%PDF-1.4 %вгѕ” 1 0 obj << /OPM 1 /SM 0.001 /Type/ExtGState >> endobj 2 0 obj << /OP true /Type/ExtGState >> endobj 3 0 obj << /OP false /Type/ExtGState >> endobj 4 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[255] /FunctionType 0 /Range[0 1 0 1 0 1 0 1] /Length 699 >> stream XЕ ƒ∞ —{^lџґmџ6lџґm'kџґmЫµ{їк4 S≥ƒ6Ѕ±јѕ_B"Й=H$х!@6…bдРЬFЃ#ЈдI0тJЊ#£АћЖQH g«(Т£®ЋЙQ\Jд¬,Щ≥ФФќГYF ж≈,Ч≥ЉT»ПYQ*јђ\≥КT-ДYM™∆ђQЂ¶‘*КU[к√™[ЂЮ‘/Б’@ЦƒjT Ђ±4)Н’TЪХЅj^ЂЕі,ЗЁJZЧ«nSї≠іЂИЁ^:T¬оXїУtЃВЁEЇV≈оV їїф®ОЁSz’јй]ІПф≠Е”ѓ6NPg† ™Л3ЄќZgШ oА3Ґ!ќH’wіМiМ;ґ о8яwВLlЖ;©9оdЩ“w™dµƒЭ÷ wЇћhН;SfµЅЫЁoОћmЗ7OжЈ«[–o°,кИЈXЦt¬[ЏoЩ,пВЈBVv≈[’ µђйОњV÷хј_яГlмЕњI6ч∆я“ЂlлЛњ]vф√яўЧм@∞Gц$Ў7И`њLpP !8<ФаИFpLО'81Ва§ЬIpZќМ"<;ЪрЬЬCxa,бEє4Ор≤\Oxuб5є>СрЖ№ЬDxk2бmrыҐ;дќ©DweЁЭEtѕ4Ґ{еЊйDчѕ z@ЬIфР<<ЛиСўDП csИЧ'ж?9Пш)yz>с3тмвз?//,"~Q^ZLьтвWд’•ƒѓ…лЋИяXNт¶ЉµВдmyg%…їЂHёУчWУ| Ѓ!щh-…«т…:ТOе≥х$Яo щBЊ№HъХ|љЙфЫЌ§я w[HњЧґТюЄНф'щy;й/тл“яvТю.м"эSюЏMжп=dюСчТщoЩ€/9—X endstream endobj 5 0 obj << /BitsPerSample 8 /Domain[0 1] /Filter/FlateDecode /Size[2] /FunctionType 0 /Range[0 1 0 0.6 0 0 0 0.06] /Length 20 >> stream XЕ Ѕ@ €O£Ш юэ endstream endobj 6 0 obj << /SA true /Type/ExtGState >> endobj 7 0 obj << /FL 8 /Type/ExtGState >> endobj 8 0 obj << /Width 1390 /ColorSpace/DeviceGray /Height 434 /Subtype/Image /Type/XObject /Length 603260 /BitsPerComponent 8 >> stream ююэээьььььыыыыъъщщщщшшччччццхххффууууттттссррррррппппппппппррррррррссстттттуууууффххххццчччччшшщщщщщъъыыыыыыыыьььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юэээьььььыыыыъъщщщщшччччцххххфуууутттссррррпппоооооооооооооооооопппррррррссттттуууууффххххццччччшшщщщщщъъъыыыыыыыыьььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эээьььььыыыыъъщщщшшчччццхххфууутттссрррппоооооннмммммммммммммннннооооопппррррссттттууууффххххццччччшшщщщщщщъъъыыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ээьььььыыыыъщщщщшчччццхххфууутттсрррппоооннмммммллллллллллллллммммй¶°©нооооппррррссттттуууффххххццччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эьььььыыыъъщщщшшчччцхххфууутттсрррпооонммммллллкккййййййййййкккклк–tTЄммммнноооопррррсстттуууффххххццчччччшшшщщщщщщщъъъыыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьььььыыыъъщщщшчччццххфууутттсррппооннммлллккйййййииизззззиииииййз≤С`C∆ллллммммнноооппрррсстттууууфххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ььььыыыъъщщщшчччцхххфуутттсррпооонммлллкййййизззззжжжжжжжжжжзззд∞|vZGЌйййккллллмммннооопрррсстттууууффххххцццччччччшшшщщщщщщщъъъыыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьььыыыъъщщщшччццххфуууттсррпооннммллкйййизззжжеееееддддддддееед∞НА`Gўзззиййййкклллмммноооппрррстттууууффхххххцццччччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ььыыыъъщщщшччцхххфууттсррпооннммллкййизззжеееддддгггввввввгггяЪfs{{WGееежжзззиийййклллмммноооппрррсттттууууфффхххххцццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьыыыъъщщшшччцххфуууттсррпоонммллкййиззжеедддггвввббббааааббббЃzwu|z_Gндддеееежзззииййкклллммннооопрррссттттуууууффхххххцццччччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыыыъъщщшшччцххфууттсррпоонммлкййиззжеедддгввббааааяяяёёёёёяўЫnxwy~uSUсвввггдддееежзззийййклллммннооопррррссттттуууууфффхххххцццчччччшшшшщщщщщщъъъъыыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыыъъщщшшччцххфууттсрпоонммллййиззжееддгввбаааяёёёёЁЁ№№№№№№№Яytwtw|oY_уаааббвввгдддеежжззииййклллмммноооппррррсстттттуууууффхххххцццччччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыыъщщшшччцххфуутсррпооммллкйиззжеддгввбааяёёёЁ№№№џџџџџџџџ„Я~wwq]АzqKlхёёёяяааабвввгддееежзззиййккллмммннооооппррррссттттуууууфффхххххцццчччччшшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыъщщщшччцххфуттсррпонммлкййззжеддгввааяёёЁ№№№џџЏЏўўўўўўў÷Оuvxsg]У|q@~х№№№ЁЁёёёяааабввггддеежзззийййклллмммннооооппррррсстттттуууууффхххххцццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъщщщшччцххууттсрпоонмллййизжеддгвбааяёЁ№№џџЏўўўЎ„„„„„÷÷’†vxul^С£БlIШсўЏџџџ№№№Ёёёёяаабвввгддееежззийййкклллммммнноооппрррррссттттуууууфффхххххццччччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щщщшччцххууттсрпонммлкйизжеедгвбааёёЁ№џџЏўўЎ„„÷÷’’’’‘‘“Бv~xwtf]’ЈВfOір„ЎЎўўўЏџџџ№№Ёёёяааабввгддееежзззийййкклллммммннооооппррррсстттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щщшччцххууттррпонмллййизжедгвбааёё№№џџўўЎ„„÷’’‘‘‘”“““—Юzqxtstqa√€tTTјр’’÷÷„„ЎЎўўЏџџ№№№Ёёёяаабввгдддеежжззииййййкллллммммнооооппрррррссттттуууууффххххххццччччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щшччцххууттррпонмлкйизжеддввааёё№№џЏўЎ„„÷’‘‘”“““—–––ѕМ{{vtrnoG;:631:CQXk~Х±¬ќ–—““”‘‘’’÷„„ЎўўЏџџ№№№Ёёёёяаааббвввгдддееежжзззиийййккллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