€€€€€€€€€€€€юърщ€юцпсхфщыэыышюэь€юь€€€€ю€€€ююэю€€€эщ€юэ€€€€€€€€€ю€€€€€€€€€€€€€€€юь€€ю€э€€э€€юющю€€э€€€€€€€€эыю€€€€€€€€€€€ю€€€€€€€€€€ю€€€€€€€€€€€€€€эы€ююю€ю€€€€ю€€шџЋЦ]UTOMOKLNLLKKOWНїƒ§A"&/7<=@?BYУµЬgPNORSVYZ`b[XTTUVWOEC;H`ij{Ђв€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€†eC95520010///.0-,-,*,,*+*)*+-*,('*()))$#%##"""  ! !   !    " !! !  !  ! %$'/^…ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€±bCDPq≤ЌЦ`UUTQNOPKFIg≥э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћf<7663/220020/-,+((('% #!!     &5/1BaФ•jKIJONHECEDC?@<0$##$#"%$!$##&&$#""!$###$##$!$%'&%&&''#)(,,4@EIQOOJ@<742?<-$&)&       %xь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иoJJaЪіОec^ZWWVTQJGQНн€ю€€€€€€€€€€юэфчшээщчъыъцъэюч€€€€€юь€€€€юю€ю€€ю€€€ююэ€юэюю€€€€ю€€€€€€€€€€€€€€€€€€€ю€эчьэ€юы€€€€ью€€ъыэ€юю€€€€€€€эююэю€€ю€€€€€€€€€€€€€€€€€эюъ€€ю€€€€€ыээьь€€€€€юээю€€я≈С^TSPMNKMOLKMNOYНіƒҐA %08=<=@IUhЕ|^QRQSPOQV]ced_[ZWTQGC>AUfkoНњ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вОV?5132.,-////,..--,,**+)**,++)+(('(),)&$"#"  !  ! (    !   !    " !!  !  !&%,@Еэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѓcDDNn≥ С^YVUSMOROIGf≥э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жqD8996422/000.--**)'('%#" !  %300?^СЭdONQONID>@BA>=9/$"$#%%&%$$##$%##"" "%&##!##!%(''%'&))'((,.5AGJQPLG?:766@:)&'%%        &{ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дnIIdЮґПfb^[XWVPLGGSРт€€€€€€€€€€€€эьххщчшьююыъюью€юшэ€э€щю€цшх€эээ€эщю€€€юы€€€ььэ€€€€€€€€€€€€€€€€€ю€€€€€€€ыхуь€€ю€ю€€€€€юьъэ€юьью€ю€€€ью€э€€€ю€€€€€€€€€€€€€€€€€ьююъю€€ю€€юэьэ€юю€€€€ъююь€ыд»Ф_PNPPLMLHMKNNLZН∞Њ†B '/4:;;DOTQVVSTWZch\POUZ`ejigd_YLG@;J`jk|∞ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€¶qJ;464/./--./.-,,.-,.)+,+**+,,**(('++)('$"# !   '!  ! "!!  !! ! !""!! ! #&3_Љ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѓ^CCLl≥ћР\VTSRNMNLEGf≥э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иДJ::753222/....,.*)(&($!# !  &:30?D@?;7-&#$$$$%%$#%"$$$ """!$%" !"# &%''&&&)('&+*-8@DLORJG?6558@;,)''$        (|ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аpJHcЭ≤Лga^ZYXVNHIIRОм€€€€€€€€€ю€€ьшщыщшцьэыюьюьъшшфь€ю€щээщышю€€€эъю€€€€юэ€€€ъьэ€€€€€€€€€€€€€€€€юэ€€€ююю€ыыф€€ю€€€€€€€€ю€€€€€юэю€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€эьыъхээю€€эщью€€€€э€ю€эююыжЋЩ`QRPMJLNJOLMLJYР∞їЯA)35:;?LTWVUTTUYctЛИtaUSTYgmorrj^SI9@VejqЩ„€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еКQ?8685.10/.,--.----*-++,,(**,,+++)++'&%%%#"!  #  !  " ! "!" ! ! !"!!!!!## #(=Гт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ђ[BFKhђћН[XTTRMMLLHFdЃэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чПT999311211...-,,.,)&&'#""  +A=:@MwВVKROOKIDA=BA><9,'"#%%#&&#$#"%%# "!#&##!"#!%$''(%&(($(+*.8=CLLOIF@2536A;.(%($    *Вщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аnJI_Щ±Иec\ZZYUQKJITСо€€€ю€юэ€€э€юьшхчхью€ю€€э€€ьц€эю€€€эюы€€€€ю€ю€€€эю€€эъэ€юю€ю€€€€€€€€€€€€€€€€€ю€€€€ьююьыьэюы€€€€€э€€€€€€ююью€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€эь€д÷ш€€€юыю€€ю€€€€€€€€€ююе ЩbRQOKJPNPMKMKLZТµљЯA!)459;FRWXWWWWVW]jЕЪ¶ЬЖlXRX`emuvsk`K>L]fiВґь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€•hB785540002/-----.-/,,,-+++*)*+*,*+))'(&#%!"" ! "!!!    "! ! ! !  #$   !!"!! "&&$$'.Wє€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ѓ\@CJe¶ћН\YWUQKLMHGHcЃь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Љa=:;6122510//.-,+,+*(&'#"!  /C>>DSv|WMMQPKHE>?@?<<:*&&$#%%'%!%#!$$#!"! !#$$# "%%#%'((''')&),*/6=FKNMNIB6326B;+*5*#        )Ащ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вjIK`ЭґЙeaZYZYVTNKISЦф€€€ьэююэщъыьэьщъьъюэ€эю€€ьы€€€э€ыь€€ьюю€ьтюь€€€€€€юьюэ€юэюь€€€€€€€€€€€€€€€€€€€ю€€эю€€ээююэьэюю€ыю€ю€€€ююээ€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ътчы€€€€юьэ€€€€€эээюыьььЎЋЪbTOLIPPLOLNOMPZРµјЯ? (/07;>-&&"%%&%"#%#!$$###""!""$##''#$&('*'&()(--/7>EMQNNLB9349B9-;=+%!     (Вщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ёjIJcЯєЙda\ZXWVSNKMUЩш€€€эыыьшэ€€эьыщ€чыъцчы€э€ющююь€€€ю€э€эъ€€э€ююьыюю€€юююэээ€€€€€€€€€€€€€€ю€€€€€эююэ€ю€€ь€€юэыьэы€€€€эюю€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыьюю€€ю€€€€€эюююю€€€€ъьы€€ыв ХaRMJMPMMLLOOOO[Фє¬Ы=!+..7>PY\ZYY[[[ZZ[Y]m~ЪіЉ≠Лq^SS[dlrxwqoqonБѓи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€єpK?:2/.11//---./-++,-.-++++*)())('(&&%&$#%##! !" "!!" "! " "!"!"""  !"!#" !!$&#)-Rі€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≠W<9,$$$&%&&'$$%$%%"$$#%##$#" $$%$$$''(&((&',-1:=ELLOLKB856:?87=0+(!    )Еъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џmIGb†ЇЙdb^[WTWSLKKSШх€€€€€щыч€щьэюьэ€ютьюъфьъ€€€€€ъь€€€€юь€юь€€€эььыьэ€€юьээьэъ€€€€€€€€€€€€юы€€€€€ъююыюы€€€€€ю€€ююыю€€€€юю€€€€эю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€юьюю€€€€€€€€€€ю€€€€э€эщ€ю€ыуќХ`RPPNKKJIJIMNO\ФЄ√Щ<(-/7DSX\ZZ]]]^]ZYZXXZe}Ф£Є∞Рo^URYbjr{}~zНЈЏк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тТ[C<92///1-0---/0.,,--.+*))**(()+(''()%$$$$!#!!" "  !"!  ! " "! !   ! #" !""!! !$!!$$&'+8xо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€™V=?Jj™ Н]YVUSMNRNDGdЃь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уФQ=;:;<:78232.-+++()(&&%##  %29:Et®Ґ{p}hVQPJGE@@@?=;:-%&$$#%&'%%&&'&')%&'#$&##$%!#&&&((&'*'&'-,1:8.%$'%$#$&%&(''&+()&%%&&%$$$#$%&%()'&'(&&-,.:>DNNOLKB5566C8,)*%(#      'Бч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”jDGeҐ≥Гcb_[XVUOPNIVШф€€юьщ€ю€ьычъ€ьъьью€€€ю€хы€ю€ыэ€€€€€€€€юэ€€ыю€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€ю€ыюью€€ю€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ююьюээьн–Ц_QMLHKMLKIIKJN^ЧЇ√Ъ9 '+,6JUXZ[]_^\`___]YYYVUSUawАИЧІѓЧhYVZbn|ИЛШҐІ¶•Њ‘аю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь†aE>962.,/..,0//0/,*+.-,*+*)(+)*('(()'##""#"     $   $!#%  !!!"" "$#!! " "  !#  !  ## ##!%%&*9uп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эђY<>=;97553/-./,*)'&&&"!     !%)+04179=o©≈…ђ~^ZYVQNGHEA>???8-#&%$'&&%&%&%&&&(*'%%&&&$$%&"#(&'(('')$$(+,9?DINRPJA3454A8.)+('%    *Еч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘jFIf§≥Вeb][XVURPKLYЬх€€€ю€эыэююцъъышэучцююь€ьюю€ючфщ€ъэ€€€ю€€€€юэ€€эьь€€€€€ыььы€юэ€€€€€€€€€€€€€€юю€ьэ€юэ€€эю€€ююю€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€ю€€ющюцўћЦ`PNHGIJJJJJKLN[ТЈњЮ>#((4GRTX[]\[]___^\Z\[YZUVV[\anП≠≤±§СraVYepvГТЬ†ЫЪ°≠ џю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘ГP@<:62/..-.,/0..0,+-.,*,+*((')**('''%$#%! !!"   "0 "# #, "%&!!!  !!!"! !! !" !" # !"%  ""$"$"##"$#$%*/L§ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃY:>KeІЋУ[YTSTONPKEDdѓъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иtF?;<<=;;76720/..,,*($$"""    !#"#).234229:0&$%"%')%$('&)'$'*(()%%(%&*'#!(()'()()&%),.6@EGPSPKB6454?7-++*'#   .Ич€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∆dHJg§±dc^ZWWVTOIJWЬц€€€€эчыыэээьь€ъшщюэьюьэ€ъэ€ьыхьэю€€€€€€€юъэ€€€€€ю€€€€эъ€ьъ€юы€€€€€€€€€€€€€€эъ€€€€эш€€ъэю€ью€€€юь€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€юэююэюх„…С]QNHHHKLLMJLOKYСґЊ†@$(0CNSY\[Z[]_^[]\\\\\[X[ZXXWWdqДЧ¶ѓ£ЪЕo]Y_gvЖМФЧЩ†™ђЅ„ч€€€€€€€€€€€€€€€€€€€ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€•iD=:83410---...,./.-.-,)-+++*('')(&'&#%$"!!!"!#!  "   !#!)*((+$#  !" ! !"!!!!#"""#!#""! $$##""#"$%$%*4oяю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь≠[;=HcІ О[WVTRPOPKEFcЃъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лВI=<;:<<:978300..,++(&&$"" !!!"%).356205;>AGFL]eZWcXDEIGGIFAAB==;.'#&"%%'%&'('(('&*'()%&(&'*(($$')%'&&'$&++07?FJOPOKC:657@8,**'%#      +Иш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€јbIIe°≤`b_YYWWTOJITШх€€€€€э€юьъьюьчхщ€€€ью€щю€€€ююьхы€€€€€эюъюыю€ю€€€€€€€€ыь€€€€€€€€€€€€€€€€€€€€€ю€€ю€€ью€ью€юю€€юю€ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€юю€€ээьюэюьнў»Р\QOLKHJJIMKKNL]ХµљЭ=#&.?JSUXWY\\[]\]\ZYZ\Y[]]Z[YXXU]grДЦ™≤®Мui^_ov|ДСЫ££Я®ЇѕЁ€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зЦ\C=<5/21-./-...+-.//.-.-,-*,)+)(*'%%%$&$!" !!$!  ! !##!!!!! "$#$& #!!  !## " ""%"#""! "%#! $!!"!!#$#%#%""##(((,E°ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ђ\;@Hb§»М\WTSSPQQJGFdѓъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уОO<9<<9;=<987101,*-/)'&'%#! " "!!#*.3535655:?CFE>>BK\pКfA=ABEFBBC@>=8-%%$$%&'%%'(%&('%(((('''()()+('((&(&&&"&+,/9>EJKOMF@9868?:-(''%"     .Лц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≥_HJdҐіДjd^[ZWVSPKIUЪф€ю€€€€ю€ыыыьшщчюьъъь€€ъэ€€чьэ€ьыэю€эюю€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€э€€€€€€€эыь€€€ю€€ю€ю€€€€€€ьюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€эююы€€юэ€€€€€€€€ь€э€€€эъюыэиЏЌТ^SNMLIIIHLLKMR^ХµјЬ: !+:EJNQTYZZYZ]^[XYZ[Z[]]\\\YXYXWW]jyТ¶™®ЯСvlibiyЖОШЮ°°•ђƒ’д€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѓ|Q@;86300-/0---/,,...-//-+-***-*('&')%%'$!!!!  !  "!!" "!  "!#$!!!$ !" #!!# "%""" "#"#!#!""#!"!#!!#!"#$'"#%'*++0gџэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѓY9;GaҐ С^WTUTOQPJDCc©ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЂ[@;::98;==:6531.++17*(%'&#  "').44425598<=??@=>=BhЩЄ√АE;AIJDAAC@;?<-&'&&%$%&&)'%'(*(&')(*)((***')*)()'&'&$%)-0:@GKMOJF>7:79E;-'%'%      -Их€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®XDIf§≥Дpf_\YUSRSKFTЫт€ю€€€€ыьш€ычъьююьыычэ€€€€юььчю€ьююь€ючюъь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€юь€юъююююыэшэ€юэююь€ю€€€€€€эюю€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€юэюэь€€€€€€€€ю€€€€э€юээ€юЁ–С[SQLJKKKLKKKOS]ШЇ≈Э:'2=CGKQWXWYY\^\\]]]]\^\^^`_Z[YXXXXZcrЖЬ†©£ЦЖi\_iq{КХШЮЮЯ§∞»„€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тҐfH;859:2.-.....-+*,./--,+,+,++)((&'%&"%#"!#!#! !    !! "! !$" "#" # ! " %""#"""!""! !!"!#$#$&(**);Ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЂY;<988;>=935800.-,/)(%%&$" %+153223338<<>==::?@DCKДІ©ЂyJ;;0(')''%%'$'&&()*)*(*))*(%(()'(((((%&%%#")+29?HKRQLLA7;79F8''$$#   -Рц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ІWCEg£∞fe^ZXVTQQHFUЫу€€€€€€ъээ€чъъыь€€€эьычэ€€€шь€€€€€€ююьэ€ыы€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ющю€ью€€щэ€ьь€ю€€€ю€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€ью€€юэю€€€€€юэ€€€€€ю€ээюююьцЏЌУ]RQMJLLHKLLILP^ЬЊƒ°<#-5=@FLQTSUWX[\^^_^___^bfgeb^[\[ZXXWW^joБУЪЭЫКud[]jxГОХЫЭЮЫ°¬‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€√БUD;9:?>60./.-/--++,00,,+*-*+**&'('*$$"""#!!($ "!  !"!!  !" ! "#!"!" "!"#!   ""!#%"!$"#"!" !" !"##$%'&&*,)Wўэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃZ<<;::;;886612-.--*&''%#$#!!(-09;612658;;=DQdykRLPJMSJ><>GGE?>AB@<<1*')(('()%&''&)*()++.((($&&('(&)*('&%$"$**1:=HKRSPOE888:B4&$%#!       2•ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ђ[DDf¶±~bc_ZWURPOIIVЬс€€€€шыюю€€ыююштщ€эыьюпщ€ю€€€€€юэ€€€ю€€ьюэ€€щъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€э€€€€€€ю€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€ыъщэ€€€€€€€€€€€€э€€ю€юьытўќЦ]SNKNKKLMJKJKO^Шєƒ†?(/2;=CHMRRTTWWX[]^a`baehjgf`^^]]YYZWVVV\bk{Х®®ЫИm_\bo{ИФЧУПЦ§јѕ„х€€€€€€€€€€€ъю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зУ`L?<;:>==4/0/.0...-.00,.,*,++*,*))'*&$!#""# &#!!!"  !! !!" !"""!#$$ !"$%$#$"$%#""! "##$%&$ #" " #"! ""!"#$%%%'&&)/:Бъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѓ[:9F^ШјХ_VTSRMNQLKKgќь€€€€€€€€€€€€€€€€€€€€€€€€€€€ф±ZCB@==1)'(((()*%''$')&''+),(&''%$'%'&**')$&&"&*,/;?DLQRPKD868:A5)" !        /Гу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®[FEe§Ѓ{bb^ZXURQMGGWЪуюю€€щш€щэ€ы€юъчыщтыыюъ€€эюэщю€юю€ю€э€эыюээ€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€юьюьэ€€€ю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€эьэю€€юююь€€ьъщгќП]SNLOJLLJJMNON_ШЈЅЫ>'+049?EILORSRSXZ]^^abdegfda`^]^\[[ZYYWUSUZcxЗТЫЬУВrgaepxВЖКНСХЪЃї „ы€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€¶dMG>;:779:2./100/..--00/.-,++,,*,*&()$$$$$"$ "  "    !   " #!!"! "!"$"%#%!#$"$#"#!! !"%#$!!$#$#!### !!!!"$&%#'%&*2Uїы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞g?:D[ХњТ]VTSSLPOJJIc ь€€€€€€€€€€€€€€€€€€€€€€€€€€х≠fB:::::;:;<;96321.+,))+*(##!#" %.5642145355<>>CBBTqМ≥Ћќ—–™T7bsIDFEB=@A=BABB<<:/)%''('*($'&$'(&%'('&&')&#$%&%$'&(&#&&"$*,0:@DKPROJ@767:A4&&     (rр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€£VDEi•®za`^ZWVUSNIHWЪт€€€юююььъюю€ыыыюъфюъхэ€€€€хы€юь€€€чь€€э€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юъэю€€юю€€шщююю€эю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€эю€ю€ьюэьюьм№ЋЛ_SPKLPLJIIMNLN`ЪґјЮD #&+.7;:CELOPRUVYYZ[^_abceba_^^^][\[\ZXXYUSUW]jПХЪЪЖma_emu|БДЕОХЯ§є и€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дЙTFE@;88786123100/00/...0-.-,*+*()'&('"&$"""!#   " "## !!#!!!$! "$"$""#$#$#$%#"!$$%# "$##$"## !%%$ !$# "!""#$%'$&$&.;uт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ѓ`;9A]ЧЅЧ\TSQLMQMFDFb“э€€€€€€€€€€€€€€€€€€€€€€€€€ъґqI=;<;=<:9788632.-,+-)(+)$#"!$-58:53335877IZvХ•≥«ѕ–»Ђi<<ВЩS?BEB??=<=@A@@<9/(%(%'))&%'%&(&&$%&'&#'&"!#$&""$&&&$%$#$),3:>FJPQLL?876;?1#"    &tс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€°VCEg®Ѓzba_[ZWTTOHJXЬующю€€€ъььыъъэю€юьышщщы€ю€юю€€€€€€€эю€юю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыьюююэю€€ыэ€€€€ыэ€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь€€э€€€€€€юээю€€€к’ М\QONJMNIKGINNN`ЮЄ√†F#'-12:=AGJMRTXVXXYZ]^aebcc```^]\\]\[Z[XXVSRU[bjxСЭО}uh^bhqy~ЕПУМФЯ™√‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щҐgLFE=976865274//0002//.//*--+*+&'&)(&%#$#!" !!!  "!"# #!!! "#!!!"!%% !%$#$##&%%""%$$!!""" !!!!%$"#%%$#%"!!!#$"#&&$'&)2Q≤ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≠X:9BcЮƒЩ]SSRNMOLJJIdЉъ€€€€€€€€€€€€€€€€€€€€€€€€€ѕАJB>;===;98626421.-,,**('$!$# ")14877756869=<;=AK_}Эѓ≤ђµ«љ†yR;8BН°\=>>;>@>>==.'%'((%(%&%$&('&#&'&##"!!"##!#$&%$#!#"%(-07>FJPPIH?878:?0"       /Хх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЯVIIe•µda_]ZVUSOJLZ•ф€э€€ъцщчюющыъюююэюыююъюэ€чъээю€€€ююъыъъы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€юыю€€ю€€€юь€ьэ€€юэ€ыы€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€ь€€€€€€€€€э€юю€€€€€€эюыы€ююи„ЋС[RRQPKNJLKIKRSaЬЉ≈ЩA!#&+/45;?ELQUWVVVWY[__befbab_\]]]]Z[ZYYXXWWVUVYgw~ДПХНp^]bkuБГЙТППЮЄ…ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“БTCDB;9867402212/////..//-+.-*,)'()+($$&$ !!"!   !!  $!!!"" ! " ""##$##&%#"!$%!%#!!#!"!#$ ##""$$##"!$%%! $"$!%&%''',7nо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≠X<:@b¶∆Щ^USRMNPMNJGc∆ы€€€€€€€€€€€€€€€€€€€€€€€€йЙPBA?<;><999645302/,,*(('$#!#! !(%06348;9517:9;A==BQhЖ†™µї≥ІҐТlK74:9GЧ≠mH;=;:ABB<>@A>?>/'#%'&"####$$%$#"$%&!" "!$""##"$#! # #*-/7?GJNRMG@:769@0!      4ѓъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЯTHFc§µАcc`\XWVRONLZ¶у€ю€€ъщюьююыюю€фыьэшчююэыюю€юэююыэьэююэьщю€€€€€€€€€€€эю€€€€€€€€€€€€€€э€€€€ыююьью€€€€€юью€€ю€€ыюэью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€€€€€юьщэюююю€€€ю€эьэььююъвўћТ_RONRNPKMLKNRRbЫљ«Х<!!&+.139?GPTSTUVXY[[^beb`__[]]\\Z[\[Z\YYZYWWVW[^izЦ•Кtka\`jqw~ДЖГПШ≠√–ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ІdLA@?=83695221342/-/..//.-/.,,-)('*'$"#%# !" !!! "$  !#!!! $!"!#"#"$!! !""&%!$$$&$ %""$"#"""!#"#"$!%##&"#"$ #$%!"%$#$$"&'&)2L©щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®U77Dh¶ƒХ]TSQPPROLJGd“э€€€€€€€€€€€€€€€€€€€€€€€фСSE@==<9<;::96453.//.,((''&#!"! 'D% *15<<;778<849=??BH_xР£ѓі≥іЈђРpJ631098HЩ±КY;EJOSSK@975;B2"      5≤ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€†RBCc•≤{cea]YVUPLMLZ†т€€€хть€€€€шы€€ъ€ьэчъ€€ющю€ю€€€€ьь€ыы€юэ€€ю€€€€€€€€€€ю€€€€€€€€€€€€€€юью€€€€€€ъыъю€€э€€€€ээю€ююю€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€ю€€€ьщщьью€€€€€ю€€€ьыюэ€нЎ÷ћО^TNNPPOJHKNORQaЬЉ«Х=$')+-/27@GIMSVXYWX[^a`]\\[[[][[]^[[^]^][YYYWYXW]m{~АВАvhaadlv}ЖЛЦЭ¶Ј»э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сСSBB>>=73775113333000..//./.+,,,()(($"##!#!!!    ! " "" #"!"%"#!!"# !"! #!##!&%$"!"##%$$"$$""##'$"####$##!"!""#%"$%"#''(-8kд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эђX58Ed†¬Х]RRRROONLJFdў€€€€€€€€€€€€€€€€€€€€€€€чЃZ@?><<;<=;;9961240...+')*''"! *"+38<;:;;888>>===ANnО§±ґЄґ≤µ™СpTC;3-/5;6HЧ≠ЗW<B?==,$$%$$$%% !" "###&" !  !" &,.16>GKNSTNA:85:@2$     4±щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€£Q@Cc°Ѓ{dga]XUTQMKJZЃч€€€ыь€€€ээщь€€€ъэьь€€€€€€€€юхэ€€ю€эюю€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€эю€€юююэь€юю€эыю€€€ычю€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€ююшь€€ыъьыыю€ю€€€ю€€€эьюээуЏЎћЛ]SONPPOJINPRRPbЬє≈Ъ> #$%*,,,,.8=>=;:;<66874111.,+)(('$$#!(/3787878;;;<@?@BI[wРЂієЇґєЈІЛfK@9662/1582BЛЯlG8:@F@=>:C`Ь©zed_\ZWTPLKK\ђх€ьэ€€ю€€эью€€€юъю€€€€€€€э€€ьь€€€€ююььшь€€€€ююъю€€€€€€€€€€€€€€€€€€ю€€ью€юыьыээ€ю€юь€ю€€€ыщю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыэю€€€юэюэъээ€€ю€€€€ьюьэ€€шЏ’…Л]ROOSRPLMQQQQPi£љ∆Ъ>!$&'+)*,+,/16AJQQV[[[\[XXYY[Z\_^^^\\]^\\]]\]^]\ZZ[ZYZbn|ЖОПДvia]dit|ВЙОХХЦІЄ»ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЪO7:79<:;:56553111/0100/311/0.,.,('))')($ !! "!%  "!$ "  !! """"!"# """!"$#""###$#$# $$#"$%%#"$"!!#""$&$$!"$#$&##%"#$%$%&))(/9hаю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѓX9;Ba°¬У_TRNLKOPNHHi…ы€€€€€€€€€€€€€€€€€€€€€дЗMB?=998:314210-..,(&&$$##" $.4;:9:;9::;<=>>?AKeЖҐ∞±ієЇ≥≠ЩaJ=::7447;9:5-@ИЬ`A@@C@>=>:;:-#!%&$"$$ " "! ""!#)/5:AGKPPNKB976:@/"    5їы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€£S@Da†Ђ{dca]\WVQOII[®ф€ью€юэюььюэ€ъщююэ€э€€€ычььююэ€€€€€юыюыэ€€€€€щь€€€€€€€€€€€€€€€€€€€€€€ю€€€ююъь€€э€ь€€€€€э€€€€ю€ю€€€€€€€юю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€ью€ю€€€юэьъьью€юэю€€€ыьюьюоЏ„…И[UQLQQPPORQQRPkІЊ≈Ц?!!$&))((-+.0//5:?EOVWX[[[ZZXXX\^^^^]]^_c_[^]_ca]\[[ZYWX\dm}ЗКЗЕ|qc\`hqzЕКИМУЭ≥∆÷ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Љg4,224::87477732233241//21-.0.-,*'&''&(&"!#!!"   !"#!!" !"!  !" "!!"##!#!"$##!!!"%"#$$%#%#$$% ! "" !#%%##$$"$!#"#$""%%$&'()*0HЦч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≥\98>cҐ¬Ф^QQPOMNNLIHfў€€€€€€€€€€€€€€€€€€€€€уСRC@>>@A=;;:86340/.-,-+('%"#$##""+5;<<:99;>;<@?>>FXpИ£іЄі∞≤ґ™НmRC=9863630=L?86.EИЧ\@A@CDB?B@=?@??:)"!##!"$# !!  #(,2:AGKRQOI@:959B0!       3Јы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€§R@Db•∞ybcb^\WTPQLJ]∞ф€€€ю€юэшэюыъыэ€ъщююэ€юэчэшъю€€€€€€€ью€юь€ээюю€€€€ю€€€юю€€€€€€€€€ю€€€€€юэьэ€эю€ээшьюю€юьы€€€ьюыью€€€€€юю€€€€€ю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€юющь€€ю€€€€ээьъшъгЎ«И[VROOQRQPPOSURj§Љ≈Т="$''('-,.320/118@GLTX[\\[YYX[[\]^\]`_f`\]]_`_]]]][[ZXYZ[^iw}ББГАuf]^flt{~ГЙПХЭ™Јƒс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЫC+)+.29;6477674555352/11/0.//,-,*('$$##$" ! ! !#" ! !!!"%"# !"!"$$##$"!"$%$"###$$"$%%%$%&$!#"$"#"# #$&%##&'$#$$""&$#&%%&'&(.7d–ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ґ\76>d¶∆Ш_QOOKMPOKHJeЌэ€€€€€€€€€€€€€€€€€€€сЪ[D@?><@B>:<<75771/..+,*('&#"$$""%169==;;>>:<=?@?AL_{ЦІ®ѓ≥і∞©ЮИfMA=987302355#%&('%+--126232255>?A?><;74242/-.-,+)&'$#$%!   #+04;:8;:<=CB=;;>CQkЙ§ѓѓ≠Ђ≥і∞Я{^N@><89524344:=AB@<=3HМХYC?>FNG?>?>?>>=9, !""!"!" !" #),3<@HMQRRMC946:>/"   :ƒю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€°RDDbҐҐsde_]ZVUQMKJ^єш€юэюьщщшэ€€ьыщфэчъ€юэыэ€€юычюыщэю€€€юьэ€ьэ€юю€э€€€€€€€€€€€€€€€€€€€€€€€€€€юю€э€ыъ€щэ€€эюью€€€ью€юю€€€€€€€ю€€€€€€€€€€€€€€€€Ўеь€€€€€€€€€€€€ьэюью€ю€€€€ыыю€€юю€€€€юю€ъъщя…М`VSPPQPOQSTTTRh£ƒЋХ>"!#&&'()+,.00665:55537;@HOXZ]_^_ZYZZZZZYY[[[[^\Z[^^\[[\][Z[YXY\aj|ИУМКЕ}n_[emu~ДЗОХЩЫҐ≥Ѕеыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т°F(#%.2;<6796767:45432/01230/-,--+'&&'&"$!"!"!" ! !  "! "! #!#!#'%#!##!#"$$%%$%'$&$##%##""##"$#%$"! #%%$&&$"$#%''%$&'%&((.9`’ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю±X77Aa•«Х]RSSQNQPMGGdЎ€€€€€€€€€€€€€€€€€€шЃdHDCC@>=>>EL>872/1//--,,,($$$#"  ',59=<<<:::>=???>G\vП•≥ЇЈ±≥Ѓ¶ТtYG>?:9:649426:963TРТWCA>>AC?;9<@@??=-"!!!  #  ! !+/3;?GMRRQIB9636>/"   ;∆ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€†NADe¶Ґred_]ZWUNMJIaљщ€юьющцъэъъыэюьшюээчы€юьэьюъю€€ю€€€цыюью€ююььэыь€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€шюююэ€ю€€€€ю€€ю€€€ю€€ю€ю€€€€€€€€€€€€€€€€прь€€€€€€€€€€€€€€€€€€ю€€ю€ьыэ€€€€€€€€ю€ьъыцЁ»Ж\URRUSROPSSTURg§≈ћХ<"#!"$')(*,-/11597<;<=:8779?HPW]_`^][ZZZYYYXYZ[^[Z]a``^]__^[ZZ[ZYWY_hАРТНЦЩj`]agryАЗОПРЩЭ©Ї≈фю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈m7*"*03:;875577:74415510/01//,--,,&&))&"$""""#  ##  !! !! $#!$!!"" !##%#%!!##$"!#$!$!"'%&$$%$%%! $#!##$#!!$#$#$%$&%$$&%&&$&(&)))0JНу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ±Z66Ac•∆Ф\TSRPMOPMHHeў€€€€€€€€€€€€€€€€€щєoLD@ABA@?=;?F>631///1.,+,+%$##  ",069::<;;;;:=<<=?MdГЫЃі≥≤≤ЂІЩzaLB<:9;:7856:78=AACIKFC?8B}∞ЩZGEAD@>@?=?B@AB<+# !!!"" "!$,039>GMRTOH@8957>-!      8Ѕю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЯM?Ac•®xec`\ZWSPNJIaіх€€ю€юьюьшъь€эююыюэыю€€€э€эю€ю€юьэюю€эю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ээыюю€€€€€€€€ю€€€€€юю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ыюьэ€€€€€€€€ыэ€€€€€ю€€€юэю€шж∆Е[UUUSRQQSTSVTRf£√ЋЧ@$    #"#$&),+*,/.002:<;>>????:77:?ENVZ`a_]^^][YWYYYY\]\^^__]^^\]\YZXYY[YZ\iyАОРЗБ~od\]clvДЙПЦЪЫ†і√мьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≠U8*&026;;;848788355433410.00.-,+))&&))&##!##! !"  "$ ! ! "" "!#!""!!"$$# "%&&" "%""###&#%#$$%"#" !$"""## #%##$# !&&##&$%'%'*)'')4b…ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю∞W77A`Ґ»Т]STPMJMKLJGcЎ€€€€€€€€€€€€€€€€щЇxNECA@?AC?<=77:8210///-,*+*%$## "(,49;;:;897:<>===BRiИҐђµїЈЃ£ШiRF?<:988768837;>BHGFIPHD@9.KЪƒЬ`OJFFC>>?;=CB@C;)! !!!$ & ! $++29?GKPSQM?995:@,    :Ѕю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЪK@Ac§®xfd_[YURQNLLc≥х€€€юэ€щъэюэюю€€ю€ю€€€€€ъю€€юэ€€€ю€эю€€€ьэ€юю€€ю€€€€€€€€€€€€€эю€€€€€€€€€€€€€ю€€€ъьь€€€€€€€€€€€ю€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€€€ююэю€юэюн«Д]WTVUSPRTUSTSQhҐ¬…ЬG&" "!! #%'),,)-///.16;<<<=<@C@<9=979BJV[^_aa`][ZYXXWZ\\[[\\[[\^^][\YZZYYYWWY_mv|ГЗЖА|rc]_hpw~ЕМСХЯҐЂЈ„чьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рЛF5(,138<=>97;55556643331200/..,*'''$&%$#$"!!!! ! !! !! !  !" !$$! !$#!!%!!$#%%$!"$$"#%%&%###%#"&""!#''#%$%$$$$%#"$&%#"%$$(%(())+-BЛф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≤U56@b£…Ц^RPLLJIOVNF`’€€€€€€€€€€€€€€€щљtOGCFFB>@A>;:6784110/---++)'$#!!! '4;<<:<;:;<:9<===E]{Ф©≤і≥і≥ЂЧv_LB<;;67::855;=;>ADILKKOLC>:1+EУЊЭdRPOIC?><=>ACAC9( " !! #$ '!"),2:?DKQSSMC:74;@(    ;…€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЩK@BhІ§sfe`\WSSQMNKb¬ъ€€€€эьыьююэыю€ьщю€€€€€€юэюээ€юъэ€€щы€€ьэ€юэьэюъь€€€€€€€€€€€€эю€€€€€€€€€€€€€€€ю€ъыъю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€юыэ€€€€€€€€€ю€€ю€юэюэ€€ча≈Е^WTUSSQRRSSTSQg°ƒ °P*# !"!!"%%&(++)--/02349;<==?@AA@@B>:888?ERZ^``a`^\YYXWXY[ZZ[ZZ[^]\\]\[[[[YYXWUVYaq{КРФЧСГob_bip{БЛЧЬЭЫЯѓї‘хы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µY3('.299:<<;:97977751460/00/----,()'#$"$$## !!! !!! "! !!##!"$"!#$#!#!#$#!"#!!"%$&%!#"%%$##!!"*)$$$$%###$%$&%#&$%$%''(((,.4]Ћь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≤V88Bf®…У]TTONKPYQHIc“€€€€€€€€€€€€€€ыњ|MCDBCEA???<;7783111--.---.(%#!!  #-24<@>;;;<:;??>@?JfГ†≥ЇєЈ≥≠ЭЖkWJB=<<7857:;97;?AADHMPQRNH<3/-()<{ђЩaQPOJ@;;::&   1) ;∆€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ШJ>DkІ•qcda_[WTQNMKbƒы€€€€€юэыюючь€ыщыю€€€€ю€юью€€€€ю€€€цщ€€ююю€€€юьь€€€€€€€€€€€€€€€€€€€€€ю€€€€€ю€€€€€ью€€ю€€€€юью€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€ъыэ€€€€€€€ю€эю€ээ€€€ээюэн≈Е_WUTUSSQRSTRRRfЯ¬Ќ¶T,%!  ! #$&&&(*+,-.0144568:<=>AABA?ABAAB=766=FMSZ`b`_`_[XVVWWWYZX[^\]\^^]\YYZZYWWVVW\am|ФЮЮ†ШО}e[^gnyЕНППУЭЭ°Ѓ≈ръю€€€€€€€€€€€€€€€€€€€€€€€€€€€€рЙ9%%,19;99<::=<::8452252/0./.++--++)&$###$!! !  "!!" ##!!#  ! " ! !! !##""##%%$%"!#%##&&$"!"%&&#!"""&%"$$ ""!"%#$%%$'$&%&((())-3CЗт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юіY8:Bh≠ћУ\TTQNRVQMFFcЌэ€€€€€€€€€€€€ы≈}Q@AEC@@@>@@<;:63/.0/,-/-+,,&"$" %18;::<;;;<<==ALbЛ§∞ЄЊЊєѓШ|cQD>;9;:87;76:?>@ADDGJOTOMKB6*('$"$@x¶ШbQNGBB>?=;=?BAA6%"  ")/39=BJQRQJ@664;>!   6YX5 !<∆€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ШKACBDA@CABCB@<9668?HS[^`a_`][XWWUWYYZY[\]][[[ZXYWWWYXZZWWV[iЦЪХЪЫМ}na^cqxЖКХШЩЩЭ¶ікшщю€€€€€€€€€€€€€€€€€€€€€€€€€љ^5*+.7@><;>=<==8757863520221/,*++())(&%$""!""#!!!! "! ! !  "  "##!!"#! !#&%"#$$#$$""%$"$$$$! #&&"%%"#&$%%&$#" "#"$%$%(##%)&'**(/9^¬щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€±V48Ci∞—Ц[PSPTPPLIFFc“€€€€€€€€€€€€ы∆ГQCBCCDA?>@>=<:<3/01/--.,*))(%!"# ")19<<:8:<<;;===?@AQnЗҐєїЈЈЈѓЪy\I@=;<<:889966;?@BEFFILNOPF>91+$#! (NА§ЦbSOD@A@?;<@A?>A6$  !! ",/5;>ELQPNK@953:=  .;A3  <»€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЦHGRY]_ca`]][ZYXVXVXZ\\XY[YVWUUWYVXZZXYYZ\dr}ТЪСЪ£ЩИujegqzБЗПФЩЬЯ£ѓЇлцэ€€€€€€€€€€€€€€€€€€€€€€у£V=2./;B@?;=@>:::857<;8743321/-**)&((&&'#" ## !   " "" !!!"!#&$#""$$""#""$#!#$##!"%%""$%%$"!#"$$"# !#"#%&''#%'&%#%)+2CБт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€іU38Bj≤“Ш]STSRONJIIHdЏ€€€€€€€€€€€ю…БO@BCC@AC@???=;;844011-..*(''&%# "'.47;<;99:;;=====@FYxУ¶≤ЄїЇ±•РrXH>;:8:998748=9=AABFIGILNKD;5.,+*&%!!.QА•ХeSOHA>>;:;?C@=A:( " !  " "!$,.5@@>CCCCECAAC@@BA=854/.4=DLU\_`d`^]\WTTUWWZYYYZXVTSSTWVWYXVWYXXVV]mzИЧЬЮ™ІПs`^ekv~ЗОУЬ†°•Ђ∞яхцю€€€€€€€€€€€€€€€€€€€»sK>547:@BA<;=:99;;98:<;955100-**)()'%####!! ! !!"!""!!# " $#"!"#!"%#%'#!$$!"#!%&%$"$%&%%%%%#!#$##'%%$%%$%%&$&%'%'''(+/6ZЉш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≤T48?j≥–Т[STUPKLMGGFe„€€€€€€€€€€эаСRBAABB?ABB>=?<9:752100-..)()'$%!(16:;<:9:9;==@><>?KfГЯіњЊїµђ†ДgPB>=;889975677:==ADFDGJKNIA<50,+,'!!!$!0TГ£Н_OGFFC?<;:=@>=C<'   !#+/3=BCKPSSJA;64?=  %72"   C–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЙD>Bh±ѓtbe`\YTSOKLJaЈш€€€€ыыэ€€ыэ€эюыь€€ю€ююэюююю€€юьэ€ю€€€€эээьюю€€€€€€€€€€€€€€€€€€€€чыюью€€€ю€€€€€ю€эю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эъэююъэ€€€€€€€€€€€€€э€ээ€ю€ъя¬Г^XXWVRSTTTTUVTeЫј»†M,*(%!! !#$#$#%-,,,,/-/1336:<==BB?CEHDCB??@?DCA@:540,*.5?@>DUpО£іњњњєђУv^LB>;99::765447;=@??AFJJMKE<400/.)'%"#$"4^П§КZHGEEC@;;=@>@AB<)  "" "")05=@CJNRRJA<72=>   '.,$  J‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пЖC;Ak≤ѓvcd`\YTTPLNLaЇш€ю€ээыь€€ю€€юьюэыююшыю€€€€эю€€€€€€ыэээюююю€€€€€€€€€€€€€€€€€€€€€€ыю€юээ€ю€€€ээю€€ээю€€€€€€юью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююьэ€€€€эю€€€€€€€€€€€€€€эй¬]XVVURSSRSTUVTg†ј«ЯQ.**'(%!"%$%'%$,--/..134337;<<=@CBBGEDBABABCFCAA<735.)*5AD?BGMV\^`aa_\YYXWXWVTQTTTVVWXYYXVWZYZ\ZXXYYZ`i|ЦІ§ЯЦЕtkedjt|ГКФЬЭЮ°£Ђµефъ€€€€€€€€€€€€€йБIDC@B@?@C?>>9889:;:;96:=500-,--++*&')'#! !"""!! "" !!!$ !! ! !"" !###""%$'$!#$"#$%$"## #'&%%%&'%%##&$%$$"#"#&'%%&#&'&'&&%(***-5X±ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃV9;Dm±ѕЦ\RTSQMMKFFBcЁ€€€€€€€€юсЪUFEBDC@?@??A?>;:5540..03.++)''&#!")06:9:78;:9:=>=<=@H]{ЧѓїЊЊі©ЩБjUG>=<9;96797579<<=A@@HJJJJG>;4//-(& !!%%9eЦ¶ЙXIGEDB?=;=<=999;<::66:61/-..+,+*)'%&&$ !!"! ! !  ## #!"##""$##!!"!##$%#$""!# $"$"###$##$&$ !%'%##()'%#$%&'&')(*-++3Cwм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш≠Y:=@?ADEEGMKC??==<3,)# !%(;;:?ABBC:*!!# ! #" ! $+049CEJSTOK@854:: +8.     M„€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЛB9?h™•p^a_[YVSONLJaЉщ€юющыэьшьююъээюьэ€ьэ€€ююю€ю€ю€€€эю€ъьюэю€€€€эю€€€€€€€€€€€€€€€€€€€€€€юэюьью€€€€ю€€€ю€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юющэюшэ€€€€€€€€юэюэюэс√~\YWVUVVSTVVVVTfЪјЋ°Q,*+('('(% $&''),//036687788<@BCBEIFECGFGEEFEABB=3/0+')=S\[RQZTPQT]aab`^^[ZYWQQTVUUXZ[ZZYXXWXWXXYZYYWW[]erВХЂґЇ∞ЮНufadhntЗСЫ•¶†Ы°¬йрч€€€€€€€€ЮNNLCBDB>ADC>==?<:<<:897202.--/-+*+*,($#%" ! !!! #""! "#" !!! "#"! "$$"#$$""%##"!"%%!! "$!""%%"%'$$#$&! $'&%$$$$$$%%&&*)*+,*+0;Y≠у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юµ[9>Flі–ЦaSSTRNQNKGFfќ€€€€€€юш£[IDFDBA@AB@?A@><977330...,-*((%$"  %.59989;;99=<<==<;AQoСЃЊ««Љ®Оt`ND@?;:;:735688>===>BA?C<+!%$""%#$$$%#!  "+26ADDDFGHHJHBEIHECAA?841.(#-FYb__iojcVOQY`baba][[WSTSSUY[^\Y[\ZZZWWZZZWYWV[`_^[hВҐґ±≤≥•ЦЕrd_bksxБКЧЮЬУПЬ©≈исю€€€€оЖNLLHB???@@A=@A=:=A=88973/0.,+.,...,*&%!"#$&! $!  # !!"! " !!  !#!"#!!"#""!"$%%""%%##%$#!"" $$%%$#('$$!$&# !$$$$#!"%'&('$(-+,,*+.4?tл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ј\@@=7676400/.**)('%!! )3678::99:<<;<>=<=EZxЦ∞¬»≈єЯeTLC??>;<;856558<=@DECDIKMPNHDCDB;1,)#!! # !',AdСҐ}VHBB@>>>;=?BFAD:(!%%%$%&%%&%$#$"  ",29>AFLRURPC741:;  *,#   VЋэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хЛC:=mі™pcd_ZWUTSROMeЄч€€€€€ююююю€ю€€ью€ю€€€€ьэ€ээюью€ьэыщэюэьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€ююью€€€€€ю€э€€€ю€€€€€€€€юю€€€€€€€€€€€€€€€згщ€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€ээ€€ээью€€€€€ьъю€€€€€€о¬А^VTTSQQTSUVUUTiЬЊ≈ЧL.-,**((%$#&&%')*+-/368889::AC>==??:9:52330.,,-02/,(&$!$&%!$!!"  ! ! ! !!  "!"!"#$#!"$%#!!#%$#&#!" #%  !!#%$$%%'%'&##$$$$%%%#$%)'%%'&'*,,-,,-/7P®т€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э≤Y<>EsЄ“У]UUTSNLMJFGf‘€€€€юкЫ\JIHHIFEEFEA??=>?>74442/.,))+)'&##"!)29<:889:<;:<><;<@MdДҐґ≈≈ї¶Оt\KA?B@>=98763268;;?DEFCEGKJKIJIHF;1*'&$ ! %.HkХЃИXGBCB@@>=>BEECD<*##&$$#%'&)&$$'%$$#!! $,17;BGLRURLA6418: )+#   ,X¬ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЛC9?k≠•qca^\ZVSRPLKdЃт€€€€тфъъщю€эю€€эьь€€€€ьыэ€ююю€€ъьюю€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€юэююэю€€€€ююью€€ыю€€€€юю€юю€€€€€€€€€€€€€€€цфэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€ьзњА\UTTSSSSRTTUUTjЭњ√УM/.--++)&%%'$"%()).137799;::<@AABDEGIKNNJKKOJHEDDBE=10/'$*DYbbboДЮјЊ§ДgUQUZ`ca^[YXWX[Z[YZ\^^\[\\\[Z[YYY[^^`^]YUUZoЛҐ≤і™®≠Щ{iccdjsy~КТШЮЭШУѓ№мжҐfQNIHHJHHFA@?@B@===B?9:50120.,,---*)&$#"!#%# " !!"" !!"!  !!!"" !!!$%%" !$$""$%#"%" "!!#$$%&$$&'%#$#"#$%#%$#%(&&&"%)))+-+--2Apи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≤Y:?Gsµ–Ф^TUURPMKJHGjў€€€эёШ]KHKLKHIHCFFD??><::8320/0-****'&%!"# ").48::8;:8:<><>=:<@OmОЂ¬Ћƒ∞Ц}dTF@???=>;6774567::DCCHIFHJJIHJLLI;1*(&%%$""""" ""'/HkХЃМ\JBAB?A?==u’ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тКB8?j©†oda]]YUTPONLbґч€€€этущщь€юьююэьььчь€ююэюээю€€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€€€юъь€€€€€юю€ю€юю€€€ююьююээ€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юээю€€€€€€€€€€€ээ€€€юэь€дЉ]VUUTUTTSSSTVSlҐј¬УO0-,./*')'%&$#$'*+-01679679:?BB@CFHIIJMOLKKMKHEGFDF@400)#%1L_ccgyС∞дфкЊУs\QSY^```^[Y\][Z[\]\\[Z\[\ZYXYYZ^\\\[YVWVTUbyЦ©≥Є≤§ЧНzf\afmv}ЕНФСЗМТЯЫx[RMHHHIFGFCAA??A@?>B@:830.0/,+,,('&#$ """""!  "!"" #" !!"!! "!!!!!!!"%"!!####%##!$%%"#"#!"$$##$"$%#$#!"#$#$#$%%&'''''()++*,-9T§т€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≥Y=<;:7863//.--*+)'&$! " #*29;9978;;;;<<=>B?E^xХ±ƒѕ∆ЂЛmXJEA>==<<:9965889;BHMQSTM@62197     4`ґпэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЖ?8@g©¶sec^\YUTPQQMbЇщ€€€€ьь€€юю€юэээыьэышыююэъыю€ююьюыь€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьюьэюю€€юыю€€€€ю€€юююююьэю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€ю€€€€€ышьиљ~[XWVTSTUTSTUTSlЮњ≈ЦO1-++.,(*)&&&&$%*.,.167868:;BCA@DGIJKJKNMMLLLJGIHGFB=31-%#*=T`fenЕЭа€€цлЏ™fSQW]^_^]]]]^]\]\ZXY[[\ZYYYZ]][\[YYXYXWVTTZkДЩ®©ЃЄ≠Пwicbcipx|ГЙОХОhKDCGKKHGHFEECA@AABBA><961///.+++)'*'!#!!## !""! ! "!  #" !#"! "!!! !!!## #"!!! $#!"(($!#$ #$#$"#$#$$#%%#%%$"#&%#!#&$$$$%%'&%'((((+,--/?mв€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э≥\?@Ik≠ЋС]UUTTOPPLEDjў€юќМ^NHINJKOJGGC@=;;<=;:7331/..,**)('&$ !!'1878;;8899<;>>=<:FUfЕ•Є≈«ЉІЕdNDEBA><<;:955876:=>BCBEKLLHFGJOPH@7.*)*(%#$&&&"!"#"!"### #$%+3IqЭіХ_KDBA@>=<:?DFDE<+$#$$%%&&%%)*)('((*)'()'%$! '/18@BGMQSOJ@71188      2T£дъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кГ@9Ag©©ucc_[YVROPPLfіх€€€юы€шццьъъээюэьэ€ью€€€ью€€ьэюьююэю€€€€€€€€€€€€€€€€€ыю€€€€€ю€€эю€юююэюю€€€€юю€€€юю€€ю€€€€юю€€€€€€€€€ю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€юю€€€€€€€€эщь€€ю€€юь€тјzYWWVTTVVTTTTTUlЪї≈ЫO1.,---,+)()('$$',-.0499;?>=@BFEEFHJOMJKMNNMMLJJFGHC@920)&'/F[dijwРљц€€€юхдґЙkWRTX]_^^_``]]]ZYZZZZZ[\\[^]YZZZZYXZZYWXWUV`xУ©µµЂЭХК{lcbgkrzАИЗlE106@EDHLGDEFB?>>AA@=?:6100-,+*('')'#$%" #"!! !!!""! #" #"" #! !"!!!"%" !"!"  !$#$#"#'%""""&##%$"##%&#$'&%%$$"$%$"#&&$%$%&%%'('())+--.-IЯр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€іZ=AIj™≈ЙZTUTSPNMHDDkѕэќИ[NLGLOGGJHDB@@?=;<;886420...+*,(&'&"!!)4:<>979;879:<=?>?ADHGJONNLIMRQI=5/+''*)('&&''%$$%$&$#$#"!"%$$-7MtЮ±Н^HCEFD?:;>BCCED9+$%(%$'&&%&*)''''**(%&'$#  %/29>AGORTQM@93287    2ZЭЏш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зA;Aiђ•p`a^[XUQLMNMgЄч€€€эыъчфшъыючщьэю€€€€€€€€юэ€€€юю€юэю€€€€€€€€€€€€€€€€€ю€€€€€€€€€щъыыэ€€€ююю€ю€юю€€ьью€ю€ю€€€€€€€юю€€€€ю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€ъъэью€€€€€ьью€€€€€€€€сЊyYWWSTVVUSUTTUSkЧµ√†S/-0/-./+(((()(&(,..15:;;@A@?AFGEGKMMJJNNMNMKKOMIJIFC?30.)&)8QahgmЖЬ’ь€€€юющк¬УpYPRW\`__a_^`^[Z\[YXX[[YZ[YXWVZ[XYZ[ZZXWWVTYjЕ†©І™ЂІЫЙue_`elrxvgQ9)(+2@HCEIIGB??CA==?;7331.-+)'(*)'$##"!!!""! ! "!!#!"""#"! !"$#"! "$"#""$$ !$$&$"%%#"!"#"%$"#$%&$#&$%#$&$#$$%%%$#$&%"%%&%&'''*))+.,/5bя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю≤V>DLl≠ƒЗZVVTTRONJEEr≥їЙYMNJFHKHHHEBCA?=;::9865521/-,*+('$$##+49;:;<:9:<98;<<>@MfЖ°ґ√∆Њ®ЖjSG?=;EM@:<>>:638;=ABCCFLLNQPQRQSQF;2-,'*)%'(&%&%'&$#$$#"#$$!""!#$%.9MpЩѓО^LEBBB@>;=@CBCA8,%%%#%('(&'+&&)'&))'%&&  $,29>BGOUUTPA97287     @†бцю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€г}@=ChЂ§n__][WUQNLLNlљш€€€€эхшщышыэъщю€ю€€€ююю€€ююью€юю€€юэ€€€€€€€€€€€€€€€€€€€€€юэ€€€€€ьыыю€€€€€€€€€€€€€€€€€€€€€€эю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€эю€€ю€€ю€€€€€юю€€эйЇyZVVUUUVSTVUTVSnЧѓј£W300.,..-)&()*)'+//036:<=??BEBCGFFINNKLPOONMMKOONNMIHB733-%&-CYdegzН•е€€€€€€€щтѕЮzaTRUY\`bcd`_``\ZYYXYXX[ZWTVYYWY[[[[YWYXVVTUayС™≤µі∞†Жof_^`fntscL5&"(.2>;85642/-,+&'*+($###$ !#" " ! !!#$"" !!!#$#"!!!!""#&$$%"!!"#"#"#"$! "%%##$$#&&$"#%%#"$##$$&$&&$#$$##%&()*)()*+-//1GЫп€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь±U:ALoѓƒИZUUTSQPMIHBq§ЖYLJLIGLLHHHDBDA=<<;9655410/-*)'''&!#" )277::69<::<<=;>?=BRjЙ©ЅЋƒ≤Шx_KBAC?;<@B<:;;;:89:?DBDIJKRRRMOWXOB71.)'*)'(('(('&%%$#"$$##&$!$%$#$%'/;MkХ±УcPHDB?==::@@ACD<+#!#$%$()(')('))(&&&$    $,18?BHNUUQLA96089     "AjЅч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€яzA>Dj≠Іp`c^ZYWUQMMOoїц€€€€€ъъъьъьюээююээьюьэ€€€€€€€€€€€€€ю€€€€€€€€€€€юэю€€€ю€€€ю€€юэю€€€ээ€юэьююээ€€€€€ю€€€€€€€€юю€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€ью€ю€€ээ€€€€€€€€€ю€€ьээюпЄvZUTTUTTSTVVTVUmЪґ≈©Z311.-../*())*))*,/4558<>?>BFCCCEFGKNOOMOQOOPLLNQONLJF?761&$(4M^edoГТЉт€€€€€€€€ьц„ІГkWQRW]``_acba^[[ZWWXZYYXXXWXYXWXZ[Z[XUXYWVU[tЛ§≤≥≥¶РЖzj_[_elrpcR?0'$%.6:9;;8563//.*)(&%&$!"! !(-3:=<65879:9;>=;<>AUrСЃЅ…≈∞ПlRD>>>??<:>=::7:<<>>?ACHLLOPQSUUUSOD5-***)'('&)(((&#$$#&$$'(&#$&%$%&$&&&.;MkЦ≤Х_NGDBB@>;;>BDBD<,#!"#"#%%$%)'&((($"     #-28>CINRTOH?93/88    !GqЉны€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€в{?>Dl∞®qce]YXXUPPOOnЉцюэ€€€чщччухэ€эьэ€юю€€€юююъэ€эю€€€€юэю€€€€€€€€€€€ю€€€€юэ€€€€€€ю€€ю€€€€€€ьэьью€€€ююыь€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€ьъю€€€эю€ээ€€€€€€€€€ю€€ю€ьцеЄuWUTUTTUTTVWVWVk°√ І\53310///+*((**+,*.3258:=@?@BCBCGHGIKOQOPRQQPOLNONMLIHB<52-&'+;ScgfrЖЪЏ€€€€€€€€€€эряЇСuaVSUYZ_ddfd`]\YX[ZVUVXYYYXXWWXZ\\YWXXXXXTSWc}Х¶®†ЬЬП~nea_bhlqnbUD1'$(/568;99<620./-+,+*)*)'&%$""%$#"!"#"!!#$# !""""""""!!!!%%$#"$" !!!#!!%&#%&$##$$$%$"&$$%$$$#$&'$$%&&&&&&%%&%%),***++,.05JСл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыЃV<@Lp±…КYUUVTPONHGSYRMIILLJHFHHFDB=???9:;9:631/,,))(''# !! #)4:9<<:958:99;<=?>>EQiУі«Ћј©ЙjO?9;=><;;89:;99:>ABDFEFIMQRRPTYXPH=3.,)'(())()((**('&$$%&&%$&%%$''&&&%&&(/9LjШ±Р^NKJFBB@=;>EEDC:*#$" !"#"""$#!#!   ",29;BHMQQNH?73185  &EБ…зч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўu?>Ck∞•oaa]ZXVSQQQQpЅщ€ю€€щшыыщщьэьюэюю€€€€€€€€юю€ю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€ю€€€€€юэъэ€€ю€€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ээ€€ю€€€€€€€€€€€юююю€с№ґwYVTSVUUTTVUWXUm•»–¶\8332010-,.,++++,-/.2777.&"$*.38873.+,-,+)*)(((&$$$$$$%"""!$"#$"!"  "!"##" !#"#"!##"!"""#$%#!%&%#!"###"!%%"!#&%$%$$''%$&%%&%%$&**(**+,--4?g≈ы€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цђY?BLn∞«И[WUUTNNLGHMMMJGJHGFCEGGEFFA?@@96786320-,+*))($!"!!##+5;>=;889968;;:;=?AK^tОђ≈ћј§ЕdJ@>>;;;;;;:787;<>EGGFGIILPRSSVWYVH70-*)+())++)(()((+*'&'&&('$%(%%'&'&'''''(0;LlЫ≤О^LHHFDC@=;>BAAB9)""  !!      "*19<@DNQOOI@83273   &LТћоэюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕm?=Ci≠Іr``^[YVSRONPs√щ€€эьъьюэыю€ююэю€€€€€€€€€€юю€€€юъыэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€ю€€ыь€€€€€€€ююэю€юю€€€ю€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ъэ€€€€€€€€юю€ююээьыиўµvXYWSSUUUUVVWWVrІ∆–¶Y51221210/,-/.-+,..-36659<=ACFGJKLNPNONNMLQSPNOPQROQTPKH<32.(%+8N_edmБТ«ш€€€€€€€€€€€€€ъс№іТw_TSV\ababaac`[WVUTTUWWWY[[YXXXXWVXYYWVUUTRTbvМЧ§∞ґ≤ЮВi]\\ckrvun\J6*&#(.2121.,,+*(*)''('%#%%#"$""! "##" !!""! "%##" "$$$"""!$$!#$#"#"!#%%#!!####"$%!!#$$%%&%%%%$$%%'%#$((&'(*+*+0?;976541///-*(''&$%#$*38;><898668789:<<>;;:799998:?DGJKMMNPPONQUZZSF:1,+)**,*)()()*()+(+*'&&&%')&')&&()(&&((%&*07Lr†ЈП\LHFDDD?=<=@@AD9)"" "!       *18<@EKPONKA:3271   (JП“тэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–n??Dkђ§sb`_ZVTRQPMPyƒш€ю€ююью€ю€€юыыьэ€юэю€€ю€€€€€€эььююэю€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ю€€€€€€€€ююю€ьэ€€€юээ€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€эыэ€€€€€€€€€€эьюыы€эд„≥tXYWTTVVTUVWXWWt®≈ЌҐU5530///2/++/1-+*---24758>?AAFHJHIMOLLLNONPSPNNPRQPPSTPJB830+%%,@WfgerЗ†в€€€€€€€€€€€€€€€эци≈ЭЖpaUTW^bedfe_]\XUVTVWUVXWXWVWXWVWZZXXVUVUWWVXf}Ч™і≤†К{l`]`ekrwsdWF3&"&*-00.-,,))((''&%#$#$"#$##""#"!  !"" !!! #####$$"$#!"$$%%"##! "#"!#$"%%"##$##$$"%&%'%"%(&#''$$'&%%&)+***+2Bhјъ€€€€€€€€€€€€€€€юю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч™T=BJh©ƒИXVXUSPMLJEBABEDDIKEDDCBDC?>?=:878762..,)('%%'(,/3;A>:;:::98899989=GYqП•Їƒ≈є§Б\F>;<=<=;459778:=?AHNNNQRQRRPSUWUOD91++**+))**((**)**(*+-+()(('())'('(**''('%'**07Ks°єТ]MMIHEA?=<>ABBB8)$$"!    +06;BGJPQMH>73063  *Lzіџт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћj@@Fpѓ°pca^YUSQPPMRАЋщ€эю€€э€€€€€ээю€€€€€ю€€ю€€€€ю€юьью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ююю€€эю€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ьэ€ьээю€€€€€€€ьююэ€юээююцвЈxXTTRTXWUWXXWVVq•√Ќ£W54430/01/,-./,+,-./017:;>>@EJLKJJKMMKKMOPOQONMPQOQPPSQKG?420)%'/H`iffxО∞м€€€€€€€€€€€€€€€€юьфёµФzaVTW]_cfb`a]XXWWVUVUUVXVVWUUXZXVWWWYWVXXVSS]uУ•£ЬҐ¶ЧАnca^_gmquq`H1%!!&),.,-*''))'%$###$$"$$$#$%! ! "!!! ! ! "!"#!"$%$##""##"#!!##$$##$###%&$"!#$#$%#$$""$$$$''$'*'%&#"%)*))),,2KЙи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч©U>CLh•¬Л\WXVUQKHHD@ABEGFHIGEDDBA=>AA:88875220-+)(')-/4;?><<99;=<<<<<<>AI[mГЯЈ√ЅЈІРuZH=<<;;;8662488;>BEHLQRSTUUUVXWQJD<5/++**()*+++))+)(++**(),+)'%')(**())**)''))('(+49JrЮ≥О^QPKHFC?=<@DDBD:*%$$!    */3;8785201/.,*--1;====;89;;:;=>???BJWrО™ї∆∆ЊІРrZJ?;;;;:7775258;>>BFFKNPTWXWW[^[RF80..-+,,++()+++)**)*))-,((,-,)'&'((((+*)*-+'&()('(+59HoЪЃЙ]QKHJGA@=:BEABD7(%%!    !*-3=AHJHHLMKJLMLNPNOPORRQOOQSSQRRMGA;73*&)/H_ghenГЮг€€€€€€€€€€€€€€€€€€€€€эр÷∞Уw`UWZ\^bdcc`^[YXWUVTTWXXWVVVVXXWWXYYVYYXWUT]pЕХ°Я°ђђ£ЦАqc\_ckpngYG:/(!#$%&()&%'&$""#&%!"#%%!""!""!""$$"!"#""#$%#"###%%$$$$$&%""$$$$$$$#%$$%%%&&%$&%%)&$%%&$#%%&'%$%(&#&(((*,-..4OЦо€€ю€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шІV@DLp©љЛ]WWUQKIJIC?@CADEDFA>@==>=;;974331--+,.28=>>;:9:879;>>;=?BGSc|Ц±≈ЋЅЃЧaND><<<:9;955768<=>DFGMNQTUVZ\\]YOA6/,**,,,,,++)**(++))+,,+,+))+-,*(&(*)(')*)()((())''*+29JpЬЃИ\PKHHGEB?>AGHFJJIIKNOLNOKNRQQQRRPRSRSSSQMG?86/(&(6QaggfpЕ¶е€€€€€€€€€€€€€€€€€€€€€€€ьс’іЫВhXVW[_bddaba\ZYVTUVVVTTUWVWVUWYXXYYXXYVRRTZeqДЪ≠Єјµ†Жqgc]\afkmg\N:*!%&%&&$# ! $$!!"#"! "#"$$#!#&""&&%$$$""%#!#$$## "$$%$###!#%" $&'''$&%$''%%$%$%&%%#$%#%%$%&())+-+0@m–€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш•Q=AJqЂїДZXWTROLIGB>@DDCBAB@>?C@<><:6640.01//5>CB>;999;;:;:>@>=@J\rМ¶ЇЅљ≥£ЗfRF>>@?><;;::979=>@ABFJLOTWWX[^`]PD<2,)+,**,,++-,,+,+)*++)*+**..,*+,*)*'(,*)('())'''&()(()*1;MtЬ≠К^RPOKHFA=^£Ўф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћf<=Elђ¶qba]YVUSPONXЙ‘э€юыэ€шчью€юыэ€эю€€€€эьюыэюэю€€€€€€€€€€€€€€€юю€€€€€€€ьыю€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€ю€ээ€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€ю€€€€€€€€€€ьэ€€€юэ€эдђrYXXXWVXYYYZZYYwЂ∆ќЮR7;9555322220...0/-/4678;<:>EEEKNLILOQNNMKNRTSQRQPRRSWWSROLF;85-'%)>UbifftИІй€€€€€€€€€€€€€€€€€€€€€€€€€€чѕ•НuaVQX_b`cdb`^\YXUSUVUVVSVWVWWWYYXYYYXVVTSSRWcyТЂЈіђЭРЙxh_X]dhlkcP<. !#$$"#""$#$$"!! !"!!! $&$" #%" $%#$!!$%%%##$$%$#"#%#$%$!!&'%"#%%$$'&&'&&$%$$#"$((&$&'%%&'''**)*-/9SЦл€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьѓT>ELnЂњВXYXTSNKJGB<=<97761.-17?CE@98:99::7;<8<>>J]}ЮіЅ√љЃЧy]L@>=;<;:<::;<::<>DFGGIOQSWYY[^`\N>1''()+,,)*--,,++-,+)++))*)***,,-,*++((*+(),)&()(''('(*+)),3:>EGFB4#     !,15HnЃ¶qcc^ZWVSQONVЖ’ю€юэю€ьыю€€юэ€€€€€€юэъъэшы€эююю€€€€€€€€€€€€€юэ€€€€€€€юю€€€€€€€€€€€€€€€€€€€ээ€€€€€юю€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъъ€€€€€€€€€€€€€юю€€€юююьгђqWWXXWWXXYYXXZZuЂ…–ЯS66886555331..0....35489;=;>BCFKMMONNQQONLNQQPPPOQSRTXYUTTOJA842.