€хфуттсроомллйизеедвбаёЁ№џўЎ„÷’‘“—–ѕќЌЋЋ……««∆≈ƒƒ©qz|xxtttrpplnlhmZK?DCCCCDGIMOOUX\\q}К¶ƒ”÷”—“”‘‘’’÷„„ЎўўўЏџџ№№№ЁЁёёяяааабвввггдддееежззззиййййкллллммммнноооппрррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€фуутсрпомллйизедгвбаёЁ№џўЎ„’‘”“–ѕќЌЋЋ…»«∆≈ƒƒ√¬≠pw}{zxxtsrrpppvlj_ULCDAA>>>?7ADFCEGC=DLON^k~ЫЇ…–““”‘‘’’÷„„ЎўўўЏџџџ№№№Ёёёёяаааббвввгдддееежжзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€уутсрпоммлйизедгваяё№џЏў„÷’‘“–ѕќЌћЋ…»«∆≈ƒ√¬Ѕј≠~wu{{{wvsrlppnkjj^TLGBD?A=>>>;?AG@>AC>CGJHLV]hr}ИЮЇћ”””‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяяааабвввггдддееежззззиййййкллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€утсрпонмлйизедгваяё№џўЎ„’‘”—–ќЌћЋ…»«≈≈ƒ¬¬јјЊіy}}w{{{wwrplvnjfd]<=>@>?=>;==>=>;;;<9==>=>:B<@7=9=>?>=8<>C=C=>:<=?<=<>=>@CDJG@DKU[bhnyЗЮЄЌ”‘”‘‘‘’’÷„„„ЎўўўЏџџџ№№№Ёёёёяааабвввггдддееежжзззиййййкллллммммнооооппррррсстттттууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€сроомлкйзжегваяЁ№џў„÷‘”“–ќЌЋ …«≈ƒ√¬јЊљљїЇЂГs}{}{ywvrolp^UB)>47::::99999;4;==<=?A8=<=<==>=>=>:B==5BB>777>DLUcrП°є»“””‘‘’’’÷„„ЎЎўўЏЏџџ№№№Ёёёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рпомлкйзжедваяЁ№џў„’‘“—–ќЌЋ…»∆≈ƒ¬јњЊљїЇєЉЖq~~|{y{ywusojs`TKB;:9:::9;98889@9;;;;<=E=D=B>?=>=>=>=@BCCDGKNQQFS]mvГ°љ„ЏЏ÷”‘‘‘’’÷„„„ЎўўўЏџџџ№№ЁЁёёёяааабвввггдддееежзззиийййккллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€понмлйижедваяё№џў„’‘“—ѕќћЋ…«≈ƒ¬ЅјЊљїЇєЈ≠Нyy|||zyyywwuqke[@5&:665778598738:9589:4<:=6<.<9::=:;7:7:<=<==>>>:AAC?A?DD?:CFTWl}ЭЄ»—“”‘‘’’’÷„„ЎЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццчччччшшшшщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€онмлйизедвбяё№џў„’‘“–ѕЌћ …«≈ƒ¬јњљЉїєЈґЈЖy{z|zzxx{ywwwon^N>51:9?788=8:88478889:<9><@9<5@:::F;::>77==;=;>=>=?=>?E=ACINV_ct}РЬњ–’’”‘‘‘’’÷„„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€омлкйзедвбаё№џў„’‘“–ѕЌЋ »∆≈√¬јЊљїєЄЈµ≤Уwx|||zzxz{ywyvmd@@8::;8=788<48774779999:6<6>9:9>9::A777=37:><=<=7;;;:=;<9<=E=B>GHJKIMNOZeq{Р©≈ќ“””‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммнноооопррррсссттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€млкйзждгваё№џў„’‘“–ѕЌЋ…»∆ƒ√ЅњЊЉїєЈµіЈЗzt|||~|zxzywuwudU*65=:98=788848575779959H7:6<9:9<9:9?677A6<9:9=<>6:::7;9:9@;B:<9A==@>991<9:7B887=887778599>7::@:G966=6@696::DACDAR]dcu~С≠…Џ№Џ‘‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббввггдддееежззззийййкклллммммннооооппррррссттттууууфффхххххцццчччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€йижегваё№џў„’‘“–ќћ »∆ƒ¬јЊљїєЈµі≤µВВ~{}||||z|yzzx|tti430<:<::49695858/74577.96:7:7<2<99,95755478=;;)55:5:995559;887555;5555111945.9569769176::707;:5KZjwТІїћ”‘”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€изедваёЁџў„’‘“–ќћ »∆ƒ¬јЊљїєЈµ≥±≥ѓzz~w{zzzzxzx{xxtxvvdMG9:7>:C5969265555558?;?378D6969555=877857788;6<434B5515236>55263:64046<5@INQVguГО•¬–„÷‘‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммнооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зждгбяё№ЏЎ÷‘“–ќЌЋ»∆ƒ¬јЊљїєЈµ≥±µСЕ~{}w{wxxxxzxxwxtztvdZN;G<7776:295<555;5556.:463;9=265645454545595<375B6615455;555735997:5:024=4412.217.211/5/5.249297=64>CENUdj~П™√ќ“‘‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€зедваё№џў„’”—ѕЌЋ…«≈¬јЊљїєЈµ≤∞≤Єmw{{z{wwwxxxxwstt{rte^Q6=566654466669:>7:69565<7;8J7855585545563367665=44142210.=21..01112B00/3///6/-28589>;7DNRRXclВОҐЈЌ’’‘‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€егваё№ЏЎ÷‘“–ќћ «≈ƒЅњљїєЈµ≥∞≤∞vyv~|||{{zwwxv~rl^En}uwqeU0C=;77154515175819695616565555566:<>766969585;57170959561536666666591111040/*110..111111..,.,...-/273133373:;0!))6:KVmГТ§Ј“”‘‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дваё№џў„’”—ќЌЋ»∆ƒ¬јљїєЈµ≥±±µШzw}||||||zxvvptvj7VkuswuaV3B>=:76656555>6=9966565<566656569>:H7,4<697=7?55585=:@6=57677736355D55100>0...11...0.5.,***.,.,.-/0;1-.-/226336C;3DKQJX_mxЙ•¬џЁ№„”‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€гбяё№Џ„’‘“ѕЌЋ…«ƒ¬јЊЉєЈµ≥±±єz~w{}zzz||zxxxvszxZO_k{w{uaU7B=:29551654.65945554514.424144516591115240514*1265959.9677733/225371510,1.11110+**+)..*')),)*)*+,,0.,++*,,/-/+3211:.:-79608:CDW_kyЛ•≥¬ќ””‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррсстттттууууфффхххххцццчччччшшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ё№џЎ÷‘“–ЌЋ…∆ƒ¬њљїЄµі±њ†j{АА|z|zzxzxxxxstpP:prxstpxu{oiZ@E8;+557154515084144$307-415.465.845+445)442'4.3,1254645+5.4&404*44112.11.,////1//*.,.**'*'--0+/&-+/.,*++++-+++++,+**,*****.,.,*+--/0003,2+&!##',@QbqДЩµ ѕ”‘‘‘’’÷„„„ЎўўЏџџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ёџў„’”—ќћ «≈¬јЊїєЈі≤ѓљАzБА||{{zzxxxxvsPll`5;67577555.5+104043734451222,95956166666699542242425254434340411.1.1,..11221+00/,....