(%/H[cfejyН≈щ€€€юэю€€€€€€€€€€€€€€€€€€€€эсЎЄЬГhaZRV^`cdedb]XWWVUSSUVUVXWXYXWXWXXXXWVWVVRRZhВЩ®≠ѓЃ£ХКydWX]bigbV@*%&&%#"##" "$#""! !#%%"!$'%"$%#$#""$%%%##'(##$$'%$$%%$%&'&%&'$#%&''&%&%$$$##$&'&&''('()((*++,/?lѕ€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цІR>HNh©њВXXYWTNJJGA<>DEDDFD@@B=;<;;9523335=FF@=;88:;;;<<<>;=HY|†љ ≈Ї©НnUD=??=<;;866578:=@BDKMNPRUVW[`a]SF9+"$$&+-.-*++-.,++--.,**++**)+*),-++,+,,***))**(('('&(*+)())+1ACCFHJMQNMNOONNPRPOPOORSSSUXWSSPJE<551)&&6O]efclАШў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьн…ІРnUNRV[bdedb^`_ZWTQTUUVUVXYWXXVUUVXXWWUVUVVRVbrЗҐ≥ґ≤ѓ°ВkaZWZ`fg_N=.%"$##%$"!""#"!"""#$""$!!&$$%%#"#$##$$$!"%$&%%$$%$$#""$%%&(((%$%%$'&%%&&&'%%%%&'%&('&')&&()*+.3MУй€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€х¶R>ELlІЉДZYWVVOHIJC?@CBABBABDA=;:99:638=AAB@<9998;<;=<==>ETiЖ†∞љ√Ї†ВiQC==?>:78886446:;>AEHKQSTXYZ[\`^SB3(! "&'*-//.,-..-+,,-,-.+(*,..,,)),-,,---**+*+)(((*)*+'&*-*'(+,0=Uv†≥ЗZRRROJD@A@DFCFF1      0:-  %,29=@FORRPH=40/8>-,EД¬жю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћe?DKl≠©rce_ZVSSQNN[П…с€ююээь€€€ю€€юююю€€€€€юььююээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€ю€юэю€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€ээьь€€€€€€€€€юю€€эюэюуёЂqZXWVYZXYZZ[\ZYtѓѕћЪT9:976754431/00.0322337;<:>ACEGIKJMLJLMKJNQRTPNQRQRSSTVWTRROMF945-'%(<<969;?CA>::;99;:;=?<;:@M]qТ±∆Ћ¬ІСz[IDCA@@@<7574489;?ACHHIPTWXW]_``XL=0%""%&),.//.--.-*,.--,-.-++,.-,-+--,++--++,+++*''*+,+,,)*-+((*.4>EDBGD.     !,-)!  $*08<@FLRTPF<6308;++JЕ¬л€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќd=CKl∞±vdf^[WUROOO[ТЋтэшь€ъщ€ьъэ€€эь€ьъю€€€€юю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€эь€€€€юююю€юью€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€ыыю€€€€€€€€€€эю€юю€€эж≠s]YYYZZYYZ[\\Z[t≠–ќЬW:66677753231...1316758<=<=>BEIMJGJLKLMLJKPRSQPQSQQTTUUTSSRPOJ=673)''-FZchehwКµр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ш’ЄІЛmZSQW^adfedb_\YWUSTWWVVUVVUUUVUTWVWXYXWWXWSTb{РЩ†ҐЮЪТЖxi\WY_aa[QF4!$$&&# !"#"!##!"#""""!"$%#! $''$$$&$#$##%%%$"#%%%%%&'$%&$$%('##&('$&&"#%'(&%%((%%%&),.4JМк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ™OBEECCCCB@<;;=>>AA?=;978::;??@A><<:985349>?DEDIQQPTXZ\^a^TG7)" #''*.-..--,,+,..-**)*,**+*+*,-+,*)*,-,++++)**'(+*'),)(**&(*-2:OqЭђYRQQKECA?@BBAFG.     %/0)   (.5=CHKQRNE;5239BGSМ≈к€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћd?BHm≤±xdd]ZYUQOPO[Т йъью€юэююююю€ю€€€эю€€€€€€юю€эю€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьыю€€юэю€€€€юэ€€€€€€€€€€€€юю€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€эщъ€€€€€€€€€€€ю€€эью€€зђt]ZXXY[[ZYZ[YZ\u≠–“ЮT978657610230.-/356:8689;===BGJKKIKPPOQPNMOPPSSRRQPRTUTSRSSRQLF>76/(&(6K]ghfl}У…щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъйћ±Шy_RRT[afigba`][YWVVVUVVUVWUVUTVWWXXWWXYXVVUTZfzОЮ©≠ЂЮРВqb]Z]aa`XH8,$#%$!""#""##"!!"$##$%&%#""$&''&%%$#$%&&$#%$%&$#&'&'&%%#"$'%#%&&%&&$##%&''&'('%')(),.;dјэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ™P;@Inѓ√ЖYWWWUPMKID@BEFDACEA?AAADC@><:9:9:::=>??>AHWqСЂљ√√јіТlRE==<;988:966;@CGJJMRUWWX\_a[PB0% "$'*,....,,-,,.,--+++*)*+*,-,+,,,-*(,--++,*)*+)**('&&'*,)&(+.2:MsЯѓДZSRQJCBB?=DDAIH/    %45,  )18?FJMPQNE:3/1:QОћн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћd@DJn≥≠ucc]ZYTPPNL\У»зъюю€ээ€€юю€юыэ€€эю€ююээ€€€€€€€€€€€€€€€эю€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€юю€€€€€€€€€€юююю€юю€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€юю€€€€€€€€€€ю€юыэзЂqZYXYYZ[YYZ[[ZZv≠ћѕЫQ9;:569422320/--48875578;@@@DGIJJJMQQPRQOOQOORRQQRSSQSTSQRSSPNOG::5*'()9Paigcl~Щ№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыгј£ЗlWQU[`cfedbb`[YZWTSTTTUVTUVVUVWXYXYYWVXXURRT^nБХІђ™§ЧЙАn^VV\a_YOD5% "!#%$ ##!"!$$""$%!!###""%$##$$#%'%%#"#%%$#$&()%%'&&$#&#"%&%&&%&%'('('&()))*)),3JИд€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч®R??CM_xЦ≥»Ћƒґ°ЙpRA?>:<=9:<;9::;<>ADEHMQTUWX[^`_XL<.%"&&),-.--+*./.-.-*+-,,+**)),-+*+++-,*+-/,*))()('))''(&%**((*+-4BEDGG-   -43)    $,3;BHKLQSSI:412=^ј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»`?DKmѓ™tdd^ZWPLPPO`Ф∆ню€€€€ю€€эю€€эююэюээ€€щы€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€ююююю€€€€ээ€€€€€€€юю€€€€€€€ьэ€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€юэ€€€€юыэзЂrZXZZXYZYYYZ\\\w≠ћЌЧQ9:;76755323110/0354579998/&&(,?WbdbapЖҐд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ювј™ТzfWPS[`deffc`^\XVTRSSSSTUUTUWWXWVWWWXYXTTVUSUbuЗТЬ§™ІФwcYUWZ^a^VJ;*%&"#$$$""$"#""#"#$"""#%%%&$#""#$&%#$$$&'(&&'%%&&'%"$##%##%&&&'(&')(')*+++*)->CGCCDCHID@@><;89;;=>=ADABNgЕ£Ї«Ћ«ЈЬ}\HA==>;89::889:<=@CEFHKPSWZY\^a^SE6)!$'*,-..,--+-0.-.,+,.-*+*))*-/,***,-,+--,*))++)((*)%')''((+,*).5>NpЫ•{WRQQLDAB@AFHEDD+   '55*   #-3:@GKLPQTL;733@d≈€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€…\=DJoЃ©uee^ZVPNQRQ`Тѕшэщьэ€хсьэээ€€юэ€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€эь€€юю€€€ээ€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьщэ€€юю€€€€ю€€ю€юю€€е™q\[ZZZ[[[ZYY[[Zz≤ЌЋЧP9;:778851111221022225:;=?ACDEGIKNONNLGKNOOQQPQRSRRTTQPQSTSSRROOG<94+$&)/DZcfdhwЛѓк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€к– ЊІЖjWQRW\bhjfdc__[XUTSTSRSUTUWWUTVWUWXXWVWUUTTV[crЗЮ≠≠ЪБsk`VVZ^`_[OA6' !$&$$$"###%$%##%$"!"$%%$$%#$$#$#%'$"#$&&&('$%%$%&&$%$#$%$$$%%'((&')))))*-2JЙд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€в®|M:ALk≠ЉyUYZZVQNOKA=@IMKHEHID@==<;<;:<>?>@EJSdВ§ЅЌ»ј±ЧtUHA<;==<948;99:?GMGDC- (31)    !+39=BIMNPOG<943Ag≈€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»\=DLq≤™uff`[VRQONO_УЌфюэ€€эчстщыыюэээю€юээьью€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€юэюьы€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юььэю€ю€€€€€юююэю€€юд™r][YYY[\[\\\\[[{±ћ…ФO::979;:50//1121221/15:>@??BCGKHHKLMMMKNNNQQRQPRRSSUUSTTTTTSTRQRL@973*'''6N^dggjyН∆ь€€€юээю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ыџЉЃХrM=BN[effgfeb_[XVTSRRTSSUVTTVVUVVXYYWTTVWVVUV_nЗ†§ЬУТИvh]WWY_`ZTK<,!""$#"%$$%%%%$#$$#"$%$&'('%$$$##%$$%$%&$(*(%%'((''&$$%$#%$&()(&&)*)+*++.;bєъ€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ёСmaJ;?Hp∞іtUZXYULKQNC>EOQOKC@A@>=<<>?=:<>?BIXmЙ•Ї∆«Љ®ЙiPC?@A<9:97637::=ABDGHLOPSVXY[^^]O<+!#'(+-,*,01-+,-.----+)*+++*(*++--+*,,+,-**+*()*()(%%&&'%$&&%%&%&(-9PwҐ¶xVQKJKHB><=DJGEE+  1;3%   #,39@FKNPRND=975Bi»€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒ[=EMr≤©tghaZVSQPNNbШ…кэьэьхшцсщю€€ю€€ъщэщыышьюэыь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эыь€€€€€€€ьэюэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€ээьью€эьююэюю€€€юг©t]YWWWY[[[\]]\\x™«≈РM9::89<941/20/33//1149;>@=;>?EIECFJLMMKLMPRSRQPQRSSUTUUTRTUUURQROG<;9.&%'+=U`diej}Щ’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€о”ћƒ¶lB66?LU[bggfd`^]ZWTTRQRSSQRTTUVVWXXWUUVXXXWVTV^l|Р°ЃЂЬРГth]Y[]\[VJA5"!#$%%"$$#$$###"#%&%&%%%$##$$&'$#'(%'('%"$''&&%%&&$"$%&()'('(*+*++,3IДб€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏЗ_[[F===<>?@>?AGRdШЃј»«ЈЯ_KDA><>=;:61026=B@AFHLRQSWUUX]a`ZL;+"$$'*,-**-//-+--.0.,,,+**+*+++**,+**+))++*+,+)))''&$$%%%%$%%#$$$!#,8O|ЂђzWUPMLJD@>>DHEFE,#5;6(  ,-2:BILORRMF=865Bj €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€√W;DMs≥™tfg`YVURQQNbЪ еыюыщшьэыьюэ€€€юьь€эюьы€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€юээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьэ€€€€€юээ€€€ююю€€€ээ€юе™pYYXWYZZZ[[]^\\x©≈«РM;:;9::655021/23/0348:;<>>=?@DIFCFKKKKHJNPRSRRRPQSTUSTTRSUVVSSRQRPC894)&''0EXagebmВЭџ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€н‘ћђ~`NA837COYadecbca^\[USRQRPQQQTVUUVVUVVW[\YXVUVVTYg{Т®∞≠§ШРЕo^XWXYZYRF;.%"''#%&$#$$#$###!#&'&&$%%$&'&'%$%%''((%#$&''%%%%%%&&'(''&&')*),,/>b≥ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э¬}\UZ[F;AMtѓґzVXWXTONLLJGGEA??<<==<<=?ABAHYnЗІј»≈ЅЊЂ}VE@AA=:9:989635:=BHJJMOSVWXZ\^_^WH7(!&'()+-+*,.-,--,,,-,*+**,,*+*'(()*++*'),-++++*)((*(%$$#"$&#""!! '4Nv£Ѓ}XSPOMHB?@ACDEFFGILJJLLNONPQSRQQQSVVUUSSTTUSSTTRSSH9791)&&)5J]efbbqЕ£б€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€м√ЭuaYYRB536>IT]egfebcc]YUTSPQPPSUSSVWUVWWY[ZYXVVXYWVX`wПЮЂ™¶ҐМvlb\XWZZZVQH<1#!$%$$$$%&%"!##$%%%('%$&'%%'&%%''&''&&$"&(&#$&&%&'(('%$&()*++,3LГё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ж†s[WV_[C:AMv≠±{XYWVTQPPKEC?==>><>B??@A@CP]vЪ≤Ѕ…Ќ∆µ°ЙdH@?@><:887579<>@CFGLSTTUVXZ\_a\P@2%"$(**+)))++++*,-+)*,-+*((*+*)((*))++*''+++))*)))+*&&(&$#!!##!'7RrЫ™|URONLGB>;=CCBED*  +10&      CI;=BDHLMPOH=647Dk €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€єT?BCCCCGIIJMPONOOPPQRQQQPRTVUTTTUTSTTTTQQOA5790'$&+>=;998867;=AGIJNQPTWXZ\_b_XK<-# #&+,))''(())+,++*''++)((++*)'))))(*+*((+*))(**((('%&%%# !! #6OsЯ¶xSQQMGFD@>@ABEHD( ",0*!      "IYD=CFHLPSOG;348Fl«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э≤S=IPp±©ocd_ZWTQONMd†”сыцърёятю€ю€эыью€ю€€€€€€€€€€юю€€€ьь€€€€€€€€€€€€€€€юю€€€€€€€€€€€€ю€эю€€€€€€€€€€€€юю€€€€€€€€€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€ээ€€юю€ьж©mZ[ZYZ[\]\][ZZ]t¶… ХO:;>;;;76664334465566:>>>>==?AEEEFGILOONMNQPOPMORQQSSUTSTTTTSTUUSQOJ=8;8/))).>R`hjhhvК≥о€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€д¶Еp^[]\\]_\QB7..@R[cghffc_`^YTRRRQRSTUVTVWXWVWXZ[[XWXYWUW]i{ОЬІ®ҐЬОxjbYVWY[^]VK=-!!$#$$###%%#$&&'&""%##%$$$#$$$$$%#$('%%&&%&%$&('&''()*,,.Byў€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю…Ж`XYXXX_^H;APtЮ§|XVTQJDCCB@A@??@BDBAEKYpОѓ¬…≈њЉЃУsSD@?>=;;8766:<=@CDILNRSVWX[^ab^VH3% &&(++*('('((((**('&'(('('()++((*''(')+(&(&'(&((&&$&$##!! %5Kt°•vUSOKIEA@?BEEEEB(%-%    .Ic^E:=DGJNTTLD:137Gp €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь≤T@?==CCDFDBFHLOMNMNOOQOMPSQQSTTTTSRSSSRTUTRQND<:<6,(((,?UcjhekzНЊц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁЭБnb_]]^aacda[K6,1?>@DDGP]wШ≤¬ ∆Њ≠РВmQFB?===;898789=BFHHKQRTVYZ\_ba[P?/$!%)('))('''''('&((%%'))'''&''**'')''%%))''&((''('&&$%%##   #5LtҐђ|URPLID?==AFGBDD-   ,IrЫ≠Б?3=AEJNTSLD<457Hz”€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ≠T?IPq±ђsfe_\YUSQPOiҐ„фхщ€€€ээ€эю€€ьыэьэ€ьь€€€€€€€€€€€€€€юю€€€€€€юю€€€€€€юэ€€€€€€€€€€€€юю€€юююьэ€€ю€ьэ€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€юю€еҐjYYXXZ\[YYYZZZ[r°≈ћШP:8:::::635310323337989<;;:89;>>@CGIILSWY[[^acb[K:+ "%'('%&&$##&'%%&%$%&%&')*'%%&&''&''%%'()(&$%&&&%&&$""!"" #7Pt°™xRROLJF@>=?EHFGH0   "-VФЉ÷вёЦ=5=@EKORSOF=888GЕё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шЃUBMQq∞≠uef`ZXVROOPiҐ–оэю€€€эээыыэ€ыы€эюэъэюь€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€юыььь€€эыююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€юю€€€€€€€€€юю€ю€€юдҐiYXYYYZYZ[ZZ[ZYr•»ЌЩS<::;:97852123215877899:<>ABCGDEGFFHNNMKNQOLOPPQQQTUTSTTSQQRSSSSRRSQOJ?;<8,%%$(2FZdkhem~Т«ь€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юѕТzjdabacediheefcb[JGLeПБLACBCEDANWHACFLZqОЂ¬ЋЋ√ґҐБ`KBAA@?<;<<:7:<>BCBBGLPTUW[^aab`UG7' #&((%$'(%"#&%#$$"#%&$$%((%#$%%&'(%#$&%$(($$&%%&$$%$! %6NqЭІwSQMKHEA?>?EECGF*  &0VУћю€€€ьЪ38>BFJORRNE>868IИб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ±UDMRvЈ±uegaZVUQNOQiЯ–ф€эюю€€€€ээьюю€€€эьььюю€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€юю€юэ€€€€€€€€€€€юю€ю€€ю€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€ээ€€юд°hXX[[Z[ZXZZXYXYwЃѕќШQ;;=<9899653252-179889::;;=BDDADHGCGMNMHJONLOPQRRQQTSSSTTRRUTRTTSSTSPMJ@<>6*$%&(4HYdjheoБФћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю”ХzidfgffeeeijgeccbaZJ=3--5ANW`effedb`^ZVTPNPSSVXXYYXZZXWXZZZZ[[YYXZanЕЬІ•ЮФЙАtha[VXZZZZSH=4#&(%&&%&&%&&''%&%!#&'&$&'$&&'(''('))*()+()-3Gx’€€€€€€€€€€€€€€юю€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”Иb\^^\[[[YY[\UIEIGMZXEBBBCFFBJSQLTayЩґ√…Ќ∆∞Уu\IDB@@<;<<::<::>BDGIJKRWY\]^add]P?/##&('&$$&'&$""#"##"$$$""#&%"#$$#$%$$"$&$"#$# "$##"#"    %8Mr•ѓ|RPMIGCA>=@CDDIF*   (7`У«€€€€€€хС36>BDJQQRND<56:JЙг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ∞TFLR~њ±tgfa]VSQPPRl†‘хьююю€€€ю€юэ€€юю€эю€ю€ю€€€ыщю€€€€€€€€€€€€€€€€€€€€€€€€эь€ыъюью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€€ээюэю€€е°j[ZZZ\[XWXZWXYXt∞–ѕЭR;<=;:=<8577375.047659;;<<=@ACDCCGFFJKKIJMNPQQPPRRRRSSSTSTUTRQTTRRSPOPPF9;:1'%'(*5H[hlhgtЕЦћ€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€ЏЫДlbeghecdfjhefca^][XTM?2(&-7GS^fjheed`^ZWQQRPQUWVWXXXVVWYYZZZZ[[ZYXY_iwЕТЮЫУК{ttndYVVXYYVPD3% "%&%$%&##&%&&%%%''''('%''')+*&%'))()()-/7[§л€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЄАb\\_^]]\ZZZXVRGDHDEDBABCCACGEG]opЛ©јЋћ∆Њ≠МePIEBAA?=;;<<;;;=>BHKJNTWZ^__cfc[L;+!&(%&'%$%&$ ""#"""$$"" "&#####$%%$###"#"!  # "  #5Ku®∞zRPOLJG@>>AEFEIF*  *;dЪѕ€€€€€€€€сЛ03>FHLSRTQG<898IОж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щ≠QDNRВ√ѓtgea\URQNPSo¶’уью€€€юьэ€эю€€юээюээээ€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьфц€€€€€€€€€€€юэ€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€ээюю€€эг§k\[YYYYWXYYXYXWv±ѕѕЫQ::<<<><:8787752335338::==?@BDFE@FIHIIJMNLMPPPONQRRSTRSUSTUTSSSQOSSOOQQJ;9=8.%%%&,8L]ejggtДЪ‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ё£Зocehkhefiifggb`^YWVVTOJ=0+*(-@BBEFEFHOnС™√ћЌ»ЈЭ}aMCEEDA@>;999=A?ADFFHMRSUZ]`cdb_XG3%!%%''#%&$%'&$! !!!!!"#" !"!!"!""#%$$!"##"!!!  #7Ow¶ѓ}QNMLJEAB@@EIEHG(    +CpЯ÷€€€€€€€€€€нГ06=FKMQQUQH>9:6JЩп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чђRCNUГ≈≤vffaZVUSPRVq£—чюшю€€€эю€€ю€эыююююю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€эыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€эыю€€ю€юиІh[\\[ZXXWWYXZXWzµ–ЌЧP>===<;=?;898546543139::<==@CEFFCFIIIHHMNLMNLORQPQSTRQRTTSTSRSRRRTSRSRRPF;;:3*&$$',8N`ikijvЖЫ”€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№•Зqgghiihegihge`\]YUUTQOOKD=7,#!)6AP_eghffdc`[XVSRSSTVWWWWXYZY[\YZ[[[ZZYWVX^j{РЪЫХИ|z{q_XUTUVWOB9-# ##$%%'(%%&%&'&&(%'*)'&')**)*,+*,0<\¶п€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€р§r`_a`\[\\[WTQLECBAA???@CDEFFGKVpОҐЃњ≈Ѕ±ПkTIFA@B@BB=;99<=>CFHKNOPUYYZ_cfgaT>,# $'&&%#$%%$%&$"""" !$!!! ##!""" !!  $7Ow•ђ}RNLJJFA>=?DHIKE&    !'>jҐя€€€€€€€€€€€€кА19>CIMORSME>756KШр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€х©THPWД∆ґyffa[XVRQQSp§—ч€э€эь€€€€€ю€ьъэээ€юь€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€ю€ю€€€ю€€€€€€€€€€€юю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эыююю€€€€ьь€€€€юб°j\^[XXYYWVWXZYYzґ”ћЦQ>??=;;=>BCDGJIHHIGGJNOMMMPTRSSSSPRRRSUTSTSRRRSXURRRQK@:<:2)&&%(.@@>=<78?AEFFILNRWY]^_dhf_O=-! "%(&&'$$'%$$%%""%#!!#$" ! ! !" " !   "6OuЮ¶}UPJHGEB>;@IJJLD$   %/KuҐў€€€€€€€€€€€€€€й|.7@CHNQTRMD<845KФн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф¶TKSWВЅ≥wgg^YWVRRQRt≥бэ€€ю€юю€€€юэююьэ€€€юэ€€€€€€€€€€€эь€€€€€€€ю€€юю€ю€€ю€€эъы€эю€€€€€€€€€ю€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэюэь€€€€€юю€э€ыёҐk]^[XXZZWXWXZYY{ґ“»УR>>>;<<;<<96664002679<<=?==??ACEIIIJIHIKPQNLMPQPSQOMNSRRSTTRUVSSSSUVTTRSRJ@;<8.)&$(),=SbhjglzИЫ–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чƒОvgcdgebcegdcda^[YWTTSPNIHHC@@<60(""&0@P]fhjklkeb_]\WUTTVWVWWXWWYZ[\[Z[\[ZZYXX[bo~ЛХ¶ҐЛ}ylcZXXXVUSK=-# %&&&''&'&&)'&(&%')(&)))*)+/6VЩд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъ«Сg\]^_a_\ZTPNKIGCBABBGGA@BFHPhН™їƒ »ѓОsXMJFDC??><>><9=?>EKLJKOUXZ[`edeeXH7& !%%'*(&'&((##%%%$$$"!"$"!!"!  $# """! &6MtЯ§xQLKLGDD?:?KOJLF%   -NДЄм€€€€€€€€€€€€€€€€жv+5@CGOSSRND<967LХн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ц©RISWБЊЃthh_XVSRRPSwїиь€ээ€юю€€€€€ю€€эю€ю€юю€€€€€€€€€€юэю€€€€€€ю€юыь€€эыьюэъ€юэ€€€€€ююю€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€юю€€щЎҐj\\YYZZYXYXXWWY{іќ»ЧQ<;=<;<<<8786540/048:=<<=:;@BDEDDFIIHIJMQMLLLMMNPNNNOSPQSTTRRUUTTSTUUTRRRNE;;<4,)&(('/>SbjjekxЕЬ‘€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€э Вpnfdfedbbfgec`]]YVSQNMNJHGEB>?@=72,'#!)7DR`jopjgdfge^VSTTTTVWVWZZZ\\[]]YY[ZYYZZY^dtРЯ°ЯЧХМzlc_[WWXWUPH>/# $"#''&$%''%&'%''''&'())*/2>oЋ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф≠~f`]`_^]YUQMJIIE@AA@@DJIBBCHbМ≠њƒ∆ЅЂМlULHFEB@@>==<<;:>GIFKOPSVZZ\achjaTB-#!#%&&(*)''(+)##$$$&%##!!!!#  ""!!##  (4Ox£§wRNJHGC@==?GMJKC'  +L{Єщ€€€€€€€€€€€€€€€€€€дt.8@BGPRRRNE=779NШо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т£QGQWГЅ∞vfd_YVTSRORxїжэюэюыыю€€юэюэ€юьэюэ€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€ююыь€ю€€€€ю€ю€юыь€€ю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€ю€€ююэ€шЎЯh[[[ZXXYYXXVVUX{ґќ ЩN9;?>;<==976552000359:::;;;?BCEEEFFFFEJNNJGHIKMKLOPPONPPOQSTRRSUVUSRSSTSQOKB9<:2(%%##'.AUcjidjvЗЭќ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЎМlghefjgffggc`_[ZYWTQMNOLGDDB?@@<<:72-($%(.;M\ilijmnnh^YWWTQTTVWYZZZ[[[ZYY[][ZZ[YZ[\dn|НШ®і¶ПxpniaZUX[XVME9+#!#&%$&(('(&&)((())+*+-28OХе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€й†tdca^`]URPNNLEBCCCCAABDIJGPi~ЫЉƒ¬єҐДbNJHFFDCA??==<==>BGMONQUWZ]aaejlbP=*" !&&%&)((')()(&%%$$%%%#!"! " !!!"!"!  %5P{™®vRNJHHF????GJFGB)    $Cyµу€€€€€€€€€€€€€€€€€€€€жx0:ACJQSSTOG>978NЭц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЭTFPW}ї≥{eb_\WSRQQSxїеы€ю€эь€юэюэыь€€€€€€€€€€€€€€€€€€€€ююю€€€€ю€€€€€€€ю€€€€€ю€€эь€€€€ююю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€ююшЏЮiZZZYZZZYWVXXUWx∞ћ ЧN;===<=><;8664222578778:<<=>ACCEEDFGHFJLKMKIJLLLKOQPLKPNLNRSSTTTUUTSSSSTSRRK@=>8/)'%$%'1BUckkhlxИЭ–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€б£Аieehllliggc`^[XXXURPNNJFDC@@?=<<9654430-)'*4EWairtplhdb]ZVTTSTVXWW[[XWZ[[[[Z[][[]\Z\_fqЕҐђ•ЫРБ}wkg`YXXYXRG?6+#!"%()))(('(')*,.,*.3>i«€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чїФmgca]XVQLKMMHFA@CFEBCBCKUcuЛЮ©∞ї≤Цy^NFDDBBCA@@>;;@@ADEGINSV[_^`dhkjdT9% "''&&()((&)+''&$&%#"#$"!!""! !"$#  $3Kx©•sROLGDCA@>>FHCCB*   $6cЃр€€€€€€€€€€€€€€€€€€€€€€дu/:AEHLRTTRH<:::LЯъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЬVIPWyЈі{ge`\XRPQRSzЊзю€ю€€ю€ьь€юьээю€€€€€€€€€€€€€€€€€юъъ€€€€€€€€€€€€€€ю€€эь€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьэюэю€€€€€€€€€жЯf[][XY[ZXWXXWWYxЃќЋШO;====>=<=988423468:7788:<=?DEBCBBGJJJIJLNMJJKMLLNOMMOPLOOORTSRSSUVUTTTURRSTI>=<6-((''&(1CWfmmhlyЙЫЌ€€€€€€€€€€€€€€€€€€€€€€€€€€€€кіР{phhnomjigea^\YWWTQPONGFEC??==?<9755574240($'/=L]inpnljgc^[WUTSSVWXYXWYZZYZYZ]^^]]\[Y\]amyЖЧЪЩЪП{vc\ZWXYWUSI<0&#&(*(&'())*--*+-5RТб€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Џ†xjfa[UMJKNNGDCCECDFEBDJUjБХҐ©≠Ѓ∞£ЕjWJHD@AA???><>==@AEIKJOPTY\_dfhji`N7'!$('(()))(&')((&$%&$###$"   !###   (5NxІ®tPOLHF@A@=AGGDDA(  #9bФЎ€€€€€€€€€€€€€€€€€€€€€€€€вp/;AEHLRSRRI=9<<=<<=::8533446988869;=?BBCBCDGJJIKLJHHJJJLKLKJMQSPMOPQTTSRQRVUUTTSTSSSTPC<::5,'&'$&*1BXeiiio{ИЫ…э€€€€€€€€€€€€€€€€€€€€€€€€€€эЁЮВxtnqupomige`\ZUTSQOJIEDC@==<==988556731330-)##(3BUhrqnniec`_[WTUWVVWXXXXWYXX[\]_`^[Z\]]^^dq{О£ѓ¶ЧЛunnka[ZZZXTN@3+%"&(*+,+*,,-/=iƒ€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€піКkfa[UQNJIIJHDBDDFHFBEM`zЭЈ¬ƒљЈґ®ЛgNHFCB@AFC???>>?>BEEGPQSVX\`dhjkh\H4'!!"#%%)))))(('&&&()(&%%&'%%%$"!"""! "$#!      !30 %3Kx™®rPNKLLD@@@CEDDIE' %:^Х’€€€€€€€€€€€€€€€€€€€€€€€€€€вn1;@FJNORRPI>::9NҐщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€р°ULSX|≤™ucd\XVTRPPT¬иьь€юээыыэ€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€ю€€€ююю€€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€эщыю€€€€€€ю€юьвЮfZYWXXYYZYXYZYZy≥– ШP;=>=:<<;;;8466334589:66;=<=?@ABFFEIKGHIGGGKJFJIJLMPOOOMOQORSRRRSVTQRUTSSTTSRMA:<<3(('%&&)3FYcggjowДЦ∆ь€€€€€€€€€€€€€€€€€€€€€€€€€€мљМonmpvtrnjhhb[YVUSQLFFECB=;<<::989865753210110,%$(2E[hmqnjgfhda]ZXUTVWVVXWVWXYZ]_^_``^]]^]]]^evУ©ЈЃХЕБЖЗqa[\ZXZWPG>2*% %(+,++-.05NМё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чјЮue`[UPOPRNIEDEBADEEGKTmОђњћ—ќƒ≥§ФsVKGDA@==>@@==?ACBGJKJOWZ]^`eikibUA1' ""  $%'(*)())'((()(''&'$%(%%&#!"!$$#!""    $8<0#2Is¶®oMLLNNH@??AFFAHN- &>eЩЎ€€€€€€€€€€€€€€€€€€€€€€€€€€€€дs2=>=>;345355585678;=;;=?BDDEFJKGEIJIJJIILMLKNNMLMNQQQSRPSRQUSRUXWSSSRPURF<<<7/*'%&&'+5EXdijhjvЖЦЊъ€€€€€€€€€€€€€€€€€€€€€€€€юэв§yehlrrpnifid[XVSSQNHDBBB==<;:;9:;97344344322683..,,7EQ^hnnklkged^YWWVTUVVWYXXZ[]^_^^^]_^\][[\^eyЦ•¶І°ХКzqqnbZY[\YUME>1(###%),/.2=d¬€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь…•|j`XRMNPQNMKHHIHCCCGSgФ±»ЌЌЋ¬≥ХybUNJA??>=<=>>=@ABGIHNPRSX^_adghf^M8*""" "%&&))**(()''))**('(*'&%$&'#!####""##!  $-/* $3LrҐ¶rOLJJHDB@?CIIEHQ3!>mЯб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еt1=>A?853552452498:;<;;=ACDCEIJHEJKHJKIKNMOMJKPMMOONOQSPRRQSTRRTVSQRQSTQJC>;;5-)%%&()+0BXflidgwЗЧЊц€€€€юю€€€€€€€€€€€€€€€€€€€ељЪsgjoqqqliha[ZWTRPMHC?@>=>;9;;767663354542234775530-.2:FUbioqojigb^\YXWVTVWWVYYZ]][^^^__]]\\\[\^dp~Ф©Ѓ•ЦИВ}tlc\[[ZZXUMD9/($!#!&-4KИ№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘ђ~j`VOMJKMOOMMKILOLFM\vШЃЊ≈Ќќƒµ°МpXLECC@@=<===>?ADHKMMNRUW[[_dchkcWD4'#!! %''&)++,*))'(())*)))*'&%$%%##%$#"!##   &/0" (4Kx¶•nOLFGGCEB@AHGDJN7%@j§н€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еt3=BGKOQRSRK>::>><::87665644664011344355443112/4=Nakpnmkhdaa_\XUUTUVXYX[ZZ]^^_^]____^^^_`bhyО£¶Ґ•ЫД{tle_\[ZZXWSH?7-(&9cЇ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€„∞Еi\UOLMOMLKNNMKLJILThИ§ґ»ѕЋј≥®Хx`TJEA=>?<<<=::>AEJNMLQSVXY\bceikdU>+%""" "#"""'*+,**,,(')))))')('%&&$$&%$&#!!  )-*!  +6L{Ђ•nONLGD???=BHGFNTC>l®р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жw3?CFKOQSURH=;:=S¶€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кФ[RU[ВЈ®sefa[XVSOPVВ»жы€€€юэю€€юыъю€€€€€€€€€€€€€€€€€ю€€эю€€юы€€€ю€юю€€€€€€€€€юы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юью€€€€€€€ю€€юьаЫeYYZY[ZXZZYYXY\|є‘«ТN::===>@@>===8986772279998797:<>@ABGFFHGEGIGGGGHIGIJHHJHKMMMNMMPOMOSSPQSPMPQPRRMF>:;80*(&$$'()/DYflkgkxЖЦ…ю€€€€€€€€€€€€€€€€€€€€€€€€е≥£Оrciqpkgdd_YVUTPJGCDC@@?;:9899745654311213721445345771/26=ETahjkjhgec`]YYWUWXXXWY[__^^]_b`_```__a__dq}К¶Ѓ°ЫЗvsqqj^ZYZ[YTPF>2#"CК№€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€к«∞Вf[TNNNMOOMMOPPOKJRayТЂ¬…Ћ Њ¶ЕmbYPIGDA?=;<<<<=>>CHLOOMRVXZ^cghkj_P;.#!! !! %'(((),'%(())'''((%&&$$$##%  &      '.*%  &4OЂ§oONNJEC@?@EGFFOhА®ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жv1=FJMNQTSOE<;:=>DJHGIFCFHIKFCGIGHKJFEJKGHKLIIKJIJNQMNQNLPOORQQLC::<80)&$$'&&*2DWflliitЗЫ√щ€€€€€€€€€€€€€€€€€€€€€€€ыўЂ°Жlkqpliec`\XUSPLGCEFA=;987:96522463//3224543554336775466/*.;HUemmpqmjfca\YVXYWWX\Z\]^_aba`_``a^_```_`fvКЩҐХИАwКЙla\YXYVUQE9=`ѓпчэ€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€с…ЈФo^TPMKJJPPOOPPPONNWmК™єЅ«∆љ∞ШyaRJHHIC@A==<;;<>>BFIIJNQSUY]adhmmh\J6*$%!!!  #&&'*))'&&('(''''&%&%$$%!    &10$   &3QБ≠§nPOPKHEA>?DIIISЬ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иz3=HOMNRTRNH?99<<=<>ADA?><;;<985689:86657;:;=>>CHHGHFDGHHHFCFGFFHHECEEDEDFGFGHFGKONKOOOPOPSPPOJ@9>>60+((&$&()0E]hjhfjyЛШњъ€€€€€€€€€€€€€€€€€€€€€€€кљ°ИАДyomjda_^ZURPIFFCB?<98989952211441/11332635512145576474-(%'0ASammmqlhgd_\[YUSUUUYZ]_bba^\_cbaba^^`_\\`kwВЙИГВДРҐ§ЪЖhWXXY[ZUUhВП≠ўрхч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€ьќЉЮrbWOMNONLMLQSRQQPOQYqУ™ј  ∆Ј†ЙoWKEBBDCB@===<;<=@DDGIKLRVWZ`dflnmhXD4)%""$#  !    "&)((&"$#%)'&'''&%"!      $.0+  *6O{ІЯmSPKLIC???CKMLWЮ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€й{6@FJKORSSNJ?67;VЂ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еГ]TW[БЇ¶qifb]XTRRQZЙ—тю€эээю€€€€€€€€€€€€€€€€эшъ€€€€€€ю€€€€€€€эьэююю€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€эь€э€€€€юэъэюю€ююьџЩc[\ZX[ZYYYYYZZ_ГЅ„ЋТM?><<<@A@CA====:9:::88654567:;=>>?BGFEEDEGGHFFDFGDECBDEAACCBEFEDDGHKQOKQQPQPQQOPPNG?<=:5,(''&%&&)3F[ekkjp}ЛЦЈую€€€€€€€€€€€€€€€€€€€€юыеђЙМЬ|hkkgd`^ZVQOIDCB?<<;::9775432222000/13454620223547625732,($&0>>C@<><=:9<;:6454259999=B@@CHECEDEEEHFCDGFCBBACCBAAACFGDCFFIIMPOQOMQQQQQQQOIE;9::5+()'"#&(+4I_hklnr{ЙХ≥мэ€€€€€€€€€€€€€€€€€€€€€ьвЈЪe_eiji`]ZURPIDB?>===;:8875644332.01/0343330267555544885753.+**.3A_mmrolifcca_\\YYXVY^]]^_`acaadc``^]^]]]]aiwЩ±™™ƒ„ќіХКВl\Y[[YXVVY^esВЗН†Њ„еждкрсфы€€€€€€€€€€€€€€€€€€€€€€€€€€ъук⹓ћњ≤ЮУСАtbWQPPPPPORQRSSQOR\adnЕЦМ{{~vj^TME>>A?>@=>??A<=?AFHGIMORVX^beinlibP<1,&#%" "  !  #      .40$,7PwҐЮlOLKOHA>?ACCEHTЮ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€яf:AEJMPQQRNC:79=VЂ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€пЬXSW]К¬ѓrgd_[XTRRP]Цўт€юьююю€юэю€€€€€€€€€€€€€ю€€юююю€€юь€€€€€€€€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыюю€€€ююю€€эы€€€€€€€ю€дЪh^]Z[ZYYYZYX[[]јџѕФK<<===?@ABB?@=<;:<;966:5499855:@B@BEBCDBDBEEFDFECBCBBCDCBBCEDBBCEDHFIMOPQNPQQQPRTSOMD:9>=4-(%$#%&')4K]fkpmmwГОІ„ъю€€€€€€€€€€€€€€€€€€€€€ъ“•Йla`ab^\ZUSQLFC@??=<;9988744334320/1/121212454354549<:999762023539BScefhihjgeggc_\XZZ[\\\^becbddcbbaca_[\]\^eluГЧ§≥µІЃћЉШv_ZZXXZWRQRSTX^gmrsuГЪ§Ѓ∆ЎЁаеззждежзййиждаяЁ№ЏЏ‘…ћј∞ІЪЛБrif_XTSSQNNRRRQRPRSRQQRV[eyЛИУ§ЯЕsgXOHFDB=;@@?===<=>??CDHKNPORWZ[`chormbRD7+'&$"!"!#  #        "31& +4P~¶ЩhNKMLGA??ACCFKV†€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€я`:CFIOQQPRMD:76<99<<:86967;:9678;?>=@@A@AABEBDEDBBBCDBABC@>@A@A@@BEJJJMPPMQRQQRRQSTRRM@8<@>7.(%$%%$&'2GXempkioyЖТ≥нэ€€€€€€€€€€€€€€€€€€€€€€€иЄФq]WYYWVTRNHEC@=<;:;97842634232//1001011352023254999:9888857::3--8HTXX`fgiknqmhgc\[\[YY\^`a_bcaabdeca^\\\_`_aceluДУ£єƒ≤Дd]_^__\ZZ\[\]\YXVWX[adekpsxАЕДГГЕЖИРРСЛЖГБzwxxwuobaa\ZZTQTSRSSTTVSRRSSRSTTRS[chtzВПДЖЗ|k_PEECCC@==>>=;<>=@@EDIHKNQTUY[`djnnlcUI@;4)&$!!! !#  !!##%%"        #44,!  +8RВђҐmPLLIGE@?CEEFIVЮ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€я[9@FKNPSUUPE;97<[Ѓ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЧ[UX_Иї•tmic]YURQQ\Т‘к€юэюю€€€€€€€€€€€€€€€€€юэю€юю€€€€ю€€ю€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эь€эю€€ьь€€€€€€€€ю€€€€дШg^]]]\Z[\\\[Z[_ВјЏћОIAC?B@>><9:=?>;68569:89;8:<<=@?>>B@AAACBBBD?ACB@?A=;>?B@@@AEJKKKNRQRTPQSSSSRSSPJ@==?<9/&$&''&%(2D\jqokhlxЕР©„ы€€€€€€€€€€€€€€€€€€€€€€€€дЃНlWRSRRTQHFB?><<::6895234422000/023/01033323531667989989888986439BEDHT]bjpvxtokda_`ZXXZ\]^bb^\`ccdba_a`a`bghggdejsyytlfjvВЖ~na^^\]^_\ZZXYYYVWWUVWXXVWWWWWXXZ[YXXUSUTW[XSUXUWYVSTTTVUWYXUTTUUTUUTRXmvot}|xmid[RIDACA?>===@?;<]≤€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лС^WW`ИЄ°slhb]XVQQQ]Ч‘д€€€€€€€€€€€€€€€€€€€€ээюь€юэью€€€€€€€€€€€€€€€€ю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€эыыю€эю€€€€€€€€жЬg\[[\\\]]\[[ZZ]АЅЎ СK?A?>AGECAA?>?=;;;=?<9835456998:=>@?@@?=??A>@BBEGKNLQQQRRRQTVRRSURQPHB>@?92)$%%&%$%+6K^jmnkjmvБПЫљц€€€€€€€€€€€€€€€€€€€€€€€х№ЎЈ}^SMMUTIEA??<<<83563411110/0/00120/32331234404874733769646;<:699997>>;=>=@BGIMLOQSUXZ]bgioliaXRJGHD<5-%$!"! !!" !!" !"        *0.'   ";>Q~©ЯlQNNOIB?BDIJKKRЮ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁY;CEIKQQQTQH:9:?]≤€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лР]XX_ЙЉ§qkia\WUSSQ^Ъ‘й€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€юю€юью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€юьюэ€€€юю€э€€€эаЭh^][\[^^][YY[\_ВЅ’«СM<@A@CFEEFEB?>?><9;?<87461167568::;@??==??@BA?>>=>?=?@><=>=@?>BB@CIJNOONPQRRQQRSSSURRSMC>;<74431320//00.0100020331011/03028747524773459::8:::724>?AKUguzvokljjgec^\[\^`\^ac_^`^`cegjmpnlkjjjkkkmmm{Яƒ–∆ѓЖijllkfcbaaa`_cb`_]\Z\[\[\[ZZ[[ZZ[\[\]]^^`cdeimoruvqkhc`]\\ZWVVTTSRQRSRMLJKLJHFCBB@?<6+$"#! ! !"!!##" "#"#!  *0/'    "8?SА®ЭjRPPLFCBBDIJJJSЬ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џW;DGKMPPPTQG;99>^≤€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€с†\WX^КјЂtkha\YUTTS_Ыўр€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€юэ€€ю€ьщ€ю€ю€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьъыьэ€€€юю€€€€юш‘Цg^\Z\[]\[\ZZYZ`Д¬„∆ОL@??@ACCDIHD@?BA@<=?=:736336787688;?<=?>:<>=>A@?==?=?@>=<>?A@?BA@BJJHOPQRQRSRQSTSTTUTSSNE<>B?91&%%&%&'(,AW^iprpiis|ЛФ™ёы€€€€€€€€€€€€€€€€€€€€€€€€€мЄ¶РqLA;MYbikoonokigffa^\]YY`ca``acdfikkopqsuttxwtuttryИТНЙzuvwvutplkkkhilifedc`_`bba`_^^```ccbdghkpvz|ЕЛРПКЖ}tngb]\][YYYVTTQQQOMJJKFFEDDA?>>=<=><98587347::78:=<:=A><;===?>>?==>????>@CA@??ACFIGHNOMOORSRRSTTTTUUUUSNA<>B>9/)&$%'&%(3FUbioqnklr}ИСЯ шю€€€€€€€€€€€€€€€€€€€€€€€цяёƒ¶{cJ9CQB9<:87557553101122124600112276303875584686577678;<;89:8:;<;8;AEILScjlnonkmkhfa]\]`a_]_bbeggjmosuzВЖНФШФПИЕА|xvvtu{}А||{{{wvwutsqooomjjklkghhfiijlmnsy|АЙСУЧЫЭЮЯЧМГ|umjhd``][ZZWSSSQNLHHLKFB@@@=;=><=>@=;=??=?>?@@?@@@ACFHKPPPRPRRSSRUVUSVUVUURLB;>?==2&$$$&##,5@O^fmonljovБЛХ≥жъ€€€€€€€€€€€€€€€€€€€€€юю€эёЁ ¶ГYKSG::97884645411431//1260/100355314643476454588577:<<::8799:;:;;<>A@FLNLONQSSUW[[Y]bfe]QNRcЧЏ“ПQOQIDEB?<5,&##"!! "  ! ""! =iP=@)!    *2,!      %.Xїчљ=P|¶ЮjTPONLHECBEEFJUЪ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џW=AHKMRPOSQF=88Ba∞€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рЧ\YX^Н¬Ђsigb[XUTRRbЯ№уюэ€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€ьы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€ю€€ээщ÷Чg_][[\\\\[Z\[Z^ГƒЎ≈МNBABCBGGIGEECCADC?><;99;;8872/5776389;<:9<===:<>><;=?>=<==?>@BBACEEEIOMQQLOORSRTSUVUTVWUTSK>9>A?7+$$&'%&,+,=R\emrrkiks}ИУҐ ч€€€€€€€€€€€€€€€€€€€€€€юю€€ш њ°p_H:46865553520132/./14001.0344553457965435788889;;:9;77;96:<<::;998=FQX`hmqqpnklhhfb`^\^_`bekoszИХ§ђЉ‘вдвЏ≈ґµ≠ЯЩЧОНТТУЪҐ®∞±Ѓ∞Ј√¬ЄієЇЈі∞Ѓ¶°ЮЦФНЙКНРУЪҐђµЉЅ≈…ћ“÷”’“Ќƒє±§Кyqia_[WVTRPMHEDAAGJSY[WLABGIKKORPQTWVW[[\\_fc\PC=BNgҐбўЬVNNH>A@=:1+$!!!! !"   #%  3DFUM.)&#   '-+!     !5SФб€€√=O|®ЯkURQQMIEBCDGFGTШ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№V<>?@@@CDDFFEGKLLLNOORTTRRUVUUTVUTTPE;=CA<4+(%&%&*+&.=N]fnsonmjozЕПШ≥нь€€€€юэ€€€€€€€€€€€€€€€€€€цёгаЌ≠ШqN72777775420021//002/02--365652278;52666776579:9:;:9<;97<@97@OmѓгЎЩVQNJBA><;1*$"!"     !$%   $@HESH3.-.(#        #.T•м€€€€ AR~®ЮlUSSSOMGFFHICEUХ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ёX=BFKPQRQROE;69Abµ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зА[YZbТ…ђtmha[XUPQTaЬ№ф€€€€€€€€€€€€€€€€€€€юю€ю€юьюью€юю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€юю€€€€€юэ€€€эы€€€€€€€€€€€€€€€ъ”Фjeb_^\Z\\[\\\\aљџќУRIHGCBEFFGFFEFGFEDB>:;<::96466457699966;;:;;::=<<<;;:=@<=A?CC@AEEGIFGJFKLMNRRRUVUTTVSSUTSRSPG>=CA;2*&'%(,)%%)9N\elorrmjnvАНШІ„ш€€€юэ€€€€€€€€€€€€€€€€€юю€€€ьбџЄБ_D:886684101111/012//11/1257444789347645654559999::::95::=C<9;:;:89:>AIOZemopqponmjhfb^^^^``ego}ИЪ≤Љ√Ўймомиа÷ ї≠ЪЦЦУЧЭ§ѓЉ…‘џ№ажйкмллзб№ў“ ƒЊЄµєЅ»“Џ№агдбаЏЎѕƒї≤ЯРВre`ZVTSQNNNLGCBIOMNW_fgcZRMOORSSSTVWYZ[\^b[PB825>54=Mp≤ё”НUROGCA@:94,%""!  !  "#  *TiVZH3..1/-(#        !%4T¶м€€€€€€ћ@TЕ≠ЭjXTUUPKIGEGHGHRП€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ёU>AFIPRPNPOD;8BA@@@ADGFIFJLKJLMLMRQSTTSTSSTUWUUTRK?:>B@:2+($%+(%##)7NZcjorrpkkp~ЙРЫ√х€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€хћ£ВcG;6685210/1100240021123354246675784324567699:9797678:8:=>:98;;;=<<<<@FKU]hostqrnnpmigbb_^_`adlvЖПЧЃ…’„“”‘«є≥®ЦПЗБ}АЕМЪ£ђЈƒћ… —”–  »∆Ї±∞®¶§¶™ІЂґґЄєґі±Ђ©°ЦНДwmd]WURQRMIJJFHEGQXZVRUZ[[WSROQQSRTXZ[Z\cb\UM@83/-2;35@MiЮ∆љ}SUQHC@=<<4,# ! !!"$#"    0M[SXB/.-.0-+)&$#      *QЕ±°hUVUTPKGEBHJHEQТ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€№S?CHIPROMNMC<8;<=;97634657779987<;:::987;<:;:8;=?@B?>@@BFFGGEIHKIMNMMSRRPSTUTSTTUUTSSQJ@:>B>91*(*,)%"##(5LY`hlqtskipwБЛФ≤нэ€€€€€€€€€€€€€€€€€€€€€€€юэ€ю€ъя“•`E:65224200/103201015744312566878645543779:<9577889::;;9989;::99;<<6:@EHNZemppqrrsokiieb_`_bghjmtАТҐ¶£•§ЬЧХРЙАzunpsqs|ББЙТЦЧЧЮ§ҐЬ††ЪРИДВЖВЕИГГИЙИЖДГЖВ|zvpia\XSPPMJLKGGC@EADPWRNNPPQRRQOPSVXY\_]^aa]RH@61/-,-/724?OlЧіЃvRTRH@@A::3)#  !! "!#"#!"'&&$%"   "1=98=5,-.-/+*+***(     ,@=;::85464574777769::799867:97687>?@CIH?@CEDDECGEGIJJNONQRSQUUSTTTSTSUURONC;=A?:5)+.*#"" !)5HV`dmqurlklr|ЙРҐўу€€€€€€€€€€€€€€€€€€€€€€€€юэ€ю€щб—°\B6147511/0034/114753452355587456657657:<:87999879::99=;;<<;::;:<:9:=AHJPYagossppnmmjjic`bdbdefimswtwvtwzxsolkhhhjjopnrwxy{|}}zvrnlnnmpppqolllmikiddb^[WVTOLNLGGJHEDCB==BFGGILOPRRSQVY\___`__\TE<772..-+*-505=NkЫµ±{UUPG<90+%##!  !  #  !! #!$((((&%"    "-33,-.*+..-+++(**-*!    !+DzЋфю€€€€€€€€€€ю≈DWБђ£mVTSRNGDJGEGGGRТ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўP@EGJLRNNOKC62:BcЄ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кБ][[hЬ»©slh`\XUSSSfЂяп€€€€€юьэ€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юы€€ю€€€€€€ююы’Рhca_\[]^^__^]^dБЇ÷ЋПQJHGEGGDEDGHHHGGFCCB@@=;;;:7752452445663599;8743884798<;=@KH=@?BEGFCDDCFFELMMMMOSUUSSUTTTRTUQQSM?9@E@<2+,+$$"!"$'/?S[dlsxtoklovЙФ±кш€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€эўї°Б\C86323222421327556564367678365748879;::7799987::68<<88<<:<=<::<<=;=>DGPU[_elmkmmnnnnmjhedbcdegghfcacfjhhfcc``bcceghhkkknonnnmjgdbcdbbbbacb__aa`_`\ZYWTSPQONMLHDGFHNNE??BEKLMNPRVUXY\`acc`^WNE>641/-,-*)&+549?PhШЈ≤wSSPF??A>80(#%!!"  !!  ! $&&*()('&$    (06*(-+),,)(()&((+,&$"!       -?x“фэ€€€€€€€€€€€€э¬AWИ±ЮiUTROJECFDFIFFTН€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏP=EHKPSQQQLD728CfЅ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лБ[YZiЫ Ђojja[VTRRSfЂёр€€€€€€ю€€€€€€€€€€€€€€€ыыю€€€€€€ю€€€ю€ью€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэыю€€€э€€€ы÷Рhb`_[Z]^\\\^]^aљ„ ОOHGGEGHGGGHIHGHJIFEDB=<=>;:9775556687762456732127769:;<>>>A?=@?CEEHDCDCEEINNKLPQORSSTVSRUTTSRQSNG<9?DA;41+&%%%'""#+;N[blouuplikq|ЕПЭƒтю€€€€€€€€€€€€€€€€€€€€€€€€€€€ющгањ•Г`J84722131223447945236747969755876:95738987::7579;>;9=;:;;;<;=<=<;>??AIQW[baciljkoopopnifedcbccb__abdb`_`^\\]]_^acccccedefecc_]]^]\[Z[]Z[[Y[Z[[[ZWTPOOIKKMKJECDDJTVOGIJQQRQRRTXZ_`aeea]VNE?952/.,***+)%+66:>OhУі≠rSROHBA?<4*$ "! "! !  $!!&(('&(''%%''! '2,$&)+*(((%&(&&&)'&'$#$!#"    ,GГЌтю€€€€€€€€€€€€€€ьњCWКЈЫhYSQPLFEEGJJJHQИ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЁS>CHNQQSRSRD948Chј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€д~\XYhЭЋ¶ojid\XUSQTgђац€€€€€€€ю€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээюю€ьЎПgb^^]]]\\\[\]_cАЉ÷ћТPEGGGJKJLKIIJFHKFFEC@?>=A<9:986448<;88754345322256789;;;==>@@@?BBBICA?CFBGMOLMOPOPQPTVTTUTSRSSQQPA8:CJ?95.'&%).)!")5JXchmtwsnihmvБЙО™№ф€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ьебЊ¶ЙfH:413431122256464647374999798647488667888::9:::>>9<;<;:<<;:;==;?>=?@=?<::9644668678755446423255679:78;=?>?>>@?BDA@@AEEEKLLLKLNOOORTSSQRRRQRQQMD>9;GB@=1((''11(##")3GW_clsvvqjhiqzДЛХіищ€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ывеў™КdH976413222326735234546899644875998855888:;9<:<<<8:<::=::8;;::=<>:::40+,+*'($&)%%-407APp£їђpRTQH?=>:5," !! ! !!!!$!##!  ! !"&)*(%&%$&%%""!    $%%$&&%%&$"$&&'$$!"#" ('  #$"('&!1LУэю€€€€€€€€€€€€€€€€€€ыї?WЗѓТdYVTRRNKLGHJHNWР€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏPAFCHLOPOPLA61:AdЉ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€в|[YYeЮ∆Фmlfb^ZURRShЂ№у€€€€€€€€€€€€€€€€€€€€€€€€€€юю€ю€€€€€€€€€€юьюю€юью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юшю€€юющь€€€ююю€€ьЎРfd`^_^^]\\[_a_bЇ—…ФSJHIIHGIKNLJNKJIGHHDB@C@><;9675685636865447872234379:988:;<;??>==>ADCABBFCGIIKKNLLQQRRQPNRTRQQQNGIH<8=DEC?>:AAADIMZcc\^dmoomkiefggb__]ZYWYYY_geeeb\XZWWXWWWYXYXYWXVXWWVTUSRRPSRQQRRNMMYMJHDGGIPOMPQSRVYWWZ[\]bhkljg`[XQHCB<8620.+))&%'$$)$$+317@MnЯї©mRSOFB<=:5*!!"!!! """!!!  !#%$&(('%%&%"%#"   $"%#"$&#%%&(%%"!"!")'$" ! !"#&(''''#',8e¬ш€€€€€€€€€€€€€€€€€€ыєB\Н≥ФbXUSRSOLJKLJHLWО€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЏN@DEHLOOOQO?43=Ab±€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юёz[Z[dЬ Цlifc_\VSSUg≠ёс€€€€€ью€€€€€€€€€€€€€€€€ю€€ью€ью€€€€€€€€€€ю€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь€щ”Оffb___^]^_]___bЄ–…ЦUIHIIILJOONLONOMLGGDCDHA?>;:99:98566756545798134128788:766;;<><<>@=;<;:::6478265697863234557776645;;<<<=<>???@BABEDHJMJKIJONPOOOLNPQRRNMNPMID<8>JE;6.(&)(/-*%!!"(8LW_fmsxztmjgnt}ЖЙО®џоэ€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€эе÷ЂОpL<678668446266367656786997446767868899::<8<=:::99;;<:<<==?>=>=>@?@@AJk™ј±ҐТВvmkx|hga]\_ec^_`fsyzuqj_VXURSSTSRRRSTSVSPRRNQLLJKLLNOPOOONNQTRQRTVUVTVWWZ^`agmsqohc_ZWVRMFA@<820-,+($&(%&$##%$"'1/3=PpЬЄ®nRTOGA?>94*! $##! !"!""!! ""$')((%'&#""""        ##"$%&%$&'$#!#!$$#$%%#$%$&%$#%"!"+/-,--/-)(.DcЯв€€€€€€€€€€€€€ыљA\Л≤ЦeZVRSSNILKMJEHXУ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џPCHHKOPOLMKC418>`ђ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аvYY[h°«Шjlid^[VSUVkµбч€€€€€€ююю€€юъью€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€юю€ю€€€юьэ€€ьџУiea`b^]^\^^^_be}Љ’ЌХQGGIGHJLNQNPPPPNMMLGBFEB?@?=;:79;85876668:997664672674567979::::<=@B@>BEFDGFIIHHJMOMPMPPMQPOPONLGEA;7AIC=6/)'$*-,)&#"$'0>R[clswxvsljknt~ЕКР•÷т€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€щжџ∞УqM77888556654454::7998647328878:6889:::;=:<<89;:<<;8;<=<<>?=<=<<@:5," #%"" $&"! ##   %'))))&%#$"!!        !!!##$#%&%#" "#$!!"&'&%)(+)&'''$!#((''(*/01-,**3Ejєм€€€€€€€€€€ъЈBZЖіЪh\VRSTMILNMNHLWУ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷MEGGLOOPLLKB519?_©€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€аtYYZi£√Хkmfd^[WTTWnЄян€€€€€€€€€€€€ьъыъы€ю€€€€€€€€юэ€€€€€€€€€€€€€€€€юыю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€э№Рhga___^^^`^a`_eАјџѕУRFFHHEKKOPPRPPPMLMOKGIIDAAC?<;:9::874679:988:874784644567679:::9<<;>>@ABA@EGHHBDGJFIJMNKMOMNOOPRQKMLHA:8=GMF@:2,&''++,)+%"%,9JYbjosxzvqmjimx~ЕМЧЈепщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь€ызёґУbC866557675576877:97676458;9898986:;<;;;<;<99;8<=<<;<>?=<<>==>?>?SЯ€€€€€€€эюэшкќґ•РЕ{wrmnniipqnkhca_]\[\\ZZWVUUYZXXWXUTSRPUWVVWXZYXZZXYZX[_`dgjnpqrrqogfa]ZUUROLHE>:71.10*'))&%$&! !!!#""&-08=Qr£ЉІkRURF<><85,! """ !#!"!$! $)(*(&%%#!!!         #%$&$#!""#"!##%&)(*)&)--%&&%&'%%')(,//01.,-7Eh√х€€€€€€€ъіCZИіЪhXTTTPMLKLMJKNZЩ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эѕJEIHLPMPNMJ@529@_®€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ювw[YYgЯЅЧomgc]ZUTTVoЇас€€€€€ю€ююю€€юэюээ€ю€ю€€€€€€€ю€€€€€€€€€€ю€€€€€€ю€юыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъу€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ююэ€€€€€€ю€эЎНigfb^]]]^^_b_^cАЅџќТQHHGHHONPPPNQRPPOQOMJIIDEDD?>?>=:9:65799;;:9:97579894579425;;999<;;;<@DD@?AEHJHFEHGFJHMPJKLMQOQQSPLHFC?99@HKF?:/*&%+*,,,&!#%*2CU_cjouwxwqhhmpxВЙРЩ≠…яф€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ь€ч ƒІГbD5254234567649;8799484698855:978;;<99;<;9::<<==<<>>;=;;<=;AcЉ€€€€€€€€€€€€€эци—іђ†ЦЗВztspojifeda`b``^]YXYXW\]\\[XYZWUWXYZYZ[[[[__`bflqrtsturoiiga_]ZXVROIFDA;31//.-,''((&$#""""!!"&/1:?PrҐїЂdRTQG=?<84*# !!!  !! &),)('$"""      !58'  !#%$$##%#!!$""#%')'(),-**&%'&#$&&&&'',023/,)-7TН–ф€€€€щ±A[К≤ЫgWSUTRNKHLLJNN[Ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЌJDKJJKMOLLH>547>^І€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юдw[Z\l°ƒШookc]ZWUUVqњёр€€€€ю€€€€эч€юю€€€€ээ€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъф€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€юю€€ь„Нlhgda`^]`]^^_`eБјўЌУOHFEGLPPOQNLQQRQRQPLIGHHHEA?A?<><9:98:86::<:5798::;8656745495767::;:<=BD??CDDACEEEHDILOMKKMOPRRQRPJDEE??;:;BEC>72*((&).+(&$!"$,9:=;;>JЖц€€€€€€€€€€€€€€€€€€€хкЉґЃҐЫСАuronmihiheab``__]bcbd_]_a]]]`acdeigigklklpsspmiijfd_a`^\YYWTMHA=<72//.-,)('(''&$#! "(106>Pn¶јђbSUTH@?>:3*"!"! ## "%**+'%$"!!     "-9>1   !$$"%#$%'$&&"!""#&'&)*,+,-)&)($''($&'$'*-///02,*/9TШўъюъ±F\К≤ЭiZTSSPNMKJKKLNXУ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э–NEHLKJONIMH@636>^©€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юаuYZ]o¶√Чnojb[ZZVUUrЊ№с€€€€€€ю€эъщ€€ь€€€€ыю€€€€€€€ыю€ю€€€ю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эыю€юэџРmkhecb``a^_``afАЇўѕСMIFFIKMNPPQNPPRPRSRPKIIIIGDA@=?=Os®њђeSSRG?C=;8,#!! #&(*-)&%$#!"!    !24-$!"     %"%&(')(%$$$&''&&***),))&++)*)''&&'&&((-/01.1..0>\«уђCZМЃХmYVUPLJLJPONLN[†€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эћOCCIKKONMMGB835=`Ђ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э—rYY[r©ЉРmmha[YWVRUsј№н€€€€€€€€€ююютц€€€€ю€€€€€€€€ю€€€€€€ью€€€€€€€€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€юэ€€юэ№Уlmjeca`a`a_abceє’ЌРPJIHJJMNOPQONPRPQURRNLKILIECB?=?@<:;549:98:978::8:96789778766;9896869=:;==@?CDC@DDEEHKGHKKLORPMNORNKLFB@B<33;>H}ж€€€€€€€€€€€€€€€€€€€€€х∆њ≠УКzsrpqpllkmkijmoosqpmppqmknmkjjligeccbca`_`a_dca_`a]^]Z\XVVRLJ@=<9411.++)+)'%$&$"!"#!+06?Sr©јђgSSOH@A?97-""$ !"#',--(&%"#"$     .35.!!   !%()++*,,+*('(%(''**++,*(++(,-**)(('&%'**)-2363-+*9_fIYЙЃТgZRSQMJKMQPKJL^≠€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь NCDGIKMONHDA936>`ђ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ы√nW[_uѓЇЛlmga]ZWUSUrЅЁл€€€€€€€€€€€ыаш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ээ€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€юэю€€ьЁСlljf`^_aaba`befЇЎѕСPKKFILMMONNPOPQPRSQRPNOKMIDGFB?>>><:69:9;987598::::9:;<:89879<::<755;:7:>A???@AAFGHGHFJLLINOQOMNPNIHGIB@B?605?HIGB:/+&##%%(,&#"" #,8IX]chlqvyvtoljfluzБИЛСЦЫ§ƒ„жч€€€€€€€€€€€€€€€€€€€€€€€€€€элењ•ВcC5360247889977557666:796489689:9;;7:;:99:<8;;<;<===BZ¶€€€€€€€€€€€€€€€€€€эьогЌЪКupmjd`_^\Z[[WXXYX\`_^[]]^]^_\\\[[ZZ\\[Z[\[^^bbdeb`__][[ZYTSPKD?=;442//-+*(*)&$"#%$" "-06=Qq®ЉђdSSMG???;4/#& # %'(,--('%$!!##   (;=2$  !  &+-.--000..+-+-+(,*(+,-*(*+*++,*,,*(''&&#)++11/0.,ASAYМЈЦfXTTUNLJMOPMHL`±€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЋKDHFKNLNLJD@713;^®€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЈoZ]`sѓљПlid`]YXTTVr¬Ён€€€€€€€€€€€ющэы€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€э€ющџПkhhc`a``babb`bd~љџ—ТPHJHHNPPPOPSQRRQQQQRPNPNMMHGDCB>>A?