//.,/,/+/--+++-//,/,+*+,--++,**)***',*-(-----,.*.,.,.12.4.41,','6CVcuЕ†ї —”‘‘’’÷÷„„ЎўўўЏџџџ№№Ёёёёяяааббвввгдддееежжзззиййййкллллммммнооооппррррсссттттуууууффхххххцццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џў„’”—ќћ «≈¬јљїєґі±ЃєМtrr{||xxxxxxxxw_9>8858575535145<5448485=444929696=5763365:642445454:444545581448.81:...41226-0/-...7,--0---/+0,,+,+,-0,++(,,----+.+++0*)).,=,/-//.,,)**.*,...:....*.,5:>DGW`p~П®√“‘”‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џў÷‘“–ЌЋ…∆ƒЅЊЉєЈі≤∞≠њАjNsyxxvvvxvvx{{E5npstvtvh Nsoio^MEC=6<6656453545466<6517055:.4472656393633+3362212244526122414450115&4.6,.*1,1.2-/--//,3+,,.----&,)*(+(++,+(((+.+,,+'/),*.)*),,6(,)-,.**')),)+,,.4.,*,,1.4546677>HNYct|ИІƒћ—‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййккллллмммннооооппррррсстттттууууфффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Џ„’”—ќЌ «≈¬јљїЄµ≥∞Ѓђƒq_Myyyxxvvxvrgx{ODssttvvve:^xroim^PHC>676766444546599=6505.35:.447263323233=+22412142445241.2:2.121205%..1.4,.,1..///-/-,-+++-,-,+%)'''))((**(((,.*+++'2*1*,*.*,*.'+(/,,*.%''.)*,,,.,1)%).*,../2+-),,,2:FT_n~К©Њ —”‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббвввгдддееежжзззиййййкклллммммнноооппрррррссттттуууууффхххххцццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ў„‘“–ќЋ…∆ƒЅЊЉєЈі≤ѓ≠™«bYw}}}|zxvxte[rvlVttwwxvsfjhvrrkk`NJC@96676766455999:>6655115>2526663666233E633424254545452,2=4.2424.:+.121:122411.1./,---++,,/,,,))'''*,**('***.1.,---6.5,..4*,,,'*+1,*,2'').),,,',.4*#).*)***//0/441:4Wk}НЂ¬Ќ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежззззиййййкллллммммнооооппррррсссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€„’”–ќЋ…«ƒЅЊЉєЈі≤ѓ≠™І≈H9Рџ~wxvvsvrL*vtssvvvvxxvttstrrnlePIDA:87A7=775559545>425F4.5=5=5555467=777;6765455;55225C66333:454<24.22:5D4445491..11=1......,.6,)*:...C,,*,*+,//706.1.4.5.-,,,<))+-+*).)))**,.8)),9,..9)#')'**,))***+,/../367;3DKNOYcqЖЪµ«—‘‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббвввгдддееежжзззиийййкклллммммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷‘“–ЌЋ»≈√јЊїЄµ≥∞ЃЂ©¶њ<=ҐХzwxvvtzt7BzwzvssttvvvttrrrvlljUG=>2737+777.545422501395455)53301*5573737-3443535%22227263335/224.1.1.2151..214..*.).,.,,+,+...***0).01)))*++++$/+/!.,.&+"+***.))))'')%'#'')).'',')).%''''')''))''(+)*&,+--/20,/02/23EPbrЦѓЅѕ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддеееежзззиийййккллллмммннооооппррррсстттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€’”—ќћ…«ƒ¬њљЇЈі≤ѓ≠™І•ЄK7ТАxvvtvvvs^PzvwvvrvvvttspgpprlnjUCB@666<2::949565444105555550:53012<56675629555555.44457376636044412111.1<1.192411.1,,.4..,..4/.+++.+-.0++**+2++)--.)4..*-)+*,,0**))')&)))')''*5&))*''*5*.)'#'',)'*/(&',*)),+,,,--,--+-02:;=HUfrФ∞ƒЌ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежжзззиййййкклллммммнноооопрррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€’“–ќЋ…∆ƒЅЊїєґі∞ЃЂ©¶§±Y[||tssvvvvsgxvwwwtvvvtvplfjmvltlSIB=466:4:<:496:9644115557553855046:566625181455354445466633232222222210.6.129244221...2.++.*2..+++.)-.0...,+0---///+1////-*)*,.**)'')*,,,*,'))1))'+*''4..))'''+')).)&(+)*,,+--,+++,,+/2/66267:DJRXfl~Ґњ»“‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяяааббвввгдддееежжзззиийййкклллммммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘“ѕЌЋ»≈¬јљїЈµ≤∞≠™І•І™cvwwxrp`vtxvxxxvxxxvxvvsvpbNgmtltjUMC=586649<:5:6>:84414555758455802555666151;1449494645465533122222222211.1.12:222121.....++5*.+.+.+5*-.003..,0-/-//-+0-+//-+)*,+**)(()+4,.,,',)*)))5*+'4.')+)#'*'))+)&(+)*,,+--++)+++++-)-00/-'+,/1=AG\kt}†µƒѕ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёёяааабвввггдддееежззззиййййкллллммммнооооппррррсстттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”—ќћ…«ƒ¬њЉєЈі±Ѓђ©¶§™•hwxslppSwswwxxxtxxwxvttrtsP%kmqlpgYMB?7;775:9:6:6B885545454559555;11444445455=444<4<49142424.222221212121211024<0/-0.1....)*.;+..0*.+;...0.5...2/0-00/+2-++++*'*++)*)))*,9,**,).***++9*+*5) %+& )*%)).)'),')*++++))')++++-+,//,+.0.26@:,:FMOW_mАЩє≈ѕ”‘‘’’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббвввгдддееежжзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“–ќЋ…∆ƒјЊїЄµ≥∞≠Ђ®¶ҐЂФn{xpaoqwvvwwwwywywwwwttrvv?.mpvmtg[J8=3;5559662616555514130131353422242215.44401252429,212.2&21213/000,1.4.1.442,-(0).).++%.,.'.+.)+)...+.---.,.-/+0/0+/++)+))#)*+(****.*,'))*'*)**.))&''*'&'%'**)'*''))#)'+'+++''')*,+-++-/+))* *,.).))'##'4>N\oБЯї»“‘‘‘’’÷„„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддеееежзззиийййккллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€“ѕЌЋ»≈¬јљЇЈµ≤ѓ≠©І§ҐЂВv|whjl£zxwwwwwwwwwwwttppsW2vsrllg`JC@:@998986695558555444334115566656454945522446666F5424272>444@220223292419441..5.000...4.1...../...0.4+'+..2120206/0--+5..**+4*+*++5,.*'*,)**.,2*')**+**()(**.).)*)'))'***))+3))*+)--/+$+7*))*')*,*-+)*.0<6.29CGU^lvЗІјѕ“”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежжзззиййййкклллммммнноооппррррсссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—ќЌ «ƒ¬њЉєЈі±ЃЂ©¶£†ђЕxuUsШ≤£Рx|xxywwwxwxwwwvsspegzrspvl`S?@6;4849892644,65555554544140966553545'4444549695944122445+2252302332624141211.0.1-001....).,.).......++..1..0//-0'-++*.,.,++/&++.*...'+*+)--,'.,*',**()((&))*'*%)))))'***%)&,')*)!++,-)+,''))))))"))))).**'/,003232?G]nК¶Љћ”‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяяааббвввгдддееежжзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€–ќЋ…∆ƒЅЊїєµ≥∞≠ЂІ•Ґ†®ВfhiwћіРЗsxwwxwwwwswqwwvrsplptprjpn^SFC99595C9C8=694=65585<5955454B995;575;.55456599<665544044519453:22333>3412192....<..04..//,//:.1...0.5...1...5/0/7--,1,..9.,,6)*+8**+,*.+.+.-,),+,).++)*))(+*0))')).)*).**'*).)*))'+++,+))())*)))0'*)))*%*)))-+,,2./16DLU]pСѓЅЌ”‘‘’’’÷„„ЎЎўўЏЏџџ№№№Ёёёёяаааббвввгдддееежжзззиийййкклллммммнноооппррррсссттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕЌ «≈¬њљЇЈі±ЃЂ©¶£†ЮН[Nt√ЄМКЙrrnrsvvvvvvvtttsrsrplllnlpnbBBA27351<585<4;59555555044944.>46450559+55:2545454;5401+021242212333333,2.4*212...0+...,//00002*//.*..1.1..,,+.,,(30-,-+,./,,.,)+)+'(*(*,,,,**,*)))),)***))())*))''')#.''''''')'''''))('))+)+)))+',)*'))'&''')'%')0))*-'+./('#$$)+?O\ltЗҐЇ»”‘‘‘’’÷„„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддеееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќћ…«ƒ¬ЊЉєґ≥∞≠ЂІ•ҐЯЭВYyПњОЛЙzlofepwvvvvvvtvtvrrpnj^jnjpnb@>B:;755<585A8=98585777355<452C6969485;144<4556555<5414012246442245322514180215..11.0..+112.023110....1.1*,./,/..060/,/,+./--/0./,+(+,*,...+++.,**)',**++**&))+**)'%''4')))))))'''''''''*+++++++/+/**')&&&''''''')3(())))),*,,-037=:7DNV^gqА°Є…–”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежззззиййййкллллмммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ќЋ…∆ƒЅЊїЄµ≤∞≠™І§°ЮЬБПљљПНЛШksmaRm{vwwvvvvvvxrrongBdsjsjbV;A6=7545585<788;074858155624.65659.555.11404595955110504554644462520051201.1.2.12..0.0"/21)00410..+,,2*1#.././//1102+/---0-//2/0//(//.....+.++,,,)%*).*+))"*'*),*)!')*%)*.****''(*))'''))+)+)+)+)+))#)%&&'''''''')&(())+'''%',)+--+)!&&,251FTftК¶їћ”‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЌЋ»≈√јљїЈµ≤Ѓђ©¶§†ЮЫҐЙЉСОМЙ¶l{f=dmrsvvvvvttsspplgePTsigfba=<=C::55688F887E785=7=5766555<566@69555554456>6>55101;154533224I5<444C662211170/...60:021/-01600.0...B2>..../////70700/-.7-//7///3,//..0...<+**,,*),,2,.**).)**4,1)*)2).,9*,,1((*/*))*)*)+)))+(&&(()'1%%&+%%','''')+)))9''%&>****+),3/15:9412FVdrТµ…ќ“”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЌЋ»≈¬јљЇЈі±ЃЂ®¶Ґ†ЭЫЧШТРОЛЙ§gwZVjnsvxvxvxvvsspnlg^7_pisie[9B<<67454618.43744)748.54614462337/60555454425,41400041213-202,646224645120//2--*/.2.2.1..,..1....),.412,.*,...1./*1.0/-*-),,0--+/(,.....+*.)*'*))#**.',))&*&(&*),**),')'*%)),('))')''')'(''%'#$#&!%%&!!!% "#'%'''))%''*###!#*&''((&(+)**,*+)/..//+=GR\pП©њћ”‘‘’’’÷„„ЎЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ќ «ƒ¬њЉєґ≥∞≠ЂІ•ҐЯЭЩЧФТПНЛЙФpraTlptvvtvtvttsspplgMNbljlgeXDF=:9966586<475755.55A575=5556256736485775554514292414494;27241229122124232002/0/212..,..,.4......*.,1....,....6.1+./9/)++*,,4..,,+-.----.* *8+**,',.4,.*''.')''),*,***()(%)*5)!('(*)''*'''''(%'&+%%%$!!!%"%%'''''')''')%#%#%&#('(&!(/)'))(*),++,.+/6786956687;55555;5626565:5:5768154447485=46495>2669144<2212.**,.6.1136737142600.,)...+..2...2..*2./0600//.6,...,2,///+/,1..)1+++0--..,,,.+1)2.../,,+*(*+,)+)0)&+/**(*%()1')(+()****'(&()(!&()&)&%$%&'"*')''')'#')%(&)*(''%'('#$))'')'&''+&'')),**).)...),,;NYirzН©њЌ”‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћ»≈√јљїЈі≤ЃЂ©¶£†ЭЫЧХТРНЛЙqwvvvtwwttsssttsqssqpqppnmkjjk[5B697?596944455:56565;5524455;4;58594414354;5C566;6C4659445@41.41'),.=1126373:3515+...,.//,..4...5.1.5,.17220//<.1.,,2+2////,2//+4+..3.......,*5.4.,,-+,,+++,/(,)3)!+1*(*.(()5**'+)(*+(*()#&((&&%& ($&$%&)'.))'''*'!&*''()())'%'((&&))'''('().&'')',''')*,*1.5557=FLRV^n~ЦІї»—”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћ»≈¬јљЇЈі±ЃЂ®•ҐЯЭЪЧФТПНЛМkqvvvwttwtwssstssqqqrrsqqpnljejb1>*66:.95615121445552612111427.555571001.50819156767.20324454.),4,',.1..13220300.,&*+..1/0+0..,..1.1..&1.202///2...+*/&,////*/..*.*+-0.0.1..,*),,.,+++)+,+*.,,#+)*((++(*))(((,))$)))(+%(()(&&%%#"" ""$&'&*''''')'%%'%'&(&''&#%&(&&((''%&&'''%'%'!'!)%'')")%,',$2 (("")9G[hyУЂЅћ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггддеееежзззиийййкклллммммнноооопрррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ «≈¬њљєґі∞≠ЂІ§ҐЮЬЩЧФСОНК†mhvvvwtstttssqssqqqpppppplljjejg5E<:9@:C9:6=544246541;0....22=57787=51354;5@8<556766422445452..'/....1..17333621..++.1170707.....225330511/0/11622/,,2,//,/7//,/.......115..,,,...-//-,+,,-;-**+*((**(*+*)))),*,*++-,4)**/*/)((&&&%&&"%"&''.''')'''&&'%%'((&&$%$&))&((&'&'''''')''%%';'&'.'').*,,7-///06:>CGQT_eqЕЬЉ»–”‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ «ƒ¬ЊЉєґ≥∞≠™І§°ЮЫЩЦФСОМЙ£iuzvvvsstttttsqqsrrppppppnpljgsl9A:<9;8;855969955524.4..)),.4155546221445085644.5452212244541(,1//1/0//14242301.1.012/2)2/2..)1122224011.....1211//,/,//1.1,.'.11....,..1,,,....1/000----,/++**(***(*(*(++*)*),,,,,,,%)&,++*()*))''''&&%&%)'&#'!'%'''''))'''(&&&++)(($%%'&(&'%%'&"%&+%&%)(&")')(,(++++,.1*3.+'*1;>O]m}Ч∞¬ѕ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€…«ƒЅЊїЄµ≤ѓ≠©¶§†ЮЫШЦУРОЛЙ°i{xptvtsttttssqpsppppnnnnlnjjjpr78<=9999555<9966544:18..,*%).84558554545554545454=665659454@59,//1/826/1274=3322121213//-60211.<25232=2221...122/1/1///11@....*..1...4.........1.6/./.,....2+,***+*(*5++*1++*,*.,.,*,*')(6,+)))*))))).'''(&)''&(&''''''))*')'+&&'*++),&'%$',',#%&%&(/&(&&&&#&''')'!((''*.)-*4)*..5>A=R_itБЦ∞¬ћ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммнноооппррррсссттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€…∆ƒјЊїЄµ≤ѓђ©¶£†ЭЫЧХТРНЛМХhwoprrsssssssssrpppnnnplllljjjlp559:888855594625441816'...',15155655,616554402055<15165705/:06,////60522153:3202122412//03-212292310,92111...111+/,//....:......)...*2....,.+...,1*,++*,*,.0(+)*+.)**1+,*/*+(+*+*+**+) ')0+))('''''))-''')&'&'&'&)''''''''!(&(#&())(+&%#$%(%'!!%"&&*&&%%%%#%&''''#$&##',')#.)*',030,/9>EHR[hrД†є∆–‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€…≈√јљїЈі≤ЃЂ®¶Ґ†ЭЪЧФТПНКТЖlrfbvorssqqssqsrpppnnnpllljgjgjg79585;8989554625484416)112*122164445,<2<554401.45612165509.2.4.9/./90424252525.1.22416//03/61224020/,71111...4..,2.//....1.1...9)...*.....,,+.+.*+*.+.***-.5(+**+5*.*,*.,,++(***(*)*+) ')))))('''*''')'''*'&#&#'')''''')''!'&+#&'(''(&$$%#%%%!!###'&&&&&)###&')'&'%$)!%''+!*'(#*+-*0#(*,('1=EO\gt}Ц±√ќ”‘‘’’÷÷„„ЎўўўЏџџџ№№Ёёёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€»≈√јљЇЈі±ЃЂ®•ҐЯЬЩЧФТОНКЙ|qmTOzoosspsqqprrrppopppnlllgjglgB=575<7;8=5879565<542<444515444922455@5>56454414554456254=44442>2.1=142424454611141216..1427131220/-0;0/12..151.17//0/...0.1..*@11.1.1,.....--++*+.1.1---..8..+*.9,2,,,../,-+))((*)***))()+****)+-))))%'),'''%&()*''''%*'%')*1%&&&'''(''''%''''%''')'&&((,%#&('*'''&$,&'''.),''(+),+0*+,..)47;7>COU[hqzФ≥¬ћ”‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€«≈¬њљєЈі∞≠ЂІ§ҐЮЬЩЦФСОМЙv|rd,R{ropsssrrrrrrproroppnlllljvnI=47385;7;387;57575616555:1556421644454:26142511442446.4454542.44414,114.41512.2.2.1,2.11423030220//00//14)002.2.2/010.0...1.1"111....*.....--***..0-0+0.0..+..++.*,,..11/,/,*')(*())*)*)++*)*++-+)))) '**''''')*0!''''''')**"&&*'&&&&&''%''''')'''''%''(%%('%''('&&('&))#)')#'')))')')))***,,,/-)'!%'5@UfuВЬ≤∆—‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€«≈¬њЉєґ≥∞≠™І§°ЮЫЩЦУРОЛЦo|rTHKzsopppppppppppoooompnlljjgntP66:7;9>8?8;8B88786<56559G986C4.4D44455D9D544<1142455>56454655244921143;5?5<554:45242<252:363622230000/01>1115061211.0.8...508.115../1.1...+--+--4.5.51:15.,.<....,,-..2.*,2,,)***(()*)**,+,)'))++)))1)+*.))'''))G'%''''''')))& '=(&'''''''''')*')')')''',&#&'%%$&$#'+&#')&').')))()&&&%'''))*)%*.,.055;BDOQ_gmzФі≈ѕ””‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€«ƒ¬ЊЉєµ≤∞≠©¶§†ЮЫШЦТРНЛ®auo]9]roopppoopooooommmkklllljjfjlP<48,86:.9375;77555815*55:5746.226242426484416.444242414222544.2141.03'537)71515.422.623/3000302-2//001..4,0.1*1,1..,,%...)1..*,,1.--/....++-+)-*.&..0,2.1,,,1),).++)*)*))).))%*'*)**'''***'''&'+))')'))*''%%%)%$'''''''&'%&%*''&'&'%'#'%'&'%'#'%'#'&(#& %!#!$#%''###$&))!''&#$$$$$#%'%'''')')*+(./4((',/22DQh|П®Ї…”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€«ƒЅЊїЄµ≤ѓђ©¶£†ЭЫЧХТРНЛЂauqa\gpoooopoopoomooooomkgljjjgfegPC6:4<8F6;587758755;561558785525454545455@544:4:55454225424<55242:101=.55?15353206221<3:230-2:23/20/011.19110;.1121//,*.05.5..+....///,/.9...--7..*....1..,..5..,.+1*&)****.*,)5*,*,)'''*.*)).%)*.)''''))*).#'&&"%$4')')''''')'-''''()(('*%''''('''''''('(&'%*%%#+$'))&'&' '')'''($&&&&'''$'')'''&%#)4()*0**)+-/06:8KVfoxН≠јћ“‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∆ƒјЊїЄµ≤ЃЂ©¶Ґ†ЭЪЧФТПНКІbusjrpprroooooroomoooormkjljjgjgggSG.;1<9B9;08575855495505.5575646664966550;455828565854555409152426+358)3080414210511.6+7232/3700/200/1...61216'214431/14150400..,../-/--.6///0-5...11.....,..40..+'0.)*+*,),*,'4,,'+))*)*.,**. )*,)''''*)**.')&''&&.))''%'!'%)'+)'')()((')&(&''))''*)))((*'(')%%%*'''(&'&'#'''''')&'&&'')')''%&&&%)/()).)*+,-//0,+/5:BIOVcpБЯ≤√ѕ‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈√јљЇЈі±ЃЂ®•ҐЯЭЩЧФСОМУЪdssrvrrprpooooroojooolrnljjjggggjjSH.<1=9<9=0;588@754;5919.95;6<45664>665;0738551556585555550=044844+454*;070212210500.2+7262033///20202.1141511'6244:2/45150002..../////-.6.//5.0.*.11......1.00..+'+.0,,+,*++,)6,*%+**,)*,,**, )))))''',*.**')&.)'&'))''',!*'))*))'*'+''''&'&*&)*((.)))((,'''%%%%)''',&&#'%'''($(-')&&*')')'%"&)&&)*()).'*(++,+)&+(*(****6CN\bq|СЂЅќ”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈¬јљЇЈі±ЃЂІ•ҐЮЬЩЦФСОМРВdrsrsrrppppoomonnhnpnlpnljjggggeglSH5<4>9:9>4<699D855<5<5=5<8=6>15564B665=5;.9554446695645.65D041;44.1141?491213351500.21;270000--.1,224.22416111:242<111518./,4.1.//0/00/.:...5.0.).......1.5-0.-+.+,+5//,,+,-/,<**'+,,**,,+*+/(('')*')%.*.*)))%0%(&%')%''2).)+****')(-'&&('''+&()()/(('((-(&&#%%%*''&/##%'%''*'")0')&'%,'''))&"#%*''((%**.'((+*+((&((*+,,.169567NRW`nБТѓњ…“‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггддеееежзззиийййкклллммммнноооопрррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈¬њљєґі∞≠™І§°ЮЫЩЦУРОЛБpftrssrppnppoomollnpnmmnmlgjggegeekSH.:*66756.566665548451<066645-356.5451545"41412.5564522'645+1*524)..1150211.31304./+2,/.0////,-.1#212*245.1..16.2.2,400.2*.'2*../-/-20/*.,....0,*,.,.,1....&..+*...*//,++*+,-(,#)!,,,,.-+***-'(%'')'' *')))')%(%%''#''+')',*))*%'''&&&(''''#&('''$'&&&(&&(%###'&&##!"###)')(%()#$#%!%%&&''%##!!#&&#(')!))'))''#&&'(&&(#)),&+-&"&12210///220..,..-.50..1...9.,.0...+...../////++--,.,.,2..+3-**+,8*+)))**,*4*)),,.'(&+%%'*)**+'')0*')1''')''')'''.''))'&&)')((()('%'''&'&&"#%&&.)+)())& '&""""&'''''#!!&#&,'''.'%'''%'''&&!()('))'',+-169729:MXguВЮє»ѕ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒЅЊїєµ≤ѓ≠©¶§†ЭЫЧХТРН†dhrtssprsrpoooppplnlllllmklgjggefddadF4<997;:;77:;776616696=7799870537455616454516599959552226250028586564475412.42424/2022/1//002+..1#242'206002229.2,1-5...41..521./---0/0..'.0.-0.001...1.++./....1.11. ,,/,../',,...,,'/-*&*./*+))))***.*)%**.*)"'%)*,)*,*%)*+*)')%')'%'''''')&'')&&')))(((('' ''&&'&& %&& '')))''$&)'%&%&%'''''&#!###''%'''$%#'%%#'&'&&()''&'&'*)(,--(,+/'))..BQcsЗ°ґ»“‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммнноооппррррсссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒЅЊїЄµ≤ѓђ©¶£†ЭЪЧХТПН≠crpsrrprrrpjnnppnlllllklljjgggeeeea]dF499:9?;A77:>7>7A24596:7:99850557566:5A62595769695;55244<44002>6>6<647B66242D4544040205/,/126.1.6,144.416112424.9.108000100010../.+/72:..,.00.10.0214..,,+./0/0.2.1/9(//5,..5+,,....2,-,+(*+++5-.*)),+5+-),,4+,')&.*4))*)'1,+)'')%'')'''''%','')/'')0++))(''.%.&#&,''%&&("'',*)'(&'')&+&'&%%'''&#!!&*'%%'''%'%'&&'*'*&&&(&(&(&((*(**)'**/'(),.4=FQ\cku°њ»—‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€√јљїЈµ≤ЃЂ©¶Ґ†ЭЪЧФТПНЂdvennpnpnpplpnnnllljjjjjjjjeeeeeeda\`H.:8:8=9=777;7:6;224659675615.555566:/=73676726565955122844.1.92817221=66454@45.4.2//.11.122511.5,222.415111212*4.005.2.0)0..)+*..,.6.6...1.0+1...1.1,,*+*-.//0/1,.+2,,+/#..2,+&+,,,1,,++*))**1-.)))*'1++*,,2)*')&*(."''''.**''''#'%'#'''%$&+))'+''#.*+(*'''*!)!%#*&&%&%& &')%'&''' '&*%&&!#%&&#"!#&(&#%'#'%&%&%%&(%(#%%%$%%%!&&))(#'&)),(**,..*59:6:=IVcctФЃЅќ”‘‘’’÷÷„„ЎўўўЏџџџ№№Ёёёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€√јљЇЈі±ЃЂ®•ҐЯЬЩЧФСООЫfvZUllmlnppnpnnnllljjjgjjggeedeeeb`[^J.=:;787979776656445859553;04.;55566:-77=7767266=5555111449050904.1120735455<44.5/5/../22224<1704,224.6241211.4*1.112.214)0..)0+2000:,5.1.102.6/.....,,+++--/.0/2**).,,,+#..2--&***,.,++/***+*.+,)*))'+*****.')'.&&&(",)'&+*,''''%'%%#,'''&&)))''''#)))')'''.#'#'&(%'%.&'"&&&")%'''!%%&!#&!#####"#*&&##%%#%%%%(%%%%#%"%$$!"""!!$.*'!'&*(*(('().%,-)"!!)044CW_ktЙ£Є…”‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€¬јљєЈі∞ЃЂІ§ҐЮЬЩЦФСОЦЖksL.lmqmpppnppnlllljjgjjgggggbeeebb^bL.=;=37999:97785755787<555=045?77764<277A7:77696B565544454@5:4<00+..22754455>454657202444245@083514444944,4011642122524462100+505.31=*6221424/56555G9K555;4B.-)#2.4411445454542254=442441.43<3A2'1<441;1414444636224@2119..190111.84D4400/0///221111=10.5.0262F19./////-.-..;.....,+9+.+/,,,.,,,=,**)))****)*)*+*)+*+*+*.*.,1*)*.)1'&'**+'+))')')'''.).*1**))'''''.)'&%'+&)',''''',','%'-'1*-&#''&5(.)*)($(''&%%*&%&'%''''$&6(&%'%.&&'''('(*,)0+*'))/*+*++0/233=;70KYhyЖЬЄќ—”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЅЊїЄµ≤ѓђ©¶£†ЭЫЧХТРХbnsh:@pplnnnnllljlljjjgggfeeeebdddbbb\\N'5+63659,937.5580555)5.53555+31335585:58696:16591455)959.31500%+'#.,10404151202/..1.2,1.112)005)51..1...1.0+01222121112,001 /01.000)1/5//+.).).00120005..*0...2)4).)*++&-*,+*,.*+++**(/(*',+-,,-,'.,+)'&'')''')''')%)'))*)*',),''!*'*''&())(&)''''%')'*'*''''#%%%%('&#%'' %%'%#%#'%'"(()!))+(('#!(&*''(&$$"&$%!&&&''''%%%$&)#'##%!&&'&&!#'(')''''&)''#()+),++&-//.+#/2@GZh~Ы≥√“‘‘’’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€јЊїЄµ≤Ѓђ©¶Ґ†ЭЪЧФТП®`hrj[Tjjllnpnllkjgjgggggggeeeedbddb`b^^N::04114<3;553;5757581=4654453<5555686=6B9:695B8<575<085515340**.,* *.84;49484426001012.2./19/215.400.*....05..041421222..511+2210111.20400/0/<./001<1107...4...1.6,.++.0+2..,*.0**++++*/()1,3-,,0)**1*&'))1)').))**)*)**,*,*.**')'*)((('')5&+)+))''"''))*).'''%#&&&&((&&'''%'''%,%%%%'%&3)&#!())(&#''(''((&&$'$&#%%%''','''&()(,'%%##&'&##&')''')''')''')()(,((&++++((,.59@FJW_pzЯЉ∆ѕ‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббввггдддееежжзззиййййкллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€јљЇЈі±ЃЂ®•ҐЯЭЩЧФСОЂ^holjejjnlnnnnnlkgjgggjggggfeeddbbbbb`dN=811...5353507555856/96765565<7735961:6>99085<5;5749455545441.1221..184946152406444114.511/61205.1010.0000050001.5111211+514.555.411/20443342:2002060.+4,.04...1,4....1104.0.+..)**+*,*.*%,.,2--+/*)%.))&))0,',.)***+,*,',.,),)*'**+*)(''('1(,)+**')&'%''*'.''''&'(((**''('*')')(*&&&%&&&/'%##((((##&''''(*)'&'"&''%'%'%)!'%'()(+)''&&&'&&%''''#'(%&&'%''(((&+''''&(((,.*.044529BFO_fqМ≠љЋ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€јљЇЈі±ЃЂІ•ҐЮЬЩЦФСОЬ_kopojllllnnnnnlljjgggjgggggeeddbaaaa^aT4-0+.--10013-0142959-6777656587;1569155:8;1A55577=1548594545144=524425494402040;555418.=22/21108.5030822161015140=221514+2180859151//204233:14200500..*4.115...4,1...01000.1....*+*.+.,.**,.*,,1+,*.%++5')).**+1)+**,,,2',.,'*)*)**0*.)*'*(+(0)))*).&&&''*'('.),''(+(**('().),'((''*&!&)%(&'$%''&'%###''%'''('&+"'',%'%'#%!.%'')(((+!'(*&&&&&''*'#',%%%'&('+',''''')%&''**&))++.'((('/6EWbkuЗҐї»“‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€њЉєґі∞≠™І§°ЮЫЩЦУРУМ`mrpnlljjlnnllmkkgggeefeeeeeebbbb___b[VV.%5.40-.+..1+*,..94625556645.55<222:554;7=7G57787C44.95;0556156E6456254;1410054=55441:2C44/2.11<1503*<022<2125153D.2.616.22;495<461./102/00<0110.60200.91226...5,1.1,.00.001.-..+.+.,.,,*,*1)**2..+4*-);+)*.&))4&,+**,,6,,++'''***)1).).'.'+)3(''))1&''%',)'*1'.'&',(*((#(*.*.)&'()/&&*%(('&'''%''%##(&%%'%'&&+&'&/%%%'#%%2'%')&&&,()(,&$$&&&',!#'1'&&''('+!.'''''*'%''(('(&)(((**//2229CGNV_kuА£Ї —‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЊЉєµ≥∞≠™І§†ЮЫШЦУРУcmrpnnljjllljjllkggfeeeeebdddbdaa_^^dUMA&%;AB1)+$*))%)),,..1.0111422'52511*545155758057755.0%445)446.6577555.414.111.5142212.11422.4,1.2.1.. 1+0.211220314#.*2.4)114254412.////0...0.01/&/.0.1)21211.1..'...'..0+0.5).00-.-.++++$+)*'))++-+-++%+**)'''.*,*)**-+++( ''*))%)"'''''&'&("'%&'* '''''')),!'%'&''('(()+)*''())*&%%% %&&#&%' '%%!%&%#%('%% $$&$&!##%!##'%'''#$$(&(&($$$$$$!#'&'&&&&''&&'''''%'%'%'%%%#%%%&&'!((+,/!!!!!''*,GYguМ©јЌ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЊїЄµ≤ѓђ©¶£†ЭЫЧХТРГqkmrppplgljjjjekkjffeeeeed^bbb`b^_^][TPC7'5QD4..,..**,,***,0..-....42B5<412=4557555<557<53301554455>6=996455454545555C5444242125244=444544333<12111.142736..141:242222200/12/005...0..../112221212.11:12.1.1.103133J01.0--.6-//0--..+.*+**--*-)--.+*'*,@*,,,*,,,+)+)')*****+**)*'''''''.'')1****)')&)6'''.'''))*)*)))*)*))))(&&&%&&(&')*)*))'''%#%&&&''%&'('%%'''&())*''#$((((,&(&'&'%##*'#&'&!#!#&!%''''''%'''%$&%&&&&&('('(+/+,,/,'49=B;2CJctЖҐЇ…–”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љїЈµ≤Ѓђ©¶£†ЭЪЧФТПjpfoopppljlljjjhjjhgfeeeeedbdbbbb``^ZUNM'&&1:%1%..12....,***+))())+).05175545*115553715585525455545481767555545355545454444244544222655.544245511,122,002/1-001,4*422-232,21.*..0)..0..1222441..1.1)114//*..211+00105).)..0.1)/.//00.*+++*)**)*)*)-..%,,1'*)))**,++++))**),*,,+++#))+)),*))),*,,,)+)('+''%)'''))+++''''''%&)(%&((((&&&),,,,))'')'&%%''''&!((('')(())+)*'&&#''&&&(&&&(&'''''%&&(&!!!!!!&''''%'%%%&$&)''(''&'&&''(+(((*'',-(0$/(,))'8FZgВЮµ√–‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љЇЈі±ЃЂ®•ҐЯЭЩЧФСЮ[nkoppplljlljhhgjjggfeeeeeebbb`^`^^bVZGC +/:C6:0.1211.,..,...+)*-++)-.103131<.117553517566=5555555B56256A666655575G55454445345@442425454>55444<221457/2230207231@1543/02;2:22..01.01;..26224B2.1:12.212/6,..402.0.0.0-5.001.1,/--/00.,+..*))*++*+*...*..6)*)''.,,+,+.**,,*2,-+&+/).+++*+*))*,,.,**,*((/(''*')(+)))+)*'.')&'))&(())+''')*,+,))''('%%&1))')&)))''()'-++)*''&&'1'('(''','''''''&&*&##*!#('.')''%#'/&((''('(&&'''.),'()*')*+*0)-(++3*19CFN`hqzЩЄ«–”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсссттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€љєЈі∞ЃЂІ§ҐЮЬЩЦФС≠Rhfonlnkkjljjjghhggggeeeeefba^^^^\\\PQ:: 4:DLOJE=10)*'.*.'.01.--0-----..."..8..-53110.5355<55.444+;55445;565625055?04.44455244<.21412.44:3312'624,567"2020236-33<2422//-7/942.0011118*116122=.1.5'122.1.2...1+.......*3-000..,.,,-/-.,.++&)(+)-*+*,+,*,*2'))'',***+'.)**++.+,'()-).*+&+)+*()**,**(++*(,((')))()'''))*',')')')'((((*#''((+))(('(('!%'.')))#(((#'&'!+))(*('%%',%'%&%'!("%$%#%%#!'#&'*&!'''*'''''"$+$&&&''&'##&''*'*%''(((**)-)*'++1+.,3/1=@NjСВ}БМЖБКЦПГxmf\N5+ &).----"0144457541/++**)*,.,....1355402/212466955.6441415-755.412141424244949053555-355.4.224454537363324.4.1...110-40001*5.14424130103151....4&1.1*2251200.1*..1,,*..1121.'.,.+.+,,...,...**)*)**,*,)*)+.*()(*,,*,*.,.'.)1,,)))*).%,*,*++*'***'(&))*')&)))***''''*'))*+)+)++)(( )),*''*))((#(%'&)''''''%#!%&* &&'()%'#%'*''%%#'&''')'%'%)%''*'%+&$%##%''#&'&&&))&&''%()%#%#'''$'$#%%#'))#)*././%!$$-.DUfxЙ•єЋ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЇЈі±ЃЂ®¶ҐЯЭЩЧФТОejrlllljjjjgggjggggggeeddbbba^^[VRNF:><>?A;hУЕУБДДВДЖДОАТЫ§ЛxpfZF=3-)00.-....162>2=/0-,.)......,-.1122619124645454=42144;5B5339245;4:54455>5F53355535354<44244:4:5C6767464@/.0.0;343D33033;4541341101155A31..0B1:24254B241415...=...5121611.6..,,..,*,.+...,&*.,,,.,.,.*+,.*+*'),*,*,,.,5.5*'))))*:,1**)***'*)*)*)**6))'/)&)*)&'''6**+,+7)+)/++((&'):*'')(*(*(,)''.')''''%#%''<')''')&$$%'.''')'.')''''%''.'')5&'$'%%%#''*%#%(%())))')','#%%%%'(%%$&&(&)).''*2*-*++//1259@DDNUckБЧі∆ќ”‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€єЈі∞ЃЂІ•ҐЮЬЩЦФСycenjjljjgfggffggegeeedbbb`^^][[VQKD7=?@3F[jЖЕ~ДyААББВАЖwЖБИЕАГА{wve[PH5*!)+.$0)1'-//6/211.,,*#*#..1./+.12.1*114'.010515.1*41225'5444425.653155511.424///114,2.5.3233314#/21.304.500)0+514011101'-+13501*..4.2.21114,..101..,1,.,...#...).....,.,*')"*+..,*++****,,)')(+*+*)%'''''%)',)*&''')''.'*"'%&&'&'#'%'''')&%)((%(&'%' *''&((+&(&'''&&''&,''!&#& %%(''''%'#''%#%%%%) %'&$'($&%''#%'(')%'%%"""%%'%%'#!&&&''%%&#& #!%#%&''!''(&%%%'##$#%#&&'&'&''''*#''*(**.)++-,*('$),49KYoП®ЉЌ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€єґ≥∞≠™І§°ЮЫЩЦУУb\gjjjjegggfggggfef^edbab`^^\ZWUQKE6=AFGFImСЖЖВНАББДВДВЖАЖВКЖЖЖЕБРЕ{skTH9)$").)-..'++,/-0011.:*9,.*......*.212022=.004154;5@25244>0;5545440555395844194116/111.1.5.2215524,442111<1445.<154514431?-//45412.11211.42....005121..1.6.%..),.,*,.5.1...,)*'+-0.4..,*,,,.*)),*.+.+5),))')'*)*)*'))')**+**')''))')')')')'#"(&(()&(')'.'*'&'&))'''''*'')))*''!&&&#)'(())''''''''+''&,%'''&$&&&'''%'),(''&%""%%"&'%"%%%%'''('%#&&%#'&+#%%&&'%)')'('#$""#$&&&#&#&&&&'&'$''.())4**)*)'((',,034DN\chРЉ…—”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Јі±ЃЂ®•ҐЯЭЩЧФТ®L\kjgggfgffegggeebebbaaa^\]ZVULF92>INEfrzФГДВЕБЕДМЕЖДЖБДДЕДНДЖЖЖДКВДБДДДАОБОАТЙГААpeV=82266/%%#.!,.1..141B4D45:69)5530*4+008.2245G59431E5.594<5>255>554.272:422424.8154515354555.5481444452>1425291135571112.52612121.15..121516221=..12.=..*..4......-*+.,,+2+..1...4,,,+,-+//:-,,,+7*+('*/*,*+)**/*1).,,+,'*,*))))))))'*'))**/))(.'*)1''))'.*/+0++++))&((+*+)+*))4)*))&''*''&&%''*)*)*''%4'.'%%''*%&%%"'&.&''&"&&,')'%%&$'%%(,&*),%%#''%'.&'&##&&&''#&#&'$&&"#!&&-((%'&%&''.''&(&&&0*,,+)-/3662/=CLVcu~С≤»ќ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ґ≥∞≠™І§ҐЮЬЩЦФХУMckijggggfefgffbebcbbaa_^[]WTMG<3=?HUiЕГГВВВ}ДБЕДЕЕЕВЕ}ВБДБДВЖДДВДБВ}ДБВyВБДВЖ}ЖГАЗДВxsc\VH3' ')*',,.)-*114B9=66922#.'...)...142111)533542425.247132224.4242625'51415-5151424'52416245625,215.1.35333,.12,..1*211...2.2.1...2.1.....4**++%,*2..,,,1,,--,,++(,,1..,.*,,,+/&-/-+,,-**!+'((*',&*()(*'*%.,,+,''*)))''''''&(('))')''&*'''*#''' ')+)+&+))*'%''*+(')''')')''!&&*'&###%&))*')&' '#'%'!''&"'""&%*&&%%%'''''&$#'#%((!((+'#!'%%%& &&&##&'''&'#&'&'($$!#(*'&&&%%'"&#%'(%%"))*+)$)))*-$.+' &!'):K^n}Ч≠ј–‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µ≤∞≠©І§°ЮЫШЦУШoXfkkjggggfffgfeVeccba^_\[VWWNHC3?FD665<414B4?4;45564C444B544556565=2015513412291.12.6221*14292211121.../02>.,++//=11.--=0//2//-(-009..+.+*+,-7.--,,/.6.**2*+++,6,+*+*.*.,6//-2*(*)*,**'')*)*)*)))+'().))).*')''')++++0+***'')*)#)*))'')*)*&'(1**''% '**,**))')'''1''''&+(&%((8(&&!!%&''''-(&(0)&(('''1''1))'&#&''&#&''-''&!$&'-%$!!'2'%%''%'/'&'''.&%((*,++)))))......*27;?FFMS]ekrС∞љЋ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µ≤ѓђ©¶£†ЭЫЧХТГk_iiiijjggfgfffgbfecb___\ZV[O=DBA9Q^kРЖЕЖЕЖЕЖЕИБЕДВ~ЕВВ}ДДЕБДБДДДВДВЖВЖЕЕ}ЕДЖЕИГЕ|ЕГЖГД}ВЕЕЖБyocXOF.# &')*..12,4,456=6=4=57101.--.051314442622.222111537544656.511.5/445.445.6242535354555.645453212.12411..%2142105*412*12411/020/2.*,,///2.020$200/0/0/-00.1)+*-+-*./1.-++(..2.**,&+---1..*.*+*+,1..,.**,)'*,*))*+****))))$)+,')*,,**'%')*('$+',*))))*)))*))+))*)('(',**')''+*)*)*''')''**!'''%((&$&!*%&'&&&''#')()++)(''###''%),))'&#'&#&#&#'&&#%##%%$!$%$!#&'''&'&'&$#(%&((*-*+))'))-*+++'*,..0'40-00+7>JO_vУЂЊ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввгдддеееежзззиийййкклллммммнноооопрррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