<9887:988578:98<;:;:::::89:886458:78:;=?@@<=?DGGDHJLIIIMOQPNMPOLHFHEBD@8327BMJG@<6-($%"&()#!!!#&/DS[bdhnruxxuohimpsz|ЗЛНПУЬЂ«ўнъ€€€€€€€€€€€€€€€€€€€€€€€ю€ьмкЎ©XD:1/0135997656767788787=8379:9:;:99;<:98;8==;;><>Iж€€€€€€€€€€€€€€€юыфжќТДzrjijfb^[WVWVTRQQPQPPSUUVUSUUWZZXXY\[Z\\\\[[\[`_cdde__^[ZZYYUPNJD;@N7.0.--*+)')&%%!#$#"&-/6@QrЯЈѓhTRQF?C><5-""!"#)(+)(*&'%#"     (661$    %.0274343310210,,,,*(+**+--,,.+)-,**&(&(&))+*,/0/CN?YМµЩcWWUULILNMNNKM`±€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э«IDJHLNNNLMF@513:^≠€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЅp]^^rђјТlhea\ZWTUWu∆Ёр€€€€€€ю€€€€юццю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ючщ€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юю€€ью€€€€ъѕРlded```ac`a`^bfВњўЌРPGGGJOQPQPQSRRQPQQSRONROOOMJHFBA?B><;89786476389878<::<=<9:587686334777:;;=?>>;=@AADIJKHIJMLPONKOQLKKJDDC?75227AIIHB<7,'%###'%%$% !"*:KY]ceiprwytqokjkknw{}ГНСХЩ°єЋЁнщю€€€€€€€€€€€€€€€€€€€€€€ю€ш«Њ†БhRF;534567767659778977:4276;;::598:;;::::;<;==>?U•€€€€€€€€€€ююьъцпб≈ЬИyqkhida_][UUTTSPPMJKLOMPOQSUTSUUWZZYYZZ[\]Y[[Z]]\`ababa^^]YWWWUQGCA>6:B0-+*)*)(&&(##$#"#! $+/3@Ou•ЄЂiVTQC<@=<8,#!(*++*($&#!#""!  )14,$     .@F@:::78634313330--*+,-+,//,-,**+)')()'*))(**-.<@>YИђЫfYXUTNILMNOMFLb≤€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьјFCHIKMMLKNJ?4.5=aЄ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э”q[]^rђјРnlh`[YWUTWx…џм€€€€€€€€ю€€€цоююэ€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ьыюыю€€€€ю€€ь‘Рlgfb`_^_b`____eЕƒ„ЌРOFEFHINPNOQRTSSQSUTSPPRRRNNMLGDB?B@>=::865446589:9:==:89;::47687745258999;;<>?>>@CCCFHILIHKKOLPRQQJHFHEAC>535817BJNKC:2.)%$%%$&)*%!!"&0@NY]aglqxyyxuqnhfjkpyАДКПУХЪ£Ї…’зщю€€€€€€€€€€€€€€€€€€эю€ылќ…ЉѓЬВdE5642447986:789:9::85989:<::;99<<:9::;;<>=878544588:;68;=9878:;67976354228::8;<92/4988885778999898:89;7:::;<99;:;:<><=BTТнфпиЏ“∆ЈЂЮУЗВxunhddb_^]Y[VVVUVUURPKIIFBGHIIGGLPPPRSWVVVZYZYY[Z[ZWXY[[[]^][\\ZXWVRNJEA;740/.,*+*&&%##"! $!"*04@PxЂњЂbVVQK@BA?;," &)('#$$"  "!   &.40$        *@lњблсцеџ™oVHFC?><;;:;<:;8520///.2.-.---.,0.-,,++*)-5;A^ЛЂЩgZVVTRRQQPMDGPc‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьЅKDGFKMLIJJFA7039_Є€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дpZ]_t≠ЇКonib]YUUUVw¬Џф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эээъ€ыы€€юььъ€ыЁСkihea_a`_^\``agЖƒ“«РNDFIGIMKLNQQRTUWVVSUSRSRONONKHIEB@AAB@777546579;855898688999;988665/3778::<<=<=>>>@AGDFJGFJKHLOOQQOJHGD@A:68530/5=;;<;98631---..0//---./..-,,27@_РЂХhZWTQRQOPNJFDJeЁ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ь≈PFHFHJLJIFHA604<\®€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кs[^`uѓіЕnmia\ZWUTW{…Ўш€€€€€€€ю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€юю€€€эы€€€ю€эюэ÷Пjhefb_`_a^]^bdeЕ√„ѕТMDEFEHLMPOPSSTVUVUTUVTPQQNNMKHIGEGC@@<6985545698:635436<<<99;9::9772485:<<=;<::;BIOKC@9.)#&$"""#'(#!  %.7GV^cjlquy{|{wpkhggeinsu|~ГЙРФХШЮ•Ђљ»‘Џйцю€€€€€€€€€€€€€ю€ыѕ–ѕ≈ЄЩqP849:99997779988;:878:89;88;998;99;:;GfБЗЕ{vqqonheb`]\XWYTSRPPQQMNPNLLIJKIFHFDEDCFFGIJKIOTUTUVWYZYXYZ[XXZXVUVVVUUUTRSLHDB?<73/.-)'''('$# "$! "" #)/7>R≤њ≠eVVSKBEC=9/&!"')'&# !!!  /=5-     1N{„м€€€€€€€€€€€юи—УiXPNMJFA@B@?B???=;:621.0/-./.-/12/.--06@]УЂШiXVUSSQNNQNIIN`©ны€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эћVFGHFILLIGG@924;W°ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лt]^]sЃ≥Бnkf`[ZYTSX~ћўч€€€€€€чь€€€€ю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€ю€€€€€€€€ю€€€ь’Нkecfb_a``^_`eefИ«ў—РNECDDGIOSRPSTUWVVTVVUTRRSTQOLNKIJFCCA=9;<86786947504315;;=<;;;899:;5599;;:;;<<;=@????>>EEEHJIJMMKMNHDBB=C?:81031266;CILLD>93+(&%"""!"%&!  #$/CV\`agnquy}}|xuqjeeehhnsuz~ДЕКПСЦЩ°¶©Ј≈Ќ—амую€€€€€€€€€€ы“‘”“–∆µЩoN;898785887;:799787:8:9:7:<988:9;9>Kesrpmkkgcca_[YXVWRRRPPRNHOPKLJKHIHHGGHIFECDHIGFIMNLORUUUVVXYWVX[YXWVUTUTRRQPNNNLEC?<953.+*(''%%$%$$%(# !!   "+/9?TГґј≠eWWSMBDD=:0&$()*#!!   (4>2!       #3RЕ“ж€€€€€€€€€€€€€€€€пж≈}fZSNLHKIFBBAAA????<951.0//01143..057@^Т©ТgYXWUQQKNPNGJJOWpї’лъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э VDIHGJJLHGI>8137U°ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оs\\]u≤ЈБmkfa[YWUSV|…„п€€ю€€€ью€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€ю€€€€юъ€€€юўМkfcebb`b_]_cdbeЗ≈÷ќТQEDGEHIMSSSRTTWVWUVXVUUSTVQPNQPKIEBEGC@==:;;98<7330245556<<;:9957<<:9;==<::><=<<==?;BBIEFIJMKLPLGF?>9601002238=>CKJEA<4.)(&!! #&%""! *=NW[^dhmpwz|}{urlggeehjloux~БГЖЛСФЦЩЯ£•≠ґЊ… ќџдкош€€€ю’‘’’÷”ѕ«ґЬtR<9:83989:::989::94889;;;;77<9;554/-*((&%%$$##$$)/"  !% #*08>RГЇ√©`VVVKCEF?=3&#&*)%"   $-53+        !6_Э‘й€€€€€€€€€€€€€€€€€€€€ьмд≤zcWSUTQKIJGEBBBD@A>845301123380/66@]НІМeZWYURONQQNFHJKA.7Krµ’нь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эƒRDLIHLJNGIIB8306TЬъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юиr]\_{іѓ|mmha[XVUTXВћЏщ€€€€€€юью€э€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€юю€ю€€€€€€€ююэ÷Оmideecaa_]]_aceЙ¬ќ РQHFHIHJMSSSSTUVTWWXXXWUUVSPPQOPOJGCCFCC><::=:9:64502252358:78;777;?<=?>?@=;==;;<=>:8=>ABBFDGIGJKKPJFC@;:?;6331200224:<@GLJFG<40+(#% !"!"%" "!!&4CRWZ_cgnsux}|}|xtokhfgcdgmrtx{~ГЕКНРХЩЩШЬЭЭЯ•≠±≥єњЅ≈≈Љјњƒ≈√√¬јЉђНbE867;:;<77889;995985;99958899>EUZ[^\\[[\YXXUVYURTTPJIIFIGDCEFFJIIHIIJGGJDFFFGJHGLLONPUTUVWUTSTUTTSPOONMKGHECC?A?;6//.,)'&'&$$##$"""$%# ##*16=T}±∆•]WXVJCEDA?3("!!$'''$!!   #8A4(     #:`©ўх€€€€€€€€€€€€€€€€€€€€€€€€€шн‘Гl`YVTSQOMKEAACFF?=?<6:3351:5089@]У©ЛgZX\XSPPQOKCELL?.)(-9VОї‘ихэ€€€€€€€€€€€€€€€€€€€€€€€€€€эЅSFIIHLJKHKHE=426PШь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЎn]]_~іђynlga\ZVVUXК“бэ€€€€€€€юююю€ю€ююю€ю€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьюью€€€€€€ю€э÷Оnkfgfdaab`^_degМ¬ЋћЦQFFGIJNOTURRTVYUVWXWWXWWUSQRQROSOIHHEEB@=><><98667652303525499866:==??=;>=<><::<>@>:<>>>CA>CIHHIIKFBB?=A@:5343013332:=@CFLJMB<92,('#""""##!" %)7EQY]adfjosu{~|yvpljgebffhlqrwy}ААДКППРСПРСТФТРССЦЦШЬЩЭЮЫЬЬЪХЛБlUF>89;:;99:;;;9:6978:9898;8::>LXY[\[\\ZXWWXWUUTTSQPKKNLHCDHJKFHHGHJJHHIJEJHEFGFLPKMOQVWVUVSRSTTPPLIHGFFDBD@;=9842/-.+(('''%$" "$! !!! !#-28>S|µ…°[XXSI@EDC=4*&())(&! $  4>:* -Df±Ўы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юпк Йsf^ZZXTPJMJFHEFGA@>?=:644297?YНЂЛeZWYUQOORMKFFKL@2.-*')/8KjЪґ ўр€€€€€€€€€€€€€€€€€€€€€€€ю√REEEGJGFJNFA<324LТх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юѕm\]_Б≥∞{nkg`[YUUUVИѕЁъ€€€€€€€€€€ю€€€€ю€€ю€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€ю€€€€€э€€юЏНlkfdeddcaa_bdffЗ≈–ЌЪRHEDHHMRRRTVTUYXWYWYWWWWVTSSSSRQONHLLJHFA>?AB<;8:878844473548;954<>??@><@?=?=<79>?==<===?EFECBCEED?;>=:651/.024335;?@CHNMOFA<4.*%%!"# !"+;ISX]^adimqv{}}{yvqrojieccehilortv{~~БЖЗЖЗИКМКЗЕИЙИЖГЖЕГБ~yuqh_WPG<=;<:;:;<;8;=86999:759:;:CT[ZZVZ]]ZZWVVVVUUSROPKNPJJGGFJKHJGFIJHMKGFKKHHDHJLMNLORSVXVSPQQPPOJEBA@@>>;<95550.,+*+(&'&%%#$!!!!! !  ! $'+08@R}ЄЋ£\YXTMEGFAA81++*'!   &(.20$  &')Lzѓ«№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьтпи»Дqhe_XVSQOJNMFGHHEDB>=:88=YР≥ЛaYWUQQTOQQJGGOJ=0/-..*'#$#*2DYС÷х€€€€€€€€€€€€€€€€€€€€€юЊMDDCEHFGKMH?;314IЖг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю∆m]]`В≥∞{lje`ZXTTTUДћўфю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€юээ€€€€€€эЏНlhfcddeebaaeeghЕƒ”ЌУPIHDEGMSSQSVTRVXXYWYXUVVXVSTTRTNORMMNMLJIA?BC?;;>;:<:8755355;;8789;:=A<>CA=?=<8:><<>=;;;;=>==?CB?ACC@@;;=;542100545539>>?@GLNMJG=52*'%"!  $-:DPY]aecfistwyyzwwvusolhfebdfgikoopuxzyz|{~~~~Б|{|{ywxsssrlib[VNE>;<<<9999:;:97;<9889::>NXYXXWYZZZYXWVVWVUURVTPPNONNMKMMKMHJNOJLLIKNMKLIMLIJNLORQQUTPMLIGGID@==;=864300/+++('()'%%%##" ! " !  #)-5ATyі∆І_ZZVKEHGC@=4+&$ $8@3)"     +-$ $.AmЌй€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьфнѓАkdb]XTSSPLLILJIIIG>;7?YР±Кg]VVUPRPQPLJKMN?00.-,--,++'%%-7WЬ≈жю€€€€€€€€€€€€€€€€€€юЉLDDDGFGJKJJ@=784H|џ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юƒk]^`Б≤ђykkfa\XUUVVЙ—‘мюш€€€€€€юы€€€€€юы€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юы€эю€€€щўОlhecbedcccbffdiЖ¬’ќРOFIHEEMPTTRSTTWXZYWZXVWWXXTSTSUQQSTROLKMLICCBB=>=<>=88787566862353658<:=?@>:?>:>>==>><=><>@CA??B?=99:;724/02435687:=?>AHJJNKG?:3-(&#   (6@MVa`^afhilorstxxyvwurnlihhdedeilkjlmpoprtuuvxvvuusrrpnopmifdc]XTLB=<9::9;9:8::;99:98:ERXWVZYYXZZZXZZWVVTUUWUTSQQRNNNQRMOMMNNMMLLNMPRKLNJGJLHIMPPVUNIFD????><8672/.+*,)'''$%&)*%#$#!  ! ! ! "*.6DTu∞≈ђbZZXNEDEDA=6(   !.261'    ")&2HkЄЏ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щх№Э{if`^WUTQONKLJIGC=7?[Ч≤ЗcYTUURQOPQNJIKM?/-.///000.-+'$#(-CsЈ”ры€€€€€€€€€€€€€€€эїKCBCECFHIIGC?565E{г€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”m\\^і©wjkhb[ZUSUWН”—июъ€юсн€€€ю€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€€€€€юь€€юь€€€€ыЏОjhebefhgdcbacdhЗƒџ÷ЩPEGGHHLORTTSUXXYZZYZZWWZYXUVVUVTURRSQLMPOPIFFICBA=>>=;;;966871120046:<;<:?<9<@>;>A>?@@>>A>??9:9=<;><:;8;::7541/31234989>=??AEFLOOI@=91-'#!"&&4?KVV\]^_adfjmptvvvxwvwtqpmlgfhfbaeeghikjmlopqooooomklmmkjfhedc^XRJ@:<<9<;:;;88<;89:?MUWWVY\YX\Y][YXYXVVWVWVTSTSOORPOOQQOOPQPPPQPJPOIJKGFIIDEEJOVTKE>><<::8620.-*)(((%$#$$##((%#"       '.6DTu∞√ІcYYVOHFHEA>;7980144357;;979<;;>A><=B?@A<=>=B@>;;;:<<8:=<558;532./244549<9>>93-)%## ! ()'+0;>LWZ[^^^begmppqruvwxwvuurnlheceedcbcehfhiljkkkkjhfjjfihfccdb][WPG?=;::8:999<:<:;HTVXYXWXXXZ[[YZWYXUVWWXVTTURMRTSTRRROOOQQPQSNKMJHHHIHGCCEBCHNKD@:68765/,,*)')%''%""$$$" %%%#!!!!   "!  %*.9DVwѓ¬¶e[XVKEKKFD@2    072)     &4JrЇЎ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьъм£|nga^YWUQMLH?;@^ШЃЖd[VWUROORQHFIML@80013A92610./,,+((%%')9b®∆ию€€€€€€€€€€€ѓIB@@@DCFDFCAA722J~г€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џn^]`~Є™vongb]WWUTXТ‘‘рыэъщёЋ—Џьыю€€€€€€€эю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€ю€щю€€€€эѕОmjjiiiihfdcbbagЕ≈Ў÷ХQGEGHGOQTSTTVWYVXXYYZYZ\[XXWWXYWWVUTSUTPPOPSQOMPNIDEAD=>A<8;:455323257988:89@@=>=>=@C?=>?>>?;<><;:58:8017;4/00/084369::=>:=::=;?PXWZZZZXXZYY[ZZXXVUVWXWUSUVSTTUWUURRRPOORONNPQIGGFEEB@=AA>=?@?<:611/..)%'(%!%"$#%!!#"#! "##""#! !    "%-.5AV}≠√©e]YWPGNLDE?1    &21(       0PВЊЎ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыщ’Рylffe]VQNMD@aЮµЙd[YVTQQONPHHHMMB80326=<;98:643036876:98<>=<>??@BE>@G=<::79:512972131/147259<>=>FBAAFGJNOMF@:6.*&#!# !   #  &+4BKQY\]^_a^_^befhkoqqqqsqrssrrnnlmljhhffec`acdbbaa_bbedbbc`_]YSND>::;;9;>QZZZ[\YZ[\\ZYZYZYXWZZYYYZXWVTVUTRTRNONNNNKKJIIGHDB@><=<;945531/-*)%"! &0'! "!  "%" " "")+&" #"  ! "*/9EW~Јћ§b]^ZRNNHHHA1    (87,        %1Ch≥и€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эьёЧАmf]SF?bЮ±ГcYWWRQNQSOICHJK?556415555322320.-0021-)))%"#%*>g†≈з€€€эКG@AA?@@ADFGF@814Cqм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ќm`aaБ≥Ѓ}pojc\ZWUV\ЦЌ„ччээубуэ€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€эцэъы€€ю€€ЎНokjhdggiigfbabgК»џ”СTMJGIIQSSSUTW[\[Z\\[[]\\]\[Z[WXXZYWVUUVTSTUUVURPTTMKIEFGFFC@=<>><:8344347568;=9;>=<:;::641396112101206;:=<<>>?A@@?ABHIILPNLHE@72-$$#"!  &.6FNW\]^]]\\^_abdefhijhmnpqppppppqpmkkighhfhifccbcdfgdbdcdba_ZTKA=<>;9GW[]^^\\^]^][\]YYZZXYZZXXYXVUUSTRNPMMNLIKIGHFEB?A@?=:::740./-,(&&'" "0' !!"!  #**%"### ! &1;HW~њќ†^]]ZQKOMHIA-  '53*        $2Jvґ–€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щїРoZKAe§ЈДd[XWSROORRLDEJOD864348635644521302110/---+)&'%!$,@w™ƒ’©WCAA@@@>?DEFGA824Coк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€¬n_`aЃЂ}rpj`\ZXWU[Цћжюью€ьыю€€€€€€€€ю€€€€€€юы€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€ю€€€ыъь÷Нokjjgjfgjfgec`eМЌџ‘ХUMNKIHQTSSUWXZ[ZYZZ[[\]^]\ZZZYYYXYVWVTVVUSVUTSRPTUPOMKKKIDEDBAAB>;96556596678;;;<;;=@AD>DD>@=@@=;==;4113870//0/1/0669===>>@A>@ACDFEKIJLNIHFB<4))$#""!!)0=HOX]\\]Z[\[\[\___bcbegfhjllmnoomolkmkkmkihfffgfihedfihfe`[YQKE>;;M[Z[^]]^\\^^\\\ZXXXXYVVWVURRSRNNMNNMLMKFHECD@A><<;78552..,*(&%#     $"'#$%"$""#"!)19GW}їѕ£b^\ZSNQQLIG0    055&    $1Mєџ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“Л[FeҐєЗcZYWTSOLSRKIJLRJ;985253227643367763120//./-+''$" !!,C[FC@B@>@?>=ABADB900@nз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€њl_`bБ≥ђypoia\[ZXW^ЧЌзю€€€€€€€€€€€€€€€€€€€€€€юю€ю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€щэ€€€€эюўМmhiihgfhhghfeadМћ№’ШVMMKLLQTSTVWYYXZZYY][[]]\ZWYXXYZWXWVUTVVVSURRRRRSSRQQPKILFGEEEC@@<::99985543458::8;<<;<;<@AA<>A?=<:7323154./2///.16589=<;?>?IOVZ\\\[[ZX[[Y[ZZ\][\_aedeffgiihkimlkhfhgiijljhkifhffgd`]ZWMDGXYYZ[]]^^][[[ZYZXTUWXUURQNLNPPLKLLGHKHIEFCAB?><:9633//+('&#  " !! ! !"!##'**'$$#!!!(-8EYwЃ •c^]ZUPQPLIG2  $191&   $2LГїд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фkIc†ґЕeYXUSSPOROHFIQRLCA>94783235313478;86843000./)*'&$#"5BAA@?=>@?@@AA@900;89:531339;7:;989<<<=?=>CA?::97550263322002246:8::;@@@@??ACABGEJIHJMOMJF@:0(%### ! !!#,4>FOVZ\\\XYYXXVTUTSTWZ\Z[\]]]__baccedbddfgghfdffghefff`aa\YVV][ZZZ[][[ZZYXVWWWUUUTRPOMNJGJIIEFHCDFECB??=>97430-++(&&#!      !#""$$)*)(#"#"!(.9CXw®¬•d]]\SQQMLID. %:A0#    %.I{іи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юmId°µЕeZWVSRPQPNLEHQTPIF@?=<:7531223168;;<<;960...-,)*)'$#1B@?BB=AB@@801:a“ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®j_`_В≥≠{ojh_ZYXVV`†—у€эю€юь€€€€эю€ю€€€€€ю€€€€€€€€€€эщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юэю€€€€€€€€€€€€€€€€€€€€€юэ€€€€ююћМqkhgfeefccdfeeiО Џ’СXNMLLOSTVWWXXZZ[\]]]`\\^\\[Z\[[ZXXXWWWUVVVWVTVUSSSQRRRQQSQQPKIHEFDC?><<==<742758;7765367:<;<>>==>=;7750255352313244669:;;=>>A@ABBAADBGFHKJMNJJEB;3-)&"$! !   "&,1=FOUZYZXWWVSSQOQPPSRTUTUUVUXZZWY[Z]^\]_^[]_`ba``_^\]_\[_[[ZXWWXYWVUUVTSSTUROLMKHHHHFHEHFAABAC@?@>8944/0-+)'!"  ! !! !!" # $)))++(&##" &)+/8EWy≠Ѕ¶hb^]UNRRMJB+  *3:.$ )4KЕЈв€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъlHgҐєКe]XWVPNPROMHHNSSGGBBD@@@:85411135:===>=8411--+),,,)&#$1@>?C@@;==>ABAB9//;]—э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≠la__ГґЃ|pkha\YYUUaҐ÷ш€ю€€ьэ€€€€€ю€ю€€€€ю€€€ю€€€€€€€юы€€ью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ью€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€эќЛoijhgdehfcbadgiН»Џ“НWMMMPRUUVUWXXZZZ[[\__\\[]\[\][[[YXXWWVVUVWVVTUTTSTSSSRPPSTSRMEIKJHGBC???=@:6865:86:8412689;<:;;;<987411215454/2423257;<;;;<>@=?@AAABAACFIHJQMJHFB:550(%#!$! !  %>229ELQVVTVVTSRRPJMMOKOROMOQQNOONTRSVUXXXXZZZYYXXWZ[Z[YZXWVUTTTUSSTPPPQPOPPNHJIHFFDCCCD@?@=;>=:<622,-*()$"  ! !!#" #&+++&&(*$!#$ &'*,,09CWw§ЊЂkb_]VPSROMD/  !33."    !-9TЛіо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€pHeҐЈКf\XYTRNPPQNCELTREAEDEACA=?<8200036;A>?B=:883/.-,,./*'*2:==><><:<>?CD@;1-:^ўю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€±l``cЕЄ≠{olgc]ZYVU`Ґ’ы€€€€ююю€€€€€€€€€€€€€€€ю€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€ЏКlkhfffhfeedbehgН∆Ё÷ТWOLKNPUVUVXWYZ\Z\[]__^^[]\\]\[[YYYYXWUTSTVVUUTTVVUUTTTRSTUSTSPNPPMKIIF@??A?>;9::86:;4439=;:87<;;;:974510355564674768:=;=;<;@==B@??@BD@CFCFIPOKLIGE@=:4+)$%#"  ! #:&#)/7@BEMQOTRSROMHJHIKGEFIIDJFDJIHKLNTQQRUUUSSTRTVUTSRSRQOQPQKMMMKJLNLHKHEEEBB@A@>=?=:9775453/*+(&#!    ""&&**,'%$#"#!!""! %'+*)()17BVx©Њ≠j`_[URRRMMH+6<0"    (;_Шєх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€mHf†ґМg[XWUROQQPKBGJUUJBBEEB?AAB?=;96348>?><<;9830./.0-+/37:;;;<;89<>CA=<4/5^Џю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ђh__dЗї≠zmkg`]YXVW]ЮЎы€€€ю€ъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€€€юь€€€€ьъь€€€÷НlhijddihgihcehhМ аЏУXQNMOQUVUYXX[[\[^]]]^_`]\\^]^][ZXZYYWVSSUUVUUVUWVUTRRVVTUURSRTSPQPONKGFCACD><<;:7559676764587768887267205212525566356:;=;:?A;<>>??A@ACCCDDCHKKJHJKGAC>6/''#"  !" #%&,3:9DGKLOPLKGDFGFFIDAADBBC@DIIJJKOPPOPRQQQOOPRNLKNKMJHHFGHHGIJLGGE?AA@?><::75331-*,+(&$"!  !  $(++)'(&"!!##!"$$',*)(%$).6EXz≠√Ђi_^[USSONJE*%3>9%      !'7UЪЅ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щjIfЯіМfZXXSRQPRPLHGPVYUNHHGE?@DBA?@??;;::;<;<==>=<<:6120/-,.289999;957<>?@A?;75[в€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€£g^^dЙї§ukje^[XXWV^Э„ь€ю€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€юэ€€€€€эю€€€÷МnillfgiifefdbfgКћгўСXROPSTVVWZYX[[[]^_[\^^_]]]^]^]ZZX[ZXVVUTVVTUTUUVTTTSUVUTTUSRMOQRQRQQLNIGCBD?;=:88667:8732079:9585676765023135546;:6488::<BDBEDBGHECKFHHHC=53,%#""  "$'-28?EIGHKIEEGECA@BABCBDDFIJHMPNPPQNMMLNROJKJLKKHDDCCDCEEDED@?;=<8995440--*(&%$!      ! !#$%'('%#%(-*"!! !!()+**'%"!%)0:FXvЃ»Іha^^VOSPKME*$=M;'       '7VРЇ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щkKgЮіИdZWWSRQQTPIDFP_md[TOJHE@?A@??@@?@=;:;;;<=><=<=<:863/./4:<;<;7778;<=BGJRU=Rµ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€°h_bdКє§tkjha[YWWU^ЪЏэ€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€юы€€€ююью€€€ЌЗkilhghgfgghgeggКћя÷СXPPOSTTVXYZY[\[_^\[\^]]\]]]]]\YYZ[YXVVWVUUUVTTVTTUTVXUUWTTUTPQOQRRRQOMNLGCDB@=;<:67:<97238688::533021411471189736996:876====><??@A?AD@CDABBBCGCHKEFF?;70+'& !$*//6=?<>>:???@@AEDCBEFHINRMLLOMKMLLORNGHGDHD?@?A>?>><<<:8750.-.+)+'$$     $&%(%$"%,6/"!"$$*-,+%!!$"(/:FVwі»Ґh`]\WSUSOMI+$37,   )9WСїы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шkHg†їЛeZYWUQPRSOICFNhЭЩЗqaWRMIBAA==?A>??>?>=<:>;;=<>>@=<:4325=@>><76:987>;:644027874/0////104731467477499879:<=><;=><>==@BCB@@DB>BBBCFFIDGJD@@:91*%!#!!%$(-,-/11389:=>?BDAHKHGGHIKMKFJJGBB@>?><9:98779532/,2.%%$"        !  !##$&""!  #,1,% #'*+,)'&"&1=GWv∞«°d]`]UQTSMLI,!#    % #=iЩє€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тlIk°µЗeZZWSRSSSPIBJOlЄ ƒ≠Тxj`WPJE@>>><<=>A??=>?;99:;>=>=;8754;;9;947<936;=CGc|hD6@[О≥я€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ъea_eХƒѓ{nmh_\YUUV^Цяэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€эЋЖkhhhgjiiimupifdЖƒя÷С[RSSSTWWZYZZ[\[]^\]]]][Z[^[[ZYYXYXYXYWVWTTTUTRURUTUTVUUVVTUSSRTTTUTROLNPKJKLHF@BA@?==;::7423:8321/-/140/47411579737;48::;<>=<<<=>=;<=>A?@?>>>??ABCCEHFIGHEAA:2-'% ! "&'),/545888;:===?<<<866733231,,,*+),+&&#!!        ! !!!! %%#!# !$(%%&)(-*(%"$"&2;HYwђ«•e_`^UPNOMIH3    #&9d†Ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тlKj¶єЗd\WTQSRRSRKBKPrї—ЏЎЋґЯЙudYQLCC?:;;??==<>@@97=<;=>=:<>:876474366509:9COYh\F5(,1BjЮєм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Цd_bgХ∆ђxnlh`]YVVV^Ъею€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыэ€ю€€€€€ь ЗkgehhihhfivzpgfЕ«г‘Л[RRSTTUVZZYZ[[]_^^^\_\[[\][\[YXZZXYXYWWWUTUVVUURUUVUTTWVVTVVSSSTUUVSRRONPNJJHHEGIFC>=;;;:75497511312252.44000448968:47;::<;;>=<:==<=;@@<<><=@@@BDHEHIIFDCA=8.($"!    "$"$&'(**)',,)+)(&&&&# "!         " !$$#!! ! "%&***,)(&#" (2;IWxЃ«¶h`_\TPNNOMO4 )=kЭ’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€нiLk¶ЉКdZYUTOPSRPIBIPtЉбындЎќƒ≤У|i^UPLD<<@>==;=>A=:BD=>>=:=?><<;66643/.0951AQ]dP:3%!!'5KyІ∆€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Шe_`gЩ…≠xnkfa\YXVT^Шдю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€»ЕjgfhghfihgsГyhfЕ д—ЛYSTRSSVWXZZZZ]^`^``__]]]]][\]ZZ[]ZYZWWWVTVVVUUTSTWVUSSVVWVWVTRPRUVVUUTSSQSOIJKHHGFCC>>?=;;89966793100241550.05478:877;:;<<;;<=<;>=<;:><<==;KZyђњ†g^__WRQOOOJ3 "!*>l†а€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вeNq©їКf[XWVRRSRNICGNt ъэш€о№ў’…є°Лvg^RIEB?@@><@C>;<<;=??>A?:;:600/050.7CPQ@1-$  "!%-=XЕ™а€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Щe`_gЫ≈®xmlea[YWVV^Цзю€ю€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ Еjfhiiihhhhm}{mgЗ а‘ЛXSSTSSW[[Z[\[]^__```^_]]\[]]^[Z[][YY\YVVVVUUUVUVUVVVUSUVVWVVTSQUVWUTVUUSSRQNNNMKHHHEACB?=:;<;9877421222/5732325:7:969;:<=9;=><<;;;=99=999<99::9:;=??=?>>DHDCFEC@<81-+%!$" "               "! !""!#$'./.*''%" )2:KZ~ѓ«¶g]]\WSRPONM5 #+?kЫб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еgNnІЇИg]WUURQSTQIDHOv–ъшшююэу÷ѕ—ѕ»≥ЫГj[RLGHD@A?==;:;<=<===>><>??=<<612/1.0/5850,*&$!"#""##(0FmЫЈч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Уd_`m£…¶wnmfa\YVUW_Ъию€€€€€€€€ю€€€€ью€€ью€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ью€€€€€€€€€€ќЗmffhjjihihkuujЙ«№“КYUSUVVWZ[ZY[[]\^__``_`]\\\\^^\ZYYZY_bXWVWWVWWVWUWVUTSUWUVWVUTTSVVVVVTSSSQSRRSOLLJMMMEDBA@==<=;8:8774331047422298:;99;;<=>9<==:;<<<==;:979=<98;97;>>=;=<;@EBBEEDBA>;71,**&"#"                   !  !##$$*,+--,%!(2=JYГіћ®e^][XRPQPQL1  ,@pЮб€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“cLm£ґЗe[WUSRRUTPJFKQ~—ыь€юю€чЏџџ÷Џ’–ј°ЕrbYTMJFD???;::=;<==<;<;=@><<:240110./.)('&$$&$"#!##$$'-9OБ∞э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Оc__pІќђxlkf_[XVVXa°с€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€юэ€€€€ю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€“Еmfggikijjijq~oМ∆ЏќЗYUUUXVXYY[ZY\^\\]]```__^]][]]\[ZZYae^XYUUVWXVVWWWUUUTTVUVWVTUVUWVVYWUUTVTTUUSPOPQRQIHGDGIB>=<<<<;:955735663874999:97:==<6:<;;==;=;:;::88;<::9977:;>758<;=B@?CEFDABA>9740+'&!"              !!!"$%'++-,('$#!%1<;;<;<=>:>>>=;;;:686620//-+)($#%&#$&%!#&%&'&*4RЗ§≥е€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Мb``m§ЋІullg`\YVWXb•р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ьюю€€€€€€€ю€ю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћЗlghiiigijiim{~uО≈џќИYRSTVWZYZZYZ[]\]^^_`_^^_]]\\][Z\\Za`YXXVWVWWWWUWVTUWVUTSSWUUUVVXVWXUWWUVWXXVRPNQTQQLIJIGHFABBB???><686358:458648;:78;9:88;:89<:<=9::<<::::7;9778::;6667<<>@AACDECAB@BB;:4.*&&#               "%&+***(&!    '3>KXЖЄѕ†g_^YTQRQMMK4$!'7fЯц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€«`Oq¶іЗe[ZYUQSUSSKGPSД№ыю€ю€ю€щьюэ€€€ща’÷…Ї£Нyh\VQKIBA?===>><>@?>:::87678530.,.-+'$$"!%%&#%&%&&$''+4>NoХ∞р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Пb_`l§∆•tkigb]ZWWVe•н€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€ѕЗlkgghjhijihkx~xП…ё—КXRTUVXYY[[ZZ[^^]_`_`^^___][\\[[Z[[[ZYWXXWWVXWWVUVUUTTVVRSTUVVVUWUXXVWWUUUXXTTRQRTPRNLONIJKHDC@@B@?;<9457;;77797:::9669:88;;8;9:<<<::;::;<;7:8257:9975359:=>?AACCEA@ACC@@=743-&# #!        #&&()))'&#$#! +6AKZДµќ†g`\[VQTRNMN5 "'$"+=gРё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒ^Nt™єИe[XXVSQTUTJHPTДЎь€юы€ьэьъэ€юььюскивбЎЋ±ЫВpe\WPJGA?>=@>>?>@=<987566762/,,,**('%"&''&&'%&&'('('*,4>R~Чћ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыПa_`q¶«Ђwkhhd[YZWVj™лю€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€юю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъь€€€ю Зlligihhhhhjls~yТ ё“ИZSUVVYYYYZ[[]_^^__`b^_`_`^\^\\\Y[ZYYYXZZXXWXXVUTTUTUSQUUUUXUVXVUTWXTWUVWWUTUUUVTRQQPPQOKNMIGFEDC@>?<::;;>=88959:999635898;;<;:;<=;9;;;989;9::957:855434689=@?CB?@B>>@DDACB><8/+&%$#!      "#&')('*($!#"  *2>?><:::8676610/,.,-,,)()**&''((()('(+,),*/7DaЕҐа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЙ^abuђћ±zkkh`[XXWXm≤у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€эю€э€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€ЋЙpkkiggigjjkkmx}Чћв‘КYUUTWZ[ZZ\[[]^_^`^_b_^^^_^^^^\[[\\YZZZ[ZYYWXXWTTRUTUVSTWWXVUUZYWUVXVWVXWVUXWXUTTVUTSRRPPRLKKHGHIFC@B@><9:><9:9;:8>;57958:8:><8<==::<:::9779:<;763444422699<=>@=;=A??CCCBCCCB@820-)%#        #$%&))+)'$$$" )0=JZyЃƒ†f^_\TRSRLNR7 #$+@lФи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѓWOp™іЕd\YYTQRTTRKIMSНиыь€€ыю€ьъюю€ю€ю€€€ющыурџ“–ЋЄ°Кvg^VQOGBBB?@>=:;<988741/0//.-..+*-,.+))(*))()+.-,+(**-454;98678::::757:<8861023324477:8:99:==?@C@@AB@@CB>;<84,*% "  #&(())*''&$"!!  "*2:;<889853110///.0-.-./.*,,--,.+-.--,,,,*,005BX|Ш’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лГaab~і’ѓykhf`[XWUX~ќы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€юэ€€€€€€€€€€€ю€€€€€€€€€€€эю€€€€€€€€€€ю€€€€€€€€∆Еrpmlmkjllihgio}Ш–дЎП]WTTVXXWYY\\\]__^[^aa_]\^^[^]^\[\^ZZ[[XXXWYWXWXVWWVUUTVVUUWWVVUUUWVVWWVUVUWYWVVVUSUVSSUSQONMMMNMJIKFDFBCDB=<=<;:846;:5664669779856:7:889569;;87540344/323485877:<;>@>>A?B?>AA@?A@=74-)&"!!7.  #%)****(&%##" ""    )3;K\ЙЈ °f]\\TRRQNMO4""$!!"#%0JxЯ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€§TQtЂґЕdZZ[YRRRSPOLNTМаы€€€€э€€€ыю€€эю€щээшъэщ€цуэшнд÷ њЂЦ}n^VSMIE?<<:889654222020./.10/..,-/120.-,.-,+-.-.--,-06:IeН™р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€бБ_^cВ±ѕЂyjhfaYXWV\ИЎэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€юэ€€€€€€€€≈ЕqmkknmkijhgfiltУќгЎР^UUUVYZXZZ[[[]_`^^`_^^^\^_\^]\[Z[_\ZYYYXXWZXYYZWVXWVWVVUVTVVWVWVWWWWWUVUVVXYXXWUUVVTVTRSSOPQSSRPMKHJJICCGDA>=;987;::9:87985374596678879=:9;;::7565665232254367337;=?<<@?A@?A@@?@@@@=841)(%!  ,+% "%%&&')(()%$%$"! !!  )1=K\ЗєЋҐg[]\UPROKNQ7  !"#%)+6O{≥€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ІSOtђґВbYYXUTRRSSKIOTОд€€€€€ыэ€€щэ€€€€€юю€€ьэьы€цчыющк№ё‘»є§ЛueZTPGA?;975234435560//./2301200377121200/./.+.,.-/1.08HYyУ¬ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—{`afИґ√Ъujjd`YWXX_Тв€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€юю€€ю€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€юю€€ю≈ЕonmnmjkljjjghloОќе’Л]TVVWY[Z[[[\]\^^_`_]^_`]]___]]\Z[]]ZYYXYYYZYXYYXWXXWVWVUWUUWWUVVWWWVVUTVXWXYXWVUWWVUVTSRTSRRSRQRPPNMMLJCGJDBA;8<>=<967:95642435546734889<;9::989868847443645642049:;<<<>@@?@@A@A>@BA?;:82-*'#"! !  !-  !!  !#$&&*(%'&%&'#!"!  )4;M]Жїќ°i^]\SMNNOMN9$ !"&%(+7UБј€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€§WRvЃ±Аd\ZYWVSSSSPKMUФЏь€€€€ю€€юьэ€€€€€€€€€€юэыюэъьшюьцщкггЎ√≤ЫГm]RLGC>740/2133430212/2324763577987565730/././100.,.29CMa{Фћэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ўАabeЗµµКpljd]YXYXb°р€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€ью€€€«ЕplllkjjlkjkjijkТѕд’Н]UWVWX[ZY[[]^]\[]_^^_a`\]^\]__^[[[\\[XWZWXYWWYXVWWYXWXWXVUVXWVTRTWWVVTUXYYXXWWVVWXVURSUUWURTTONRPNMNMONINMEBB?==??<==<989687454455763369:9:<::<:9:9:566763442//24337:;:;=<>@=@BA>A@@>=<==:7/+(&$""  $ # !"#! #%%&&&&)(&&(&&'#!!   (3=NZГєѕ£i^^[RNNNNQQ;&#%$"&*0?[ќ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€£SSzЂ±Аd\ZYUUSTSQMHNTЦл€€€€€€ю€€€€€€€€€€€ю€€€€€€€эючюю€€€щэу÷“ЋЇ£МyeVOE=93.-.///-.04436123685968=997998:852354135/--/016=?>=:;<:98510123365459;97;;;;<=>;9;:6:7542//0//1007:99:9:>>;>@A?@@A@><JYВєѕ°f]^[QPOOPTQ:(''(+1AfМе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€°UT~ЃґБd\ZWUUUTTPJGMTХк€€юю€€€€€€€ю€€€€€юэ€€€€€э€ыэ€€эыюююэъё—‘џЏѕє°Иq]LC=91.0/-//-102436346456989;;<<;>>:99;96541/010-2227?FPhГ§й€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µq_``|Ґ≤Лnkic]YWVY{ћшю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€юю€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юƒЖtpnnmlnmjijkkkkТќж‘З\VUUVXZZZ[YZ[\]^^^^]]`^]\]^_a_^]\Z[ZY[YWXXXYXXWWYXWZXWWWXWVUTWXWXWYWXZXZYWYYXYZWWWWWVVVXVVVTSRSSSUTQRRPRVQNKECBAB@A>>=>@<:99533366225779669:<;9:==:A?A?>=<;:<>;437632104510277>JYoВ®л€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ч`]ab{ЫЯАnje_[XWXZКџь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€ю€ю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю√ЖrpnnomnnlklkmnlТќг‘Й]WWWXYZZ\\YZ]]^]___^^^_^^___`_^^][Z[ZYYXYXXWVXYYYYWXXXUWYYVWYYWXXVXXYXXVWWXXXXXXXXVUWWVVXXVTTTTTVWSRUTSRVPOPJGDCAB@>@A@@<;9:675453365555347:899::><=A@=<:7798311002//1313559:<::AADEA=>??>??<;;79825964534626:>L\tКјф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фЕZ]ac}ХОwmhc]ZWWY]Шй€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€юю€€ю€€ю€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€ьюхјЖsooopmnonljkkljСЌа–Л\UWYWVZ[\[[[[]\[\_^^]]^^^_^^]]]\^[Z\ZZYXXVWXX[[XXXXWWYWVWXXYYXWVXWYWWXWXXWXZYYXXWXXXWWWXWWUUUVSUUVVTSRROQQQOMIDFCDC@AB??=:;::994334244114167569::;<=?><;;;;;:40/233-,00.0355:878:<:>??==:;:631.*'$$"   " !!3%!   "$"#$%&)&%'%#%%###&%$##$##"!   !24-(! #+3;LYБЇћЮh`a[SOPPPRZOIhѓш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЫTUБ≥єГc\[YXXVUVSPMNX°с€ю€ю€юэю€€€ююью€€€€эюю€€€€€€€€€€ююьэ€эь€€ъьюэч№„аЏ»Ї§ЗbMB>5550.03477669<=;<>B@CCBAAAA??@>>=8::57:8754585653:>HTaxОќы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒo[]_cРГsmhb\YVWWh∞у€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ю€ю€€€€€ю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€пЊДrqoopmpomlkijijСЌяѕЛZSUWVVYZ[[]ZY\][]]\]]]^_]_]^^\[]][\[YZYYXYWWXYYXWWXXWXZWUVWVVWWWWWYXVWXXWYXYZ\XVWYZZYXXXWVTVVWTTVVVURSRSSRPONIHHGKIEDJEDB?=<;88634334311377535678878<::;;>@@==?>=>;;>;=<8551/)&"!     ""## 2!    !!!!!"%%#&''&&$&%'%#%'&"!#$!#%$" ! !! !  +51/(! "'+1?M[ЕЉќЪgaa[SSPLOP]mЪу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЧTVБ∞µГe]\ZWVTSSQLJLWҐр€€ьыю€€€ю€€ьэ€€эюэ€ююью€€€€€€€€€€€€€ю€€€€ьюъююнпщтяЏЏ»©ПvbLA9885226456;:;<=>@@CDCBBBCCDC@>=>><:;<;9846:7875558=@JU`vЙ≈уьью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьХ^\_`e}ХДolg`\YWXWzћч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ю€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ьэ€элЉЖsrrnnmnnlkjkkjkТћяќИYSUVVVYYZZZ[ZZ^]^]\\\\^_^__^^\\]^][\[XY[YXXWXXXWVVYXXXYWVWWUVVUWXXYXXX[YWXVX[\[YZZ[ZXZYWZXVUTTVVWVUUTTSSTTRRNNLKGIKGFHFDBAA=;:<5754631241467214425577:9:<>>;>?@977444/..0026427::<;97:<;8>>@=<=>>=<;<=<=><=<932-('&$$""    !"!!!  &-   % !!!#'((('**)''((&###$%"!#&#!!#!"#!! ! *;A6) !""#',2=N]ЕЊ–Ьf^_[SPOQPWk“€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЧSYђ±Аc\YZYWUUTRLKM[Ґр€€ыьюэ€€€€€юю€ю€€ю€€€€€€€€€€€€€€эь€€ю€€юэю€эьюью€ьтохсџ їђЯЗpYG@;;767777::<;=?AA?=<<=<<:88:9:<9:>CJXguЙ…чыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–uY]_bn}К|nkd_[XXY[К№ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€ю€€эзЇЖtssonmmmkklmlnoШ–вќЙZTTVTUWYZYY[Z[^]^^\[[]^]]_^^]]\[^]Z[\YY[\XWWXYWWVWXYYWWWWWYWUVVXXYZXYZYZYYXYY\ZY\Y[[WZZYYXVTUUWWWWUVTWURTTTRQONQMJJIGEHFABA@=>>987841102244742400189498:87<=<>@<<;9652..01235349:96557;;:9:><<==?><>=A>:===><9;98410-*)(#"#$"""  !  .*! !! !!" !$$%&()*+,***+*&%%&$$""#%# !"  !  !+:;4'  !" "$#&*,2=Q\Аї“Яh__ZRPQQVYtз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЪUZ~©©}c\\[YXVVVSNNNY≥ч€€юю€€€юэю€€€юээюю€ьэ€эю€€€€€€€€ьъю€€э€юээю€€€€ююъэыюьпкяваќљ£ЕiRGB?;8:::9;==?>ACDCCBAGDBGECDCCECDGAABBA?><;;;==:::;>BGMVex£гщы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€§_Y\_gwА~rnke^\YXYbЭк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эюуЊИtqoommnllkhkmlnШ“бќК[SSUTTWYXYYY[]]\\\Z[[\^\]_]^^][[]\Z[\[[ZZXXYXYXWWWWYXXWUWWUUVWUWXXZZY[[[ZXYZZ\]Y[]]ZYXXYXYXUVWVXXUWVUWYTUTSRQNMOSOIKJJHFECBC?@?::9;:73264325121/0126567757<<7663..201862573/36689966;87;;<>>=>@>:;==<:;<=>=:98463.-,,+'$#!! " !!""#"! "!! $04+"! ! ""! !$#$%%$%''()((++,,----,)'&''"""!!! #" ! '581+" #$$$%&&)*+4>@AA@CCFFDHFEHIHGFGJHIIDCEGGCDC?>;<>>>;=<=84842462/111124314338;<<::<=<>::986110152/12103446544697488:==:;<:9;:;;;<;;;:;;:9;:;:79521/./,*+*+'$&%$"#%$$#!$ ## !!!")'!#$%$%'%&'')()*+,++--,-,--,0-*,,*,++(%$#"""! $8<94)""%&%(()-0-/CGFHGFFHIIEGKQNIJIHGIHIIHEA??>=<;<=?;=>=;735670/012224411/136:978:<=><<;<=824344101114205521565799;:88=::8789<;99999:;8:<99::<<7899:76984340--+..+++))(),)'()**'$)(&&%(*,/...-/./030/././-.---,+,**,)('&&&#" "#" # ! $1BD6( ! !#%(%(*'&04.0>R^~µ»Щe``[SPOQSUzи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ХSZАіі~b\\ZZXY[URPMN_Љщээшщъьэээ€€€€€€€€€юьыю€€€€€юью€ьэю€ээээю€€€€€€€эь€ю€юээ€ьььэээфыня„Ћї•ИmXJGIJKHFEBAAFEDDBDGIGHIJPKMOKJMLLJNJGIHFC@><=@B@?<=@AEHMUbsФяфы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дЕZXY[cwАЖ|nhd_]ZYY^Рџэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€ю€€€€€€€€€€€€€€€€€ю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€ютљЖutqppponmmmjmnmШЌ№≈YSTVWVWY[Z[[]__][[]]^_^^_^_^\[\^^]\[XZ\\YXXYZYXWWXXYZYWZYVXWVXXWYZZYX\ZZ[ZZXX\[XZYZ\ZZYXYZZXVVVXWWVTTWUVWVTTTVUVQLMNLOLHKJHDECBDDA?A=<<;;:783121112145221/13457::;==@>>>;877575220/41055236349:9:99:;<;89;98:847868;;:;687;;<<::<<<<====;<;75674677631332121011//.-.002655435233540/1/.,-++)(*+(*)&%$%$$# !#"!! ":KB5) $!#$(,.11,+12,0?R^≤«Ыh]_[PNQSRTxе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЪUZ~≥µ~a\^[YYZZWSNMN`µш€эььюэю€ю€€€€€€€€€ююьюю€€€€€ээюээ€юыью€€€юю€€€€€юэ€€ю€ююьэюю€€ю€ъчиўбя ґЯАeXSSSPKHFEEEGBCGFFFGHJLNMQRNOSRNOOKIJKFBABBBD@@@@A@CA?ELT]oВЊнхы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞gUW[[h|}zslhc_][ZWe•з€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ю€€€€€€€€€€ю€€€€€€€€€€ю€ю€€€€€€ю€€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€цкїЖvspoonoonnlloklШѕЁ»БXTUWWXXXZY\[\\\]]\[\^_^]^``]]\]]]\ZZ[\]\[YXYZYXXYYXXYYXZYWWWYZYWY[\[Z[Y[\[[Z[[ZYZYZ]\\[ZZ[ZXWWWWVVUUWVVUVVSSUWRROOQNONNKMKHIIEEEDEBA@??=?=<8673132201233324135697:;:>>;;<::954323100/.1002114579658;:;;8:94266576457:99777:;7879;<>>?@@>;;::99;;:;::53465543326543034686;>;97420120..,+)))**&$'&'&%#!!$$" ""  *<=;9;6552-/023/320132142588998:<=<<811520//...-./.011455348888678566526534686665777432576:<>?=?>;:@>9=<;:;:;;867858967475224999BIF@651.--/.,-,('**(&&&&'(%%%"#!!"+BQL>0# !!$&%(,-1CHJS\euЪ„мц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вХcTWY[h{}{qifb`\ZYX\Л÷э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ю€€€€€ю€€€€€€юээ€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьюю€оєЕtpnrolnpmmmlonmШ—дћГYUQTWVWZYXXZ\\[\[[Z]\[\\]^]]]]]]_\Y[\]]ZYY[[ZYXXXWVWYWY[ZYXWXXYZZ[[[[[ZZ][[[[[[\[ZZZ[][YXXXWVXXUWXUTTVTVUUUSTSSSUSRSRPOPONLMLJMHJMJJMLIEB?AA>;:;9412232011./0/0//145676<=>><:54621/21/0.-100//2412368:86898566443246757745886362003359;9:<<:;::;<::==;9:7689:964573368756;@A41----,-++,,((('&''&'&&&%#! #" /DQO?/"!! $&&'+/249?IUOD4*->S[ЕЇ»Цf[[Z\^WRSUxе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ШU^ЗЈђyb^][ZYXUUULKQhјъ€эю€€€€€€ю€€€€€€€€юью€€юююю€€€ью€ьэыь€€€€€ээ€ю€юээ€юююю€€€€€юю€€эю€€€ю€€ь€йотЏќЅІОzj_ZYUPNIDFCHJIKLMLKMPQRTSUWXWWVUTUSSOLHEECCBA@ACB@?>AGLT\dvЂвпш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рѓqWSVZbБТЛykigc]YYYVd•к€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€юю€€€ю€€€€юююьэю€€€€€€€€€€€€ю€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юнЇИupmmopomnmnmnnnХќгЌЕZUTVVVWYYXWX\^\]^\Z[[[\^]^_^^]]\]ZYYZ[ZZZYY[[YWVWXWWZXZYYZ[Z[[[ZYY[[ZZ]^][ZYY\^^\ZXXZZYZZYXXXWXXWWXWVVUUUVUTVUTSUURSSSRQMLNMKJKJLMMOOLMJHIFB?><>?:785523/////.10./45466:<<>;:;9555241//.-11///0312346988989877632796767776754333/011167837;:88;9:;7889:96867635663004671.242/1/---**)'((+)&&%%%&)%$'&$!!"$! *@PM>/! ##$$&++/4669?BKNI6*.?QZї Хe\]ZUVTRPUyе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЮV\Иґ∞~c]^^[ZXUSTPMOgЊч€ю€€€€€€€€€€€€€€€€ююю€€эы€эююээю€юююьэю€€€ьэюьююьы€эю€€€€ю€€€€€€ээ€€ю€€€ээщээсцхмЎј•Мwf^YVPKIEGGFGHIKLMOQSRSSWYXYZUSUVVTQOOOLIHFDABAA?@><>DKPW^jВєгнэь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∆|ZRSY\}≤їФohjf_\YZ[Vqƒъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€ю€€ю€юю€ю€€ю€€€юю€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оЇЕronmnoommnmnoomУЌаЋЕWSVWVVWXZYXX\^^^^\Z[\\\]^`_^^]\\\Z\\ZZZZYXX[\[XXXXXWY[[ZXY\[\[[YZ\\[[[^`\Z[ZYZ]^[\[[Z[ZZYYWXWXYXYYYWVVTSUUUVVSSRPTTRSRRNMMNLONLLMKKLMMJHHJIFEDBBB?=<9764221///00.12432146:;99;;77875212/.//-../00211256488659988888:9::444485311321113663996659:984743643765310000..046300-------*))(&'()*)'&&&%'%"$%%$!!$! +9DF;*! ##%&(*02687:=CFLYpZ50AR[~Ї≈Пc]`]RPTRPSxв€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЪU_Иµ∞}c^\]ZXXVTROPPiљц€€€€€€€€€€€€€€€€€€€€€€€€эюю€юю€ээ€ю€ээю€ююю€€э€эью€ю€€€€€€€€€€€€€€€юю€ю€€€€€юю€€€ъфн–Њ§Жpb[VPLJGHDDKJJLORRSSSVXZZWWZVVWUTUTRSOPLKHFECB@BA@@BDHJP[anЙћ–връ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф”Р_STUWfІЎ∆Зhhid][ZZZXИџ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€ю€€€€€€€€€€ю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъљГromnqqomonnnonoФћа ГWSTVWUUX[ZZY[\^]^][]][]]]`_]^_^[]^]]\\]Z[ZXY\\[ZYYYYXZZ[YZ\ZY[ZZZ]]]\]][Z\[[[\\[\]][Z\ZWXXYYVWXZ[YXUVVVUWVSTTSRRRRSSRQSROOPPOPONMILLMPLHHILMMKHEBCB?:98666300122.0020/,/3789889778885351.-..,-/.-00/355466257968889;9678755886214531555678657878975754212333//11..//./0///,,+,,++)(**('((())'')($!"%$$$ "#! 7CG=4* "#%'%$'/059;>=@FN]uЪґБA4>QZzіЅМa]_[SQROPV{г€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ШU_Зі≤Аd_\\YXZXVTONOkƒь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юю€€€юьыэ€€€юью€€€€€€€€€ю€€ю€ьыю€эьэю€ээ€€ююю€€€€€ычм“ЇЪ~j^VQHCBCECHNPQSRRUVTUVUXZWUUWWWWUSTUQPOMIDED@BC??@ABEKMT^dxН£Ћкпэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тЊЕbTTVVUj©ЅЪrhgfb^\Z[W^Ѓт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€ю€€€€€€€€€€ю€€€€ю€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыэю€шїАqrqpoomoqmlmppoЦЌя«БXTUUVVXXZ[[[[\][[]^^]]^^^^\\\]][]][]]]\Z[ZYY[\[YZZZ[[YXY[ZZYY\[YY\]\[]^[ZZZ[\[[[[^^[[\\YYYYXXWWZZXWWVWXXVTTTUTRSVUSSSSSSQNNQPQQQROMNMPNMMKPQPMNJFEB@?<78773242020.00/0./12488579467;742..//---./../.111434458678:99::68:8726975464/35544464666:75687432134310/0/.,/0000.++-+)+))(')))*(&('%%%&&%%%##"!!! ! +?M?6'!#$''(*+)+18=>=AJUeА†ї ЋМF5BSYuѓњНb\_\SQSRPV|г€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ШT]Е±±Бea^[[ZXXWRKKPm≈ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьью€€€эю€€€€€€юэю€€€€эюыэээюэю€эьшъэ€ю€€юэю€€€эъхаЌђНl[OJGAADIOQPQRRSTUTUUVWXVWZZYXWWUUWSSSMIJIHC????A@=?BGLPXbqВФ•‘нсэ€€€€€€€€€€€€€€€€€€€€€€€эюъкіz[SRSUWXe}oiheda]ZY[VqЌю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€ю€ю€сЇВtutrqpnnpmlornmШ–д БXUVVWVXYY[Z[\\\[[]_`__]\]\[]\[[Z[][[\\ZZ\[Y[[ZYYZYYYYYYYZYXYY]]ZZZ\[\[]]\ZX\\\[Z[\ZZ\[[ZYY[[YYWWYXVVVXWWWUSSVRSRTTSQSTTQSRQNNPOLQXVMLONQRPQRPNOOKHEDAA?:9:536300321-/00/0012646626565300000..../..,,-1/015468668967:<8;:774676967424465215743675765763124420..1//0.---./-*,-+*&')%'&%((%&(%##%&$$%#! #!!  /;>:0#  $%&))*+--/4;?@FNfЖІЉ»ќќќПG6DT[u™љКb^a[QOORSTxг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЧV`Е±≤Аc`_[ZYWWVONPPp∆ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€юю€€€€€€€€€€€€юью€€€€юююььэю€€€ээыью€€€€€ю€€ыю€э€эъмџ≤Рt_NCDJRSRRQRQQQTUUVWVVXZZZZYXXWWWUTUTROKKEAA?>??==;?@AGOU]iuДЪђ„мх€€€€€€€€€€€€€€€€€€€€ырз–£nRLOSSU\^acddhgdc_[ZYYXЛя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€ю€€€ю€€ю€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьыпїВrssssqopqolnsmlШ—еќДZUWWXWXYYZZY\^^\^]]`a^\\[]\^^[\Z[]\[]]ZZ[[XZZZZYYXXZYZYZYXX[Z[[[YY[\\[Z[^[Z\^]ZY[\ZZ\[[ZYY\\ZZZYYXYYWVVWXXWUUSRSWUTSTUSRRRTRRQPMMVZOKOQSRSTRQSSRPONLFDEA>>:8;8426530..11431/34331443330110.///.--.---.-0./245636668:;:::9867778777853667765457746753651110100/////.-,-..-,+**)&%('&&)(&&%&&#!$&%"## !   !4@?7+""#'((++.//489?CI_Ь‘мхчцчщ№ОI7DS[v©љМb[^\QMOQRRuя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЫV_Е≥µГd]]\ZYWVTQOORp≈ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€ьэ€ъъююэ€€юыэ€ьэ€€€€€€€ю€ю€ю€€€ъмЏЊ§ДgWUYYWTUVTSRSRSTTUXWXXXX[Z[\XVVVYWRRSOLJGDBB?;>=<><=ACHPVblyЛ†Љбоф€€€€€€€€€€€€€€€€у№ќѓЗaLIKNQ[e`^_affgda`][\[Vd∞с€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€ю€€€€€€€ю€€ю€€€€€ю€ююю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€пЇДrsrqqpmoqonppmnЦћбќЗ[UVXXXYYY[ZZ[]__`_]`a^^]]_^^^[[[^^][\]\[YYX[[XYYXZZ[Z[Z[ZXXZ[[\[[[[[Z\Z\^][Z\]\\\\][\^[YYZZ[ZWXZZWXXYXVXZWWXURSUTTUTTTSSRRUSSTRORRPPNOPQPRSPPRTSQSRPNHGEDA>>>>:873420./054//02122253211211///00---,,,++...13433699:::;:;<<:7996699676649:8:855796754441013311/-.--,,,+-.*)+*)(('&'''(('$"%&$"$#"$""! "! 8HC9,"$&)+-+./.377;DL_Ь÷пэ€€€ю€€ёПG4EV\z©іИd_^[RMORRTvя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ШUaЕ∞ѓ}c^]\[XVWUQOPQo«ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэюээ€€ю€€€эююэю€€€€€€эю€эю€€€€€юэмџ“ЇЪАqb`a^[[XUVVTSTUYXUVXYYZ[[ZWXYXXVTUTSNOMHEB?@?>?>?>=>CGLU\drРҐЈџмь€€€€€€€€€€€сяЈЯКfMCFINRlВya[^adeeb`_\\]YYГ—щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€ю€€€€€€€€€€€€€ю€юююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лЈЖtqqrqqpppnnoonoФ…аЋЖ[UVVXXYYZZZ[\\^_a`^aa_]___`^^]]\^^]\\\[YYXX[ZZZZ[YYY[ZY[[ZZZZ[[YZ\\[[][\]]\ZZ\[[\[]\[\Z[\[[[\[ZXY[ZWXXXWXYXXUSSUVTUUTSTVUSQRQSSPRPPOOROPPPRSRSRQQSSSRNKJHDCAA@><:7620//13201/00033211133//120.0/.,,+,,-,**,/00237:::<::;;99;75678878757;88869946:856652/0620/.0/,++*)'**')*)))(((&%%&&$%&%$$" !"!!" ! ! &0>H>*#&**+.-.0257<>Je†÷сэ€€€€€€€€ЁПI7GW_w¶µЗb__ZTRRSQSwя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЦS`И±™|d^[\ZXVVSPPRPs–ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€ю€€€€€юю€юю€€€€€€€€€€€€€€€€€€€€€юьъьхв‘єЬЗwjbdc`\YWXXYZYYXXXYZYZYZXXZ[ZZXVUTTRNKHFEAABBAA<<@?BFIMSZajtЗ§…аелмммнкйдѕ£~l]L@?ADGMj°Яs^_`dgeca`_[[^Yj≠мю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ю€€€€€€ю€€€€€€ю€€€€€€€€€ю€€€€€юю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЈЕvtqrrrssrpmnnloЦ я И\UVWYXX[[[\[\[\]`_^`a^]_```]^]^^^]\\[[]ZZ[ZY[ZZ[ZYXZ[YXXY\[Z[YZZYY[]\\^]]]\[[Z[[\]]][YXZ[XY[]\[[Z[[YXXXUWZWVUUTSSSUTSWTSUSQRSRRSSRQOPOQQPORRRTUQQTTSTRNKLIGGIE@>;;8321011/01/./0230034530.01/-0...+,-,*****+,,-/27;:;:<;89:9679789788559:978865565324430-8510////,+--*(&')'&&%&&'('&%#"#&%""" $& !! "6F=3+ !'*..-35459<@JcІўт€€€€€€€€€€€џОI8HW_z™ЄЗb\^YQNRTQSyа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€УTcМµЂya_]\\XUUTQLLPv‘€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ыь€€юю€€€€€€€€€€€€€€€€€ю€€ю€€€юыуи“≥Хspomc_`\[[ZYZYXXXYZZYXXYZXZYWVVVVUQOOKGFEB@@>>>;>>;=CFGLR[mryДУШЬЯЬТМАiVGA=<>QkqbTsТd^_`bedda^][\\`ПЎэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ю€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щЇГutrsrqqqrommlnpШЌя…ЕZVWXXVY^\[\[[\]^^]^``__^^__]]\\]_^\[[\_]\\ZYZZ[YWXY[[ZYWZ[ZZ[[[[XY\[[Z]]\[\^\Z[\\]]\[ZZ[Y[]\\[[[[[ZYZZWUYYWWWVUVTTUTSTSTSSTUURRTSSRPONOQQRSQRUUTRSTTTSPOPMJKKIE@<<;85320001/021/023344441/00//2311,+,,)(*)')++*-/08:;:==:;:98998:<87897889798:;95233332102100/./.-/.,'''('&'$$''&'('$"&%$"$" %% ##$4=>5& #$#(,11158:;>Kc•ўх€€€€€€€€€€€€€ьЭE7GV^|ЂЈЙb\^[SOQTQT|б€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЧUgСЈ™{c`_\ZXVVUSMLPw’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€юъэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€юээыэ€€€€€юэцжѕЃХКВxqkfa_]ZZ[ZXWZZYYXXXXXYXXXXWXXUTUSNLGDEEA??>=<:;?>=?ACEHIHKQVWTOHEEB<=?@E~Љ≈Чa]c_`a__abac^\\]]\јф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сµБtrrrropppnnmnooЩѕаƒ~VUWWVW\^[Z[[\^^^]]^aaa__^^___][^_^][\]`^]\Z[ZZZXZYZ\[ZZZ[ZXYYZZZYZ\\[ZZ\_]^_\]\[\][Z]\\\[]a][[[[Z[[[XYYWYXXWWVWXVVUTUTUSRUUSSTTRQQRRPOPRRRRRSSRUSRSTSSRRSQONMKIE@?>=96344441252//23310151//010143/.,,-+))()(*+((-/1698;<;;:<:9:::9899:99:99867:8876303212200//.0/--.)'((&&)'$&'&&%%&%#%&%#"$"!! " $.=B4" #$"'*,/467:;?G]А∆х€€€€€€€€€€€€€€€эЫE5GW^ѓЊРc]^[SOQQORБв€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ШTeТґІyc`_]XWXWURMNPy„€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€юъэ€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьюю€€€€€ээ€€юэт№¬≠ЪЙ~wrlgb_^[YXYXYYYXXZYYZZYZZ[][YYWSQMJIHEB?AA>==><=>><>A?=<>?>DJGGGCA@BENЩЏ√КcY\^abbabaa`\\]^Yk©ею€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€ю€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€к±БtsrqpqrpooonooqЩ–б¬WSUVVY]]Z[\[\_`__^_ab``^^^]^`_\]_^]]]]]]^\Z[[[YYYY\[ZYY[[XXZ[[YZZ[[^_[Y]_\]]^\[Y[\[[\[Z\\[Z[\Z\]\]\[Z\ZWYZYXWUVYZWUTUUXUTUVTSSTTTQRRRQQSSPQSSPRUSRUUTTSRSSSQOMOLGEA@>:776623531001100121///0/////-.-,-**+*('((')+,02327;;<:::8999:56987899;;8986867302330//////.+(*2+%%%%&%%&&&%%%&'%"#"$$$#!  +485,$!!"$&%(-048:<@K]Э“иъ€€€€€€€€€€€€€€€€€ЮG7GX^z•ЈНb[^[RQRONT|я€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЧXjЩљІxec`\ZYXVVQNPRА№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ю€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьыэ€€юьхџљІЧКuqlgb]]\[[[[ZY[YWYZXZ[\]][YYYVSQOQNHFGFCDB>?>=?>>@A@@AEFKOMKFDBAEJMxЬ{^]aba_bb`__a^Z[]\dФ÷ъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€ю€€€€€€€€€€€ююю€€€€€€€€€€€€€€€€€€€€€€€эи±БrstsqqpqpponnoqЬ“г«~XUTVYY[\\\\[[_`aa`_aa_`]\^]\`_\]^\\^^]\[\[Z[[[[YXY\ZZZZYXYYYZYZZYYZ\]\YZ[Z\_^[[\_^[\][XZ\\[\]\\[[\\\Y[ZXZ[ZZZXVWWUTSSUWUTUWUTUTTUTQQSRSSPORSRQSTSSTVUSTURQSRNMRRMJFE@<<;6666644401110021..00/........-/+)('''&&''*+,/056:<:;;67877649878;;978689854201420///--/-(%'+*%$#%&$#$$$&&$%&#"# !!  %3B?5( !#%''(*.46:AKn™‘с€€€€€€€€€€€€€€€€€€€€£H9GX_z†ѓКc[^ZQQPMMRЗе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьФZkЧї£ucb_]\ZXWWSQPRБб€юю€€€€€€ю€€€€ю€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ю€€эшйўљ£СЖ|vrkd``^\\]\Z[[ZYZZZ[\[ZZZZWVUUWTQRRPMMKCBC@=>@BBA@BHJJJHFDCABGKMS[Z[]_bdaa`_^^^_`_[_Й ц€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€эълґДuutssqoqqnmopoqЮ“д АVVWWXY\]\[[[\^`baaa___^]]^]]_^^_^\\]\\][YYXXZ\[XYYZZ[[[ZXWWXYZZYYXX[\\Z[[\[Z\]\\__]\]\YY[\]\\[\\[ZZ[[YYZYZYWXWWXXVVVSTVVVUTUUTSUUTSTUTUTQORSRRTSSRSUVSTURQRRPNPRPMKGCA??::=;988731320/0/--.-./.-./110.0.+)())'%#%))*+-037;;:::79;97898998::6478976423340./.---+)'%$%(#$&""%%"$&%%$"#"## "!  !!,AK?)!#$$&)++,/38;:9623321/.-.-,,,-.-/21////-+++*&'$%)''('+/069:789:<;;::;9;;<::98984136452.//-+*,+&%&$#%$"##$#$##$##""$# "!    .9><0 $)))*+.0257J|Єўх€€€€€€€€€€€€€€€€€€€€€€€€ІGQ\`Жµ√Хc\_ZROQROS|Ё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€иИZjСє•scb`_\YYVSPNNTЗб€€€эфшю€€эыыьюююю€ююю€ьъю€юэю€ю€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€ьчь€€€€ю€€эю€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€эче»∞ЮЙ}{vqh`__][YYZZZ[ZYZZZZXZZYUUXVUZZUSSRSRONMKJMJIKMMNMQRTWX[^__ababc`\[Zad^Yk†ўъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€м≤ВurqrqpqpprpqqquЯ’й ГXUWXYZZZ\^\[[\_bba```a``bd`]_a_^_^\\^\[\\\\[\\\[\\ZZ[ZZYZYXXZZ[Z[[ZZ\^_]^]^]\^]]]^_]\]]]]]]][[]]\]\[Z[[ZZZ[[[ZXYXXYXVXWUVWXXVTWXVUTTUWVVTTTSTSTSTTRSSSUUTTTRTSSUTTTQMJJGDBCD?=>=;9854320-./,*,,,.00.././/0//,**(''($$%%$$),/479:;97:<<=<<<;<=978636431.-+*(('(&"!"! ! !!###"!#""" " "!!!!+4=C5 !%%&(+03368CfҐ’щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€•E<=;;;:741-./-++,+,.,,03.--....-(('''%#"! #%(+0678:;:::<<=:::;;88755300-**)%$&$$###!   #$"!"!!"   (:A>6* "!$)*+,.37;HlІ’х€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€§E?R[`ЖЇ≈О`\^XQOQRQUАя€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ќu\iУљ≠ycd_[\\ZYWPOQUЖб€€юэ€ээ€€шщээьэ€€ю€€эю€€ющцььююьэ€€юю€€ю€фхэю€€€€€€€€€€€€€€€€€€€€€€€€эююю€€€юю€€€эью€€юээ€юю€юю€€юю€€€эщь€€€€ээ€€€€€€€€€€€€€€€€щм”Ї™ЩЗztogda]ZZ\ZYYZZ[__\[Z\[\[YWVVWURSTTSRSTRTSSUWWWXZ^]\^ab`^]^]\\\\^_pЩќф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююьэ€€€€юю€€ю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€фґБsqqsssqqpnnpqos§ЎдЅ}XVWXYZ[\\[[Z\^__bcaba^`bc`^^^_`_]\]_`^]]]^][[\][YY[[[[YYZZZZXXY[ZZ[\[Z[\\]]\[\\][]^\[\^^\\[\\[\[\[\][\\[Z[ZXY\ZYXUVXWVVVVWZYVTUWXWUTWWXVVVVVUUUTSQQTUTUUUVRRTVWUSSQOOONNJIFFFDA?==<;<84101/-,,-,+----/-,-,-.--*))))&$%""#$""%(,38:9<=<;;;99;;8564320/.,''& !!!##" !"%#"!! !!(1ETF- #$$&(),1338Ip™Ўц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€§GATZ_ЗїЉЖ_\^YNNQPOUВа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—w]jРЇ™xdea\[ZXXTQQPSЖя€€€ью€юэ€€€ыь€юююю€эыэ€€юээю€€€ыъю€юю€€ююпрыэ€€€€€€€€€€€€€€€€€€€€юэю€€€эю€€€юю€€€ээ€ююэээ€€€€€эю€юэ€€€€€€€ьъэюэъы€€€€€€юю€€€€€€€€€щн–∞ЭОЕ}tmga^]\\[Z[\^^]][]_`_]YXYYWVXXWVVVVVXWWY[\[[^^\^^^_^^\[\ZZ]^ay¶—сю€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ю€€юю€€€€юю€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€цЈВusrsrrqrrqooplq§џеїyXVYWY[\]^[\]]_`_``````_aba__^`a^]^^^a_]]]]\]]\]\[[[\[ZXXZ\YWWYZYXXZ[[\^^\\]]\]^__][[[\\\\[\\\^\[\]]]\]]\[\[YWXWWYYXXXXVVVY[YVVWWWWVUUUXWUVWWVTUVUSSTTTVVVVTTUVVTTUSOQURRPLIKIEGGBA?=;8:5231./.--,--*+-+*++-..,++,*('%"%#"$# $&*/4:;<><;:979:4473..,(%$$#  !  !! ## !   /BF><2#"%)**+/03:53342.-.-.-++-,*))-./.-.,+**'%$##"!"" "%(.27:;<97875531.,,)$"  !"! !!"! #.:KL:'""#%(*,/358H{±Ёь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€£HDV[cНЉЄВ__`XNMQNOWџ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќu\hОЄ¶t`_``]]YTTROPVПе€€ю€юэю€эыэ€€юэшы€€€€€€€€эьэююю€ьчы€€€€€ээ€€€€€юэ€€€€€€€€€€эюцш€юю€€€€€юэюэ€€€€эю€ээ€€ю€€€€€€€ээюю€€€€€юю€€€€юыью€юэ€€эьююэю€€€юю€€€€€€ык–Њ≠ЩЗ~wpkieaa`aa_^``^``][[]^^^\]^]]_`_a`^__]_]]^\[[][[[^bddmНњгх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююэю€€€€юю€€€юю€€€€€юю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юю€€€€€€€€€€€€€€€€€€€лѓАttsrssqqroopqoqЯ„й∆БZWWXZ[^]Z[[]\]`a_cecbaba`a_ab``__^^_^^___^\\]\YYY[ZZ[ZYZ[ZZZY[[YXYZZ[\[\\\]\]^\[]\]\[^``^_^]]^^^__\Z[\\\]]ZZXVXYVVXXVVXWWWWYYWVWWVVWVUWWXWXYWVUUWWWTTWURSTWVTTUUVTTUSRTQNOMKJKIIIFB@??=:84460.1/..---/-*()*,-----***))+(&#"#" !"#$'+2::951680**'%$  ! "+9@;2$"%%&)**+1;KЈбэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€£JGU[fУњєД_^`YLKQQQWЕа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќu^hТљ¶saa_^]\XVURQRVСз€€€€юю€эьью€ььююю€€€€юью€юьээю€юэыэ€€ээюээю€юю€ююю€€€€€юэьюэышы€€€эюэю€щь€эшщюээ€€€€€€€юю€€€€€€€€€€€€€€€юююю€эююэ€юьэ€юю€ююэю€€эю€€€€€€€€€чз–Ј£ФЗzrnmlifea^_____^_^[^`___`__`b_^__`a_^_^^\\\\\]`cgjwЫ∆мью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€ю€юю€€€€€€€€€€€юэ€€€€юью€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€н∞БsqrqqrqrrpqrqosЯўн∆YXXYZ[]\]^\^^^`aaccaaabc```aa_^_```^]]^`a]Z\][\\YZZ[[ZZYZYYZYZZYY[\Z[\[\]\\^^]][[[\\\]\\]^]\\_a_^^[[]][Z[[ZZXX[ZVWXYYWXWVWXYYXVVWVVXWVUVXXWXXVUXXVVUTUUTTTVVTSUUUVUUTTSRQOOPOLLLKHCACA>=;6650030--.-,.+)))))*,--+()-*)33'$$###$# !#'/355012*&%#""!$*4;:- !$%%(+,,.7IВЇж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э°KEW_kШјЄВ__`ZOLNMNWОе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћs_lЦЅ®scc`]^]ZXVQOPXШл€€€ю€€€ю€€юэью€€юю€€€ыцы€€€юэ€€ю€€€ьэьью€€€€юэ€юыыэьь€эюэьююэю€ющъщыюэюыы€юшъ€эью€€ьы€€ьэюэ€€€€€€€€€€€ю€юю€€€€€€ю€эыьэю€эчъ€€€юю€€€€€€€€€€€€€цЁ«≥ЪЗА|ztomhdcb_^^^_^[^_____`__`]^`a``^\^^^][\[]aehnВІѕоэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эъэ€€€€€€€юэю€ююю€€€€€€€€€€€€юэюю€€€ьэ€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€с≥Аttrqppqqrtrqqos†Ўл≈zVWWXZ\]]^^]_a`_`cb`ab``ca^````_^_``^^^]^_^\\][\\XXZ[[[[ZYY[\ZZZZ[[\ZZZ[\[\\\\\\[[[]^]\\\]^]\\^_^\[\\[Z[[[ZYYYYYXXXXYYXWWWYZZXXWVXXWWWXVVWXXWWYWYZXWVUUVWVUTUSSSSTVUVUTTSRSTSQOONKJHDBBBA><;84330-,,-,+++))+)()(****-.+-/+&&%%%#"!$*0./-())&!" $2=:/$ !!"%'(*,-.6MЖЉз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЂOGW_hРїЊК`_`XLINPQXНд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћp^lХЉ†p```a`\ZXTSRPX†с€€эьюьэ€€€€ю€€€€юю€ю€ышэ€€эъэ€€юэ€юыэ€€€€€ю€€ээюьыьэюэью€ю€ю€€€эцчэыьыэ€юющъ€€юэ€€€ээ€€э€юю€€€эююыыю€€эю€€€€€€€€€€эыэ€€€€юээю€€€ьэ€€€€€€юю€€€€€ън”є¶ЬЧОЕ~vqmjda_^^]^`__^]]_^]^\\_a_\[[\^]\^acddizТіўсэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цоъ€€€€€€€€юю€€ююююю€€€€€€€ююююэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€лЃАtttqprqprrqpqorЯ÷и∆}YXXYY[]]]]^`a``aabcccbbdbaa`a`_^^^`^__]]^_]\]]]ZWX[ZZ\ZYZYZ[[\_\ZYXYYZ\\[Z]^]]][Z[^^\[\Z^_\\]_^^^Z\][Z[\\ZZ[[ZYYZZYYZZYYXXYYWWXWUWXWWXWYYXWWZZXYZZXWVVWVVVVUSSSRUVUWWUUTTVWSRRQNMNMGDCDA>?><87533/-.+)****)(('%'('()*,,+**'('$#!!!!$+,*)+(### !*0393# !##%)))-/5SМљй€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѓTJX]dОЈЇНb]_YPNPPQYМг€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћsamТЈЮpaaa`^ZXWVQOPZЮп€€ююьшыю€юэ€€€€€ю€юэ€юь€юьшы€€ю€юэьююэю€€юэ€€ююю€ээююэью€юю€€€ю€ыы€юээю€ююыьюэ€€эюэю€юэ€€€€€€€€€ьью€€€€€€€€€€€€€€€€юэ€€€€€€юю€юэ€€€€юэ€€€€€€€€€€€€с„Ћ¬іђЯРЗБxqlhca``ba_]\\]]]\\\]_][\\\]\_dhghrКЂ«бч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€ээ€юю€юю€€юэ€€€ю€юю€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€кђtttrrsrrqooppnqЭ‘к»АYXZZZZ\]]]^`a_abaddcddcedccba_``^^^`___]]][\^^\[YZ[[[[YZ[YY[]^_[ZZZ[Z[[\\\]^^[[^\\]\[\]]]\\_`^]]\[\[Z\[Y[ZY[[YYZ[[Z[[YZZXWXZZZXYXXZYXXXYZYYXZZYYXYXVVVUVXWXWUTTUUVWXXWTSTUURQSSRSPKIJGDBA>>?=:85430-+**(()&&'%$%%%('(+--,,++*&&##! "'+,)&)&! "'173& !#%$%&(*)(,8RМƒп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€іYOY]dНЈЇЛa]]YRNMORYНд€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћn^pЩ¬Іrcc_][ZYWVTPMY•х€юююю€€€€эьэю€юэ€€юю€юю€ьшъэ€ъщэьъщэ€эъь€€€юю€€€юю€ээьь€€€юю€эююэ€€€€€€ьыэ€юююю€ю€юю€юю€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€эь€€€€€€€€€€€€€ээ€€€ю€юююэ€€€€€ътд’—»ЇђЯТЖ{upljiecc`]\[\]^]\]_^]^^^^_bdgpЗ¶¬№ошьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€юю€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€й≠БusttrrqpqpnppnrЮ’и«БXWYYZ[]^^^^_`abddddeefeedbccaabb`__`^^``^\\]^^][Z[[[\\ZZZZZ[[[\[\[[[ZZ\^]^^\]]]]]]\[]]\\\]\\]\\[[ZZ[Z[ZY\][ZZZ[[\\ZYXXYY[[YXZ[[[YXZYXY[ZYZZYYYZYXYYWXWWXXWXXYWUVVVWXVWVSSSSRRSSSSOKLNKGEDBAB?:8653/-,,*)((((&%%$#'(%',++-,,++)&$%!"#&-/-,(&&$ "".82&  "!"%'()*,,.:[РЅр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≤TLZ^eМЄЉИ__`ZOLNPRZСж€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€…o_mШ√§qdc`]ZYZXTSRP[©ч€юю€юэээюэююэюээю€ю€€юю€юю€€€ччээьыью€ыыюэээь€€€юю€ээыь€€€€эээ€ээ€€€€€€эыью€ю€€ыь€€€€ээ€€€€€€€€€€€€ээ€€€€€юю€€€€€€€€€€€€€€€€€€€€€€юэью€€юэююьыэю€€€€€эткйб„ћјѓЭСЙА{wsnmha`^]^___^_`__`_`bdoЖ£ƒямц€€ыъю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€юю€€€€€€€€€€€юю€€€€€€€€€€€€€€€м∞АtttsrqrrrrooqprЫ‘й»Г[XZZZ\^_]_``a`dffeedegfdcdecabcb`a`^^^^^_]\]^^]ZZ[[[Z[][Z[\[\\[Z[[[ZZ[]_\\\[]__]]^^\]\\^^^^\]\]][[ZZ[ZYX[[Z[ZYY[[[ZY[\ZYZ[ZZZ[\\ZXXXXZZZZYYZZZZYYXWXYZXXVUUVXXWVWXXWVVWVTTSUTRSRRPMPOMMIGGDEE>;;752.-.,***(&'%$&%%&'&$'++()+-.,)&&$*LV=,+(%(&   $,,+' !#&&&&()+-2>cЬЌт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€±UN]_gФњєД`^_[OLNPR\Ъл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћpaoЧЊЯnbb`]ZYYWTTVS]™щ€ююьъю€ъъ€€ьэюююю€€ю€€€юю€юэю€€ю€€€ьэ€€ъыэьюэюю€€€юю€юююъшьююю€€ээююыь€€юю€€юю€юю€€€€€ьэ€€€€€€эю€€€€€€€€€€эю€€€€€€€€€€€€€€юэ€€€€€€€€ю€€€€€€юэюэю€€€€ю€€€€ьыцнг’«є®ЫСКАzsjfcabbcc`ac``bcm}О•«ямшэ€€€юэю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€и™uvtssrrtsqpoqruЬ”ж∆Б[Z[[Z\^^^_`a`afhfedeeffdcdeb`aca_a`_^^^]]_][]]\Z[\[\\\^\ZZ[\^^\[Z[Z[ZZ]_\[[[]^^]\]__]\^^\]\]]\][Z[ZZYYZYZZZZ[ZXZYY[[YYZYYZZYZY[][YXYZ[Z[[ZZ[[[YXYYWVWXWVUTTTUWXWYYXWVVWVVTTUTTVSRRPONOPMKHFGHD?<8884../+*+('(%$%'&$#"#''(''*--..)&$;ssA-.,(%$$'&! !#$$&)+*,18BiЯ—ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЄVK\bjХ√їГab_YQMOOQ[Чл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЌpasЬ¬•q`^_a^ZYUTUVS]®х€ьыььэ€юью€€€эюьъэ€юэююю€€€юююю€€€€ээююьэ€юю€€юююю€юю€€юьшщэ€€€€юю€эюю€эю€€€ю€€€€€€€€€ышю€€€€€юю€€эю€€юэ€€€€€юэ€€€€€€€€€€€юю€€€юэ€€эю€ю€€€€€юю€€€€€€€€€€€€€ьы€эцпб“∆Ї©ЭРЕ{snigfgfjnnt~НҐЇ–дсчы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кђБwvtstttsrpoprsuЫ”е«ВY[\\\\^^^_`abefgebejgefdedccbaba``_^^^_``a_]^\\^]\[[][\\[[\^_]]]\ZZ\\[]]][[]^^\[]``^\]\]^\]]\[Z[[YZZXXYYYYYXYYYYWXZZY[[YYY[ZY[]]\YYYZZ[\ZZZ\[YYYYWVWXWUUUUTVVWVVYYWUVWWVVUUUUVWUSRQOMNNMLJHHDCC?<;9862..-,+)'%%&&%%##'(%&(('()-//.*Fn[8EM7*'# ""%&(,+,3Er•’ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µTM]`jЧ∆ЉБbc_\SLNPS[Уз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћm_s§ќ±uabaa^YXWTTSQbѓш€эююьэ€€€ю€€ьэюююэ€эьээююью€€юэ€€ююэь€€€€€€э€€€эьэюэю€€€€эьюэь€€€€€€€€€ююю€€€€€юэ€€€€€юю€€эю€€€€€€юю€€юэсх€€€юю€€€€€€€€€€€€€€€€ю€€€€€эю€€€€€юэ€€€€€€€€€€€€€€юю€€€€шфоаўЌњЄЃ£ЧСЛОТЧ•ЃЄ≈—актююэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€и™vvutrqsttroorptЭ’ж≈АXYZ\]]^__^^adeeedbdihefefeddcbcba`_]^_^````^]]^^^]\[\[]][ZZ\^^^][[[]\[\^^\Z]_^[\`a``^^___]]_^ZX[\[ZYZZZXXYWWYXWYXYZXY\]\ZY[\[[]\ZZYVX\\ZZZ]\ZZYXXWWWWUUVUUTUVWVVXXWUTUUWWWTSUVUVUSPQOMNLKMMIEDCBA=:::740---+(&%&&&$$&&&%##$%'(*,./7GK:;[X6*)$  "$""$'*,.3Cq¶ў€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€±VQ__kЩ∆Їbc_YRLNQS[Уз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ k^u®—≤vbeca][ZWTTSRe±ч€€€€ээ€€€€€юю€юю€€€€ю€эюьъэю€ээююэююю€€ээ€сс€€€юююээ€€€юэюю€ээ€€€€€€€€€€€юю€€€€€ююю€юю€юю€юю€€€€€€€€€юээыь€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юэщцыщфчузвб№Ёябйрцъщьэю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€ж©utttsrtsqoorqpsЬ“г√YYZ\^]__^_^_abccdddeeeeeffdcb`ba__`_`b_]]__]^_^\^_]][[]][Z[^^]_^\\[[[[]]^^\[\]^^____^]^a_\[]\Y[\[[ZXYYXWWXXWWWVWXXXYZYZ[[Z[]YY[[ZXWYY[YWY[\YWWVUVWUTUVUSTVXVWWVVWVUVTSTVVUUUUTUVUTRPNPPOLLOKIHFFD@>;:;940/.,+'&'$%#"#$#!#"!"%&'*.2BWH3DUC2+(%$%$# !  !#%&''*19Gs®Ё€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€іXT`amЩƒµ}bc`ZRLMRS\Уз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ k\o†≈¶qdec`^]ZYWTRQfµщ€ю€юэюююээ€€€юю€€€юююээюэюююэююьэю€€юыююээпс€юэ€€юю€€€€ээ€€€€€€юююэю€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьъю€€€€€€€ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€и™vututrstsprssrtЬ—б¬YY[[]]_`a`__`bcdceeddedcdecca_ccaa_`ba_```]]^]^\]^\\[\\]^^_]]]^^]][\\[\]]\\]\]]^]^_\[\\^^]\[[Z[[[ZWVWVTUVUVVUVVWXVWYYWXZ[[Z[ZZ[[[WVXWUVUWXVTSSQQSTTTSUVSSTVXVUUUUVUVVTTUUUVXWTTUTTTQNPQPMLOMIJIJJGA==>;96230,*'&####&#"#%&!"$#%(-2C\SJTH94.-*))*'#"!! !## !$%$&(+*),;]ЗѓЁ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Љ\R`dqЮ∆µ}ad`YQKNQR]Ъл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћl`rЭєШkdfda^]ZWVUTPfЈы€€€ээ€€€юю€€ю€€€ю€ээ€юээюю€юэ€€€€€€ююыэ€€э€€€€ээю€юю€€€ю€€€€€€€юю€юьэ€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€эыю€ююыы€€€€ю€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юэ€€€€€юю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€и©АwututrturrssusuЯ’дЅ~XX\\[\^`aba`abdefggddddddeddaaedbb___``bb`__^__^]\\\^_]]^^]\\]^_]]\[[\\\[[]^]]^_^]_^\]^^^^\[\[[YYYWTSTUUWWVUTTUUUVWWVVXYYXYYXXXXWVVTRUVSRSRQRSQPRSRSSSSSQRTWUUVVVVVVUUSSUUUVVVTUTTUQOPQPMLNLIJKJLKDAA@=>=8520-*)'%$#$#!!#$$#! "$&,9FJ]`E<;72/0/.,)(%"!"!  $$ "'$!%%&***/3Bu•…с€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љaV`aq°…їДacaZOJQSS\Шм€€€€шч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»kdvҐјЫkege`\ZXXVTTQiЊ€€ьэюю€ю€юэ€€эю€юэ€€€юю€€юю€ююю€€ююэ€€юю€ю€€€эююьэ€эю€€ю€€€€ю€€€€юю€юю€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€юю€€€€€юэыю€€€ээюю€юэю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юю€€€€€юю€юю€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€кЂБxtvvttuvtrrtvtu°Ўе√~WWZ]^^_bbcc``cfghhgfedcefefdbddcb```a`aca__^^`aa_^]]_^^]\\\\]]]^]^^][[]^]^]]^___^]]\\\]]^^ZZ[[ZZXXYXVWVTTUUTRRTUTTVWVVXXXVWXVUTUUVUSSRQRTSQNNQRQQRQRTTPOQSTSTVVWWVUTTSRSVUSSTUUSRSTRPOOPMNKIKLOLHKGBEC?>><886/1:7*$#$#! !#$" #)1:EOTOEB@>:98552.-**++(%%&%#$  $$  "!!$*'$$$&*.7Hq®з€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€їaZbbmЪƒґВcdaYOIOUU\Ъо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћj`z®ƒ†nceca^\[YWUUSn∆€юъь€€ююююэ€€€эю€€€ююю€€€€€юююьэээээююэююьююьэю€ю€€ю€€эю€€€эю€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€ююю€€€€€€€€€€€юю€€€€€юю€€€€€€€€€€эь€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€з©Бwvyvsuuvustuuuz•„бњ{XZZ\__adcbbbddeggfefggfefggeefecbaddbaabba^^`ba``_[]][\]]]\\^^^_`_]\]\^_^]]__]^]\]_^\]^\\[Z[ZZ[YYZYWWWURTWURPSUUVUSTTSSVUSUWTTTUVSRTSPORWSNLMPPPQRQPPQPPQSTQRUVVUUTVUSSTTTSSSUTRSSRPPONPONMLLMNKFIKDBBAA@=:95..22+&%# ! ! "!!%,4B@<<:420.-,,+,++++))'$##! !$#"#"$$!#*4M|©№€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Їb[beoЩ√єДde_YQKNQS\Ъо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ ib|Ђ√Ьnffb`_]\[YVTTmЊ€€€ю€эь€€€€€€€€эю€€эю€€€€€€ээюэээ€€юыьююью€ьы€€€€€€ю€€ююю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€юю€€€€€€€юю€€€€€€€ююю€€€юю€€€€€€€€€юю€ю€юю€€€€€€€€€€ыъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€юью€юю€€€€юю€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€и©Бzxwvussuussuut≠ўЁїxWZ[\]aeebbaceefghfeeffhggggffddcceecccabca`aa_``b_\^^]\\]]]]]_`a`][]^]___]\]][]^]^`][\\[[ZZ[ZZ[YXXVVVWWRSXURRTUTTUTTUSRSVVUUTTTSSQQRQOPPRQPPONNOPPPONOPQRSSQQTTUUSSUSQTUUTTRTVUSRTSNNONOONNOLKKIEFIGDBBB@<<;741.-+)%#! ! !!!!&1:=FUM648;<@B@@?=<:951/...--//0670+)$ #$&&$"  +Hz≥з€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€¬g\ccqЫЅЇИcd_WPLQTS]Щл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ќjd{ІјЫqgfdc`\]\XVVVmЇы€€€€€€€€€€€€€юю€€€€юю€€€€€юю€€эью€юээ€эъю€ьью€€€€ээ€€€€ю€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€ьь€ыъ€€€€€€€€€€€€€€€€ьь€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шуэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€юфт€€€€€€€€€€юю€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€к™yxvwwvttuutttsЃЏёњ|XZZ[\aedcaaggfhhggfedehhffffecccecbcdc`bca_````de`^^^^]]]]^]]]_`_]^_]\]^^^\]_\]___^\\]\ZZ[]][[ZXXWWXWVVVVXWUTUWWVUUUVVUUVWVTTSRSTTSQQPMOQRRSPLLONPQRPPQPQRSRSUTTUUSSSRSUVVTRTVVTRRSQMMMLMOMLKIJIGEGIHEA@@=;::84.-*'%#"!"! !%4BDDHA2/146=;:841,+)'&$" ':FFD>5++.//3;@AABCBBB@?=<94200256:=@C>7/(%  "&$ &.67Izµк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»i^eeoЬ«ЄВceaXNJOTV`Ьн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћkau§ЊХieecc_^\ZXUSTw¬ц€€€€€юэ€€юю€€€ю€€€€€€€€€€эю€юью€ю€€€юэ€юээ€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юьэ€€€€€ээ€€€€€€юю€€€€€€€€€€€€€€ьь€€€€юю€€€€юю€€€€€€€ьь€€€€€€€€€юэ€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€щ№г€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€кђБwwwustutuutuuu~¶џзј|[Y[]_`dgeceehihihhjikjghjhhhggeddceecbbbbbaacbcb_a``b`____]]]^__``^__^_^]^___`_]]^^][\]__]\Z\\XVVVVWVUWXYZVUVUUVVUTSTVVUVVVUTVUSRQTVQOPNNPSSRRPNPQQRRQQOOPRRSTTTTTTTTVSRSSUURRTSRONNONNNMOLJMLFCEHGDDC@<<<:751-,))&%$" !+?D?><3,+-..17<>ABDGHHGEB?><<:685158;?DGD=52-$  "# %-7MxЬјч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈j`eer•–≤xcf`WPLQUU_†т€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћjaw¶ЊФgeec`_][ZXUSUy¬ц€юэ€€юю€€эю€€€эю€€€€€€€€€юю€юээюююэююэюююэ€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэьэ€€€€€€€ьь€€€€юю€юю€€€€€€€€€€€€ююю€€€€€€€€€€€€юю€€€юю€€€юю€€€юь€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€ю€эий€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€и©Аwvvwvtuuxvuuvv~®ўжљwY[\]^`befdedfhgghhhhiihjjhgggfgffcdefc`bdccaccb`_`_`b_]^`a``^_a`ac__`^___`_^__]]_^]^]\\^_\ZZ[[ZWWXYXWXZWWYXVWVTVWUVUSVWVVWUSTUVTSQTVQPQPOPQQQRQNNPSSSQQQQQSSQRRSVVTSTVUSSTSTSRRRPMMMMOOPNMLJIKJFCDEBAA=::8411-)(&$$$" !-?D>>=1++,-.2657?@ABDDFHGGEABA=?<77626>BDGFC@91+&&# ""#"%5Om†в€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒh_der•ЌЂsghaZRMOSVaЭн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ iax®ЉРfcfe`_^\XWWTT|Ќэ€э€€€€€€€€€€€€юю€€€€ээ€€€€€€€€€€юэъь€€€юэююэээ€€ээ€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€эы€эыю€€€ю€€€юю€€€€ю€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€юээ€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€к©xvvwwuuvyvtwwu~©ЏдЉvY[^``bbcfdcehiiiiihjihjkiihhihhhgfefhfeeddddggdaaa```^^]^_`b`aa````a`^__`__`_^]]^``_\[]]\ZZ[YYYYZYWXVX[YY[YWXXUVXWVWWXXWWVVTRSSTTRQRRQRQOMOQQOMNPRRRRRSTRRSRQPPSUUUTTTTRRSSSRQOOMMOLKOOMIIIIIGGFDCBA>>;:51.-,*'%"##  +7<<96-(+---.157:<==?BEHGKMMIEC@<:966569:>BFJKF?860'&%**2jЃа€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћq_afu®ћ™tef`[OIQTTa†с€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ќi`t®њПhefc_^]^\WUTU{«ш€ьюю€€€€€€€€юю€€€€€€эь€€€€€€€€ююююээююююю€€эююэ€юююю€€€юэ€€€€€€€€€€€€€€€€€€ю€€€ю€€€€юю€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыщ€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююю€€€€€€€€€€€€€€€€€€€€€€й©xxxvuustwxwwwv}©ёељx\]^``bbcdcbeghiiihhjiikjiijiigggeefgighgfeefhheedbcca`a^]^ad`___`a^^]\^`_^]`a__]]aa][]^\[]\XYZYZ[ZWVYZZZZ[ZXYZYWWXXVXXXXWWUSTUUUTQPRPNQPOMMRSONPPPOPPQSSRRRRQNPRRRTRRSRQPRSRPOMMMONKJLOHFHEGFCCCDA>><9774-++,)%$ "'26552*),,,./148:;;;;<76:9:?DHMLJGC;4/8C9>^Н’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќvadhxЂќЃyfeb\PKRVVa£ф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЌhbsІ≈Уhecb`^]][WTUVyЊо€€€€€€€€€€€юыы€€€€€€€€€€€€€€€€€ю€€€€юью€€юю€€€ю€€€юю€€€€€€юю€€€€€€€€€€€€€€юэ€€€€€юьээ€€€€ю€€€€€€€€€€€€€ю€€€€€€€€ю€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юыыю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юью€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юээ€€€€€€€€€€€€€€€€€€€иІ~ywwxwwvvvvwwvu}©яйЊw_^]__accaaceghhjjjjjkiiijkjjhghhfeefihffgedegedeccded`__^_`ca_aba`^]^]^_^__^__^^]^_^^__^^]\[ZYYZZYYXZ[[ZZ[[Z[ZXXXYXWWWXXWVVTSSRRSPPSQPPOQQRRQQQPQQQRQQRRRRRPQPSQQRTSPQQPPPQPPONLKLKKJHIGGGGDBAAA@>=987300,**,(&%"##! )10/0-)))+--/0366:<<>@@BEFHKLLMNLLFAA@;:98:<<@CHKMOKFBJeДЃе€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћscgix¶ѕЉГhgaZPJOUW`Ґч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћgaw©¬Тgffdb`_]ZVUVVzћь€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€юю€€ююыъю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€ю€€ю€€€€€€€€€€€€€€€€€€€ъотю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€ю€€€€€€€€€к™Аzzzywxxuwvvxxv}™влЊt\]\\^`becccfhhhiiijjjijjljijhhiiigdfghgffdcegdcbdcbcc`^_``bbbbbba_`a_^`_]^_]]_^]^``^`b`__^_]]\[\[Y[[[]]\Z\[[][YZ[ZXXYYXXVTUVRQTSSRRQQQPQQPSRRSRQQRQPRRSRSRRQRSSRRRRTQQPPRNMMONMMKHJJHHFFEDDA@AB@<::74420,,+*)''&$#!" (/-,*%&'(*+,..1537;=>>>?>>AFGIKORNIIGDA><<:<<;<>@FLMPU\rЦ—€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ pddgw£ ЉЕffa[OJQVVb•ц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€…gawђƒУhfedb``]ZVWVW|ѕ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ьъ€€€ю€€€€€€ю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€€€€€€€€€€€€€€€€€€ьчь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эь€юю€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€йІy|}zvwzxvxwxzv|™биїt\]\]^`cfgfddhhgjjhgiikkjkkjjigijjffggghhgedffedbbbbba``aa_ab``a`_```aaa_]]___`__``_^_a`a`^__]]^]\\Z[\]][[]\[[ZZYYZYWXYXWVUVUSSSSRRPPRTSRSRPPPPRSRQRQQSTSRPPQSTSSTRQRRQORROOOMLKMMJFCDFDD@>@A>?A=:852//./+)(&'&$$%#!"! %)*'% "#&+*+,/2358;>=<==?ABCGJLMLLKKMJB??><<9979>ADKUY[_ґџу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈meghu°√≤Бgfb\QJQWYbҐф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ћhawЂ¬Тhebba_]ZWVVVW{…ъ€€ю€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€юээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€ю€€ыы€ю€€€€эыююэю€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эьэ€€€ю€€ю€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€з•Б}{zyvxzyxzy{{w~Ђаиєu[\]^]_begfcdfhhiihgikkjjklmkifgiigfgihghfcdgfgfedebbbabca__aca`a`aaa^`b_^_^_a`__]\]__aba`^\]^^__\][[[]]\]^[Z[ZZYYYZXXYZWVVWUUUSRQPQRSQOQQRRQOPTSQQRRTTUSQRQQTTRRRRQQPMLOQNQQLJHHJHD@BECA>?CKORTTYp§”мю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€√gcjjr†ƒ≠|ggaZOJRWZdЯу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»ebvЂ∆Хihe`a][ZVTTUVz…щ€юю€€€€€€€€€€ю€€€€€ю€€€€€э€€€€€€€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€€€юэ€€€€€€€юю€€€€€€€€€ю€€€ю€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€ююю€€ээ€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€йІА|xxxwwxzyxyzwxВ≠явЇvZ[\]_``cbcefegjihiikkjkmllljigefjjhijhffeeffeefggfcbccdddb`becacaacb`bb`___`a`^]^^^``ababa]\^]^c`^^][\]]\]]\\ZXZZ[ZZY[[XWXWWWUUTTSRRSPOPQQRRPPRRRQQSTSRQQUSQSRQQQSRQNMNOPLNOLIGCEFDAABB=>><;87<911/--,-*'(*)&%"#$$&%! %(*,.0036998:<>@?BABEEIGIORTTOIGGA>==<=>>>>CGKRWXZdМ¬жы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЊecjisЬњ™}igaYMIRWYcЯт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ќebv©»Чhfea`_]ZWUTTYБѕь€€€€€€€эю€€€€€€€€ююэю€€€ююю€€€€€€€€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€юь€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююэююю€€ээ€€€€€€€юэээюю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€д•А|wxzyxyyxxwwvwВЃвеєt\\]_aaccbeijhhjkiikkiilnljjijhedjmjjihhfgifggfgfffdbcdgfdbaabaa`_acbaaa``a```_`_a``_`bb_]^]^^^__^]^]\\]]]\\\][Y[[ZZZZYXWVVVWTRRSSTQPRSQQSRRRQNPRSRRRQQRPPQRPPRRQQRRRPOPNLLKJJJEABDA@>;>=<;;85384./-,+++(%%('''##$#%$!   !%&*-0268889<<>?>>BAADEHKLPRPNOOHDBAA?>>@??ABHPSUVV[БЇџф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эЇcbgktЬњѓБihaYNIOTYbЮу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ dcwІ√Уgeea_`[ZYUUUVБѕъ€€€€€€€€ю€€€€€€€€ээю€€€€€€€€€€€€€€ю€€ююю€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€юэь€€€€€€€€€€эь€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююэ€€эю€юэю€юь€€ю€€ююю€€€€€юю€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эь€€€€€€€€€€€€€€€€€€€€к©ВzyyyzzyxxwxxxwВѓдйЇt[\]_`accegiijjjkkjijjkkmkjjjjgbchjkjhhihhjgfhhhfdcbegcfeddbab````ba_]_a`_```aa`aa`aa`aab^]\^`^^_^]]]]^_^^`_\\\[[]\[[YYXWUWVUSSTSRROQPQRQNPQQQQPOQSRPPPQRPOOROQQQQPQPLMNIGIKKHFDDCA@?<;;=:985212/-,,*()*&$&'&&#"$'&#"" "# #$%$$%%!#(.024656:>=<>>?AABEGFIJKNPQSNLLIFA>>>AA?@AEIPTUUUZt•Ћй€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юљfdhjtЮ√ѓhgc[OJOVXb£ш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€«eczЂјНfdcba^YZYVVTWЕЎю€€€€€€€юэю€€€€€€€€€€ю€€€€€€€э€€€€€юю€€€€€€€€эы€€€€€€€€€€€€€€€€€€€€€ю€ю€€юю€€€€€эь€€€€ю€ююшу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€эью€€€юьь€юэ€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€ю€юьююю€€€€€€€€€€€€€€€€лІАyy{zxxyxvwvy{xВѓеиЉtZ]_a`_bffdfgklkkjjijllkkljiigfegihghihhikigfggggdbbeddgfddedb`abba`]]`__^^___`_^_``a`^^_aa_^`_]^_^\\``_]^`]\]]\]]\\[YZXVWYVTSSTSRRRPOPPONPOQQQPPQQRRSRQRONQQQPQSQMLKJJJJHHHIHEDEA?=;:<;:853222/,+*)*(''&&(&'$###%$" "!"" !##$'--,++'#"'+/035667:;?@@ABDFDFHFHLKMQTROOJACDB@@>=>;89:98621011/-+++*)('&&''%$&'%&$ ! "" %'!#%',+,*))'(' &,.24249;;<:8:8655210//..-,*)(''%(')&'$$$%%!!#!! $&*,&$(*()*((*''(&$$ (-.169;=@ACGGGGGHJLMJIILMMQUTROMKHEB?????@DCGMPTWY[]pЯЌк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щєfdhhoЪќґ|jjf^PGPWYcЦи€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€√df{©їЛggdcb^[[YVVV[Иў€€€€€€€€€€€€€€€€эю€€€€€€€э€€€ээ€€€€€юю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€юьээ€€ю€€€€€€€€€€€€юс’’€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€юэю€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€ююэь€ю€€€€€€€€€€€€€€€€€€и£}xwxxwywvwz{{{Б±езЉsY]_^aaadfihhhjmnmmlnmkkkijkihiihgihhhiihhjgfgifceigefgfddcbabc````ab`adb_aaa``_`ba`cb``a_]]^_`_]^_^]^^____`][[[[ZZYZ[YZWTWVUWWTTSRRQPPQPQROOQOOPNOQPQPPOOOONLNMLJIGEDEDBA??@=>>;:;:88631200/.-,-+)*)((&&'$$'&!#$#$$!"#!!#'++,(%),**+*)*&%)((()(%!#*09<=?BEGMNLLLNLONIGILJLOOPQRRQOGFHD@?AB>AFHKPUVZ[[hС∆к€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щЄhehipЫ—≤ulni_SGMTX`Цл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юЅeg{®їЛgfefd_[YXWUT]Нё€€€€€€€€€€€юю€€€€ю€€€€€€ююю€юэ€€€€€€€ю€€э€€€€€€€€€€€€€€€€€€€€€€€€юыь€ю€€€ю€€€€€€€€€€€€€€€€€€€ъшю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€юююэ€€€€€€€юэ€ю€€€€ю€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€эю€€€€€€€€€€€€ю€€€€€€€€€л¶{zxvxyywxxz{{}ВѓжйљsY_`_`bdeegiiikllllnokkkkikihijiffhhhihhijkgffgefghfeffdfgeda`a``aabb`bb__a_``a_`__`ba__`_^^^^__^]]]]\__^^a_[[\]\XYZZYVWXWWVVWVUUTRPNMPPMOQOOLNOONMMOPPOMLKLJHHHKHFFCACBA@?>==>=::;;931110//..-,.-*)*()%%%#"%$"$&$$#"##&*(,6<2'&),.-)'+-)*,+*+,**%"&08>?>;<:888993/11//..-,+--*()('%$%'&$###$##""&)+08?A>,%'+,-.-,--.,,/.-01.+(&#" &-6@GNRSRRVVVWTTSQNKMMJLLILPSUVTRONKFDA@AB@@CGGNTWY[[cГ≥„щ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щїmhijsҐѕ±zjlh`RGNVXcЩр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЇeg{ЂјОgie`__[YVVVUZКяю€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэю€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€юю€€€ю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€ыъ€€€€€€ю€€€€€ю€€€€ю€€€юююю€€юю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€юю€€€€€€€€€€€€€€€€€€€йІА||{zyvzy{{yy{{Б≠елЅv^]^a`abecbfecgijknkjlkjmljiijkiiigghkljiljhjjhhheehkidfffbbaccdbcdcbddbddaa````^^`ba`ab`__```cc`^^]^^`a`_^][Z\\[YYYZYXZXWVVVVVTSTTSRRROQUSOPRQOOOMNNMMNKHGCBGGDCEEB@BA>>==><:76788451.//---,)))((*)&''%#$$%#%$$&&'&'+08DE91,'')),-/-..-,/022//0-++++)%#! "%/DYcd]ZWTWXWUVUTRPLNONOLMPQPQRUUTNJJGEDCAABCCEHKPWY]^`xЂЋо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шіdijis°ќ≥АjjhbTFNXXcЭц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыљefv•¬Рggc`__\ZXVUS\Тз€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэюююю€ю€€€€€€ююэю€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююю€€€€€€€€€€€ю€€€€€ж§А{z|zyy|~zz{||{Бђейїr[^]__bddbbeffhhjlsokkjjmlghiijhgeeccjljijihihhghgffhigeefcbbcdc_aca`_bbbbbacb_^```a`aa`^_``a```a`^]^__^]_a]]]]ZZZYZZ[Z[YXWVWWUSUWUSQRQOQSRMOROLKLKMKJLKGEEDACDCAAA?>>;9<:::985544731//...,,+)())()('&(($#$"#$$(++.7DDA:2-&&)*(+03.-.1/.696641200.-/-/0.4BXrП®±©Пue\ZZXXWVVTSRQRTTQOQPMOQSRSQRRQKHIHHEDB?@DGKQWZ\\]nШЇ’ч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ч∞ciijv°…≥АkmkcTJOVXbЯц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыљefvҐЊПhhdba^\]XUUV]МЏь€€€€€€€€€€€€юю€€€€€€€€€€€€€€юээю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юь€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€юю€€эь€ююю€€€€€ю€юэ€ю€€€€ю€€€ю€€€€€€€ю€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэы€€€€€€€€€€€€€€€€ю€€€€к§Б}|}}{z|}{zyz{zВђеиґoZ^]`acddcdgghhijkqokliklifghhgggfeddgiihiihhigffhheejiggheccbca``aba`aa`bbacc`_ba`ba`a^]``__`]]___`a`^^aba^\\]\[[[[[Z[YXXXWWWVTWWURRSSSRPOKLOPLJKLMLHIGEFECABAB>?@;<:77:97785683/241.//-..,,)'(**((&%''&##""%&&(.7HUO;1)**'%%(*045//.//4=9554321001547@XБ£їЋ’ўўЎЌ≤У~m^YXXXXYWWWWXVSSQMNPQRPRSTSQPQPRTJECB?BECFKQUY[]Z`y¶Ћн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€цЃdjjkwЮЊ≠~lqmbTHOVWaЦк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъЇegv§їЗfheca^\[ZXVT]Тк€€€€€€€€€€€€€ьы€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€юю€юю€ю€€€€€€ю€€€€ю€€ю€ююю€ьь€€€юю€ю€юю€ю€юю€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьшь€ю€€€€€€€€€€€€€€€ю€€€еҐ}}|~}||}||yxz{Д≤зжіm[]]`abcbdfgffggghkkjkjjjihhhighffhgffgjgiihiigggiifcfhhhgedddcbcbaccccdbba`baaca__``^___`a_]aa`__]_baa_`aaa^\[[\\][ZZZYYXZYVUWUUTSTSQSSPORNJKLLMIJNNJHDDDC@?A@>;=A>=;88865666543211...-.-**++('(**('&'&&!!"%&(0?LPNE5(&&&&''(*-273030-.046626887567>>;;>>?<9963232431//0/--.-/+*('))((()'&%#%&$%%(1>Q^R>3,)'%))''*+,/499331-///49::9;<=EOgНЈ—Ёёбвбввелйяё№÷ј†Жn`ZZWZ[Z\]\[[[YXTRRPMNPORQTVSRPLLHGGECBEDGINRVXZ\Z`{ђќу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уІepmlvЯј≥АkqmcVKMUWcЫх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шґdh}ђµБehgcfc^\ZXYW]Цп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ююэю€€€€€€€ю€ю€€€€юю€€ю€€€€ю€эюю€ю€€€юю€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€€€€€€€€€€€€€й§А|}~{yy{||zzzzyМњдб≥l\\]^``bbddcecfiedceggifeedggihgggehhhgghghgfhihefffghjjhgdbbdgdbffdb`accbcdcadccccbbaaa_^]^_a^^_^`bab`_]^__\]_[[]][Y\\YYZXWWVVVWUTTTTSRRSPOPQOMGHIFGDBC?=?==<<<989:<;7676200100--/./-,++(()''&(''&%%$"$'''3J]^QC4*'(())'()(*,,/375453010/07=<>;<;99:97665672/21/.--....-+-)'**(&(&&''%''%)3GYcZF3+*(')**''((*+,,.4955542011347;BSmУЅ„ёоэьью€юэ€ю€эцшэпжЁяЁўЋ±Уyia`bddbb```_`]WUSRRPMJNPRSSTTQONIIFEGFFHKHKPRWXXYYgЙ∞ѕэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€у©emnmwҐ¬ЈЖkrlaRINVWcЯш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€х≠biВЂ∞ekhgfc^\XVWUb°л€€€юэю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€ю€€€€€€€€€ю€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€ю€ю€€€€€€€€€€€€€€г°Г||{{{{zz{{|z|Мњйд≥hX]_^]]^```aadccedbchfbcefggfiheghhhihgihgghgedceghghijjgffedbcffcacfb`bbbb`bbabcddca^^]_a^_a____`^__a`caab_^\[ZZ]][[ZYZZYWX[WVXXUUVVTSRSPOOJJJECFFDDA??@><;<;;;<:;98575210020//,-//,--*,*)))('*%%'*')/;DR[PB4**)()*)))'')+**---59666212359;@LlЫјўцхсь€ьыю€ююю€эщюьэ€ъзаабв№–Њ°Иwnkjfdgfabe`[[ZWVSQPOMNPQSSVUTROHHKIEGHEDFKMOSUX^]_u°≈п€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т§enop{®ЅµЕkplaQGPWYeЬх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чіejБђ≠giffe_\^ZVUS_Ци€€€€ю€€ю€€€€эю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€эь€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€€€€€€юю€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€€€€€юю€€€€€€€€ю€€€€е§ВА}{z|||}|}|{}|Лљйб±iZ^]]_`_ba`b`adcfccehfbbeefffggggfffiidhigggghhfggifijijghhgddcfdeecddbcd``bc`adcabba`^\``a```a_]_``a`_ecbb^\[\[Z[\[\ZYYZYVVXYXXWUUUUTRPPNLLIFDCEDBBB?@?=;;98;;999:985541./1/-/.-/..-,+*((*(%%'(%&(-/>?<;:98877678841461/0/../-//-..*,+(())'&'(*+2DTZVK9/)(((*)*,)(+)+*++,,..-17;9:98:;?NmЧњ‘втээ€€€€€€€€€€€€€€€ю€€эь€€ыээъэхеёў—Ѕ©ФВtkhgfddfgcc`]ZWUVRPORSRQSUWUQPOMLGEGDGBFGKLPXZ[[[cІ…ь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фІfppoБ±ћЇВmqpiVIOUXcХс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€х≠gl©∞gjiheb^\YXVTaЭпыю€€€€€€€€€€€€€€€эю€€€€€€€€€€€€€€€€€€€€€€€юю€€€ю€€юююэ€€€ю€юь€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€юю€€€ю€ю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€ю€€€юэ€€€€€€€€€€€юеҐВА}}~~~~~}|}~{yЖЈмж≥iX[Z\]`a___abaddab`eddcfeedcehfhgffeiihhgeggfigjhhiihiigggfcddbddddedebbaacc`aaaba`b`^`_]``^aaaa``aaa``b`a___]\[YY[Y^]ZYYXXWYYXVWXTTUQPNPMHGIHBCBAB@>==<;;89955766565325330/0/0.//.--*,))((()(()0>O^ZI7,(')*(()(***+++-,,.-//.-07:::<@K\yЮ√Џлпч€€ю€€€€€€€€€эю€юъююы€€€ююъъщыюьуннлл÷¬≥ЮИyqjeegghecb_][ZWTRTTQPPTUVXVURQNKLFGEECFGINQVW\]\_rЮЉк€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф®gppnЕљѕїЕlqoi[OPTYaФн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€х≠hl}ІіГhjifdc^[WWVVb†ню€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ююь€€€€€€э€€€€э€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€юэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€ю€юэ€юыю€€€€€€€ю€€€к£В~}~~}{~}{ЕЈниіiY[Z\\]_`^``^_aa`bccdeceeddccgihfhhghhedggfhhffighijffggfffeddcedbabdgcbcbbccb`dda``a_``__`aabda^abbba`b^^a_\^]\\ZZZZY[YXWVUUWWWVVVVTSRPNIFGGD?ABA@@=<;:887887885654333766200/0---,*--+)*(*+*)1?KURF;0)'')+((())+*,,*,-,.--.../28<<>GbЙЃЋгпчэюэ€€€€€€€€€€ю€€€€€ю€€эьь€юэъьщэ€юэьчшьзёЏЌЇ•П}ohghgfegdbcb^[YTTSSRSRSVUWVUTROKIIGDJIEEFJLQXY[\]mИђЁ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€т†gsspКƒ‘ЉВippj]ONUW`Щч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ц∞flАЂ≤}ghfc`c_[ZYXVb£ф€ю€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€юэ€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€юю€ююю€€€€€€ю€€юэю€€€€€€€€€€€€€ю€€€€€€€€€ю€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€юэ€€€€€€€ю€€юг°ДВ~}{}~~}}~{{ЗєниЈjX[Z\^^^^]bb]^_a`acbbcbccbcbbcffhijiffcdhjhhhgfggfijhgeeeeefdddfeaaeeecbdccdc`adeb``a`_`cb__acd`__ab__a`_`b]\^\]]ZYZXWXXWVXVUUSTTSUUSRPPKFFEDA>AB@===<8;7676698534652224341./-...,**++(&))',4BOXPA4,-+**(')()+)*,---*+.,.-,/1213:ALaД∞”ксэю€€эь€€€€€€€€€€€€ю€€€€€€€€ю€€€эьэюэ€эщюэшххйяя—їІТrlhhhihhiheb`[YXVUTRQRRSVXXWURLJMHJIECACDHMPW[\\ZfВ¶…ы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ф¶grqrПЋ”ЄlprmbRPTX`Ъш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€х™jkА≠∞|hifbba^[XWWWaҐу€€€€€€€€€€€€€€€€€€ю€€юю€€€€€€€€€€€€€€€€€€€ээ€€€€€€€€€€€€€ю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€ю€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€э€€€€€€€€€€€€€€€€€€€€€€€€ж†ДГ|{{~А}|}}|}АКЈнлЄjVZY\][]]]_``a`aa_ab_`ccaacbbdcdhhihgdeeehhiijhggfjjfgfdceffbcccdcbeda_bc`cddbaacbaa`b`_cc`acdcb`_aa^]_]]a`[[\[\[ZYYYWVWWWVUVSRQSSSRRPNKJFDCA==@??=;:98:87535853355865--0/.--,,/.--,)())*+4DPSJC5+(*-+--+'),),++-,..-+/../234467GiР≤–знщю€€€€€€€€€€€€ю€€€€€€€€эь€€€€€€€€€€€€€ю€€€€€€€ысшняўƒЃЧГunmjiihhggeb`a\YXVTRSRTVVXXWTRROMKJDBDCEFGPSUY]]\btХЈс€€€€€€€€€€€€€€€€€€€€€€€€€€€тЯfqstТ”÷і}lormeVQUWbЬы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сЬikАЃ≥ikfbba^[YXWWc¶у€€€€€€€€€€€€€€€€€€€э€эы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эюю€€€€€€€€€€юе°ДБ~}}АА|}}}}}ОїлкЄfTXX[\[\]]\^_abb`_^bbedbbadfeebdfiijidiifgiihkhedgiihfhfgifccedefdcddbaabacdbcaaacbceaaadecbdbab`^_b_^]^\]_][\ZZZXXXYWXXWWVSUSSPQTRQPNNHHEBAC??><;<9:78856434654356642.//.-...,.,-/.**--5GTTK<0-)*+-++,+-,-.,....-../.11203456?==;;:9<9855358537423431./11..//.-.+,..,-6BMVM<1*(+**+,*,++--..,--///0001115269AWx§—лъэыэ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююьээю€€€€€€юэээхп’∆ґЬИxojgfiiggfhdba^[XVUTRQSSWYYYYVSTNKHGFEEDHKMOPVXY[^mНЃё€€€€€€€€€€€€€€€€€€€€€€€у§iqorТ”Ё≥vnprodXQUVaЩщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рЧfkВЃ±|gkgecaa\XZYWe§ф€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€ю€€€€€€юю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€юю€€щ€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€ю€€€€€€юю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€ю€€€€ю€€€€€€€€юдҐЕБАА~ААВБ~~|ИЈйж≥gVXX[\Z^]\```_`ab`bcaccbbcbegedfffhiihjjgihhiljihfgjihhhgfiggddgebcdccbbfgdbecceecbeea`bbcdb`bca`b``_`a^\^_\]\[YWXVXYUTWTVUSRQPOLOJIHCDEDC@=;=<<;:8:85666277328620/00/1.-.0.-,/-,*-08HVYI=1+)+)*-)*-+*,-./..,,-.006>813124>V}© еъю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€эь€€€€ьыэююю€€€€€€€€€хеа÷¬©ЧИ|slkhihiigedc`^\[WSTRTUUWYZZXSQQPLKGEJHIGKLLQUZ][e}РҐƒч€€€€€€€€€€€€€€€€€€€ф•foqsП”№™rqsrpgWPSU`Шц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уЩhnЕЃ∞{glhgeca[ZZZXe•т€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€юэ€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€ю€ю€€€€€€€€€€€€€€€ю€ю€€€€€€€€€ьуюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€юэ€€€э€ю€€эа°ЗГ~}~}~А~}{ЗЈззєiTWXZ[Z\\]]^_^```_abccabdecedbcdfdfffgijgghiikihhfhihhhjhfiecccddeghdbdedeeeebbddcbbdabbcddaacbdca^]_^^]]_]]\ZZXVXXXTSVTQSSQQPNNLKHFHCAA@?<;:9::8878534454445676010./01.,-/.00..29AFLROB2*((+-+,+)+-,++,,-//.02//39>96:@XyШЄЏпщэ€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€эщьтгЏћЄҐН~smjhkkggieeea]YYWVTSTTUWXWXZXTSNMNIHGIGDGJOVVWXZ^pЛ≠Ё€€€€€€€€€€€€€€€€€цђhpnoМћ’§sprppjZQUU`Сс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уЩhlД≠Іwikigda_\ZWXXe¶ф€€€€€€€€€€юыю€€€€€€€€€€€€€€€€€€€€€ь€€€€€ю€€€€€€€€€€€€ю€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юю€€€€€€€ю€€€€€€€€ю€€юю€€€€€ю€юь€€€€€€€€€ю€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ю€€ю€€€€€€€€€€€€€ю€€€€€€ююю€€эб§ЙЖВ~}~}}ББ~АИ±екљkTWWYZZ\^]]_]]^_`ab`bbbecddeccedfghgfighifiiigfgfihhhhhiihheffddeffdfbbfcacccaaabcecbaccbdcabcebbb_^_^]_^\]^[ZZYXVXWUSTTTTOMQQLHFEECFABD@>==9876557664416432474341///0/0/./.447@IUTLA80**))),-,-)*,,-,,-../235521679=:877655475123711125347/-//..000/1;CNTQKA5/*),++,.-,*,,,-.-.,.14346842589FgЙі÷ръ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юью€€€€€€€юю€€€€€€€€€€ъупкзќµ°Зsjjkjkiiggife`]\YYVUSSTSSVW[[YVSMLLIIGHLJJMSUWY\]cuР±л€€€€€€€€€€€€цЃgpnpПќЌЦprrrnl`TST^Сс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сУgiА§Шnjjjfda_][ZZ[i∞ы€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€ю€юэю€€€ю€€ю€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююэ€ю€ю€€€€€€€€€€€€€€€€€ю€€€€€€€€ю€€€€€€€€€ю€€€€€€€€€ю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююю€€€€€€€€€€€€€€эа†ДГВБВАА~~~ААБГ~Е≠ёењlSVVWY\]]]]]^^__a```abccdbccbbehheiikkkghgijhhjifeejjfehighhgdececefebbfgedcdfeccebcdebccabccbcb`_b``b^\\]_\[YVUUVVUSQSRMIKKEHDAA??>@>>=;<:64687720542114..024121/+./-./239ENSOC;0,-,+*---,.-,,+..-11///29986876;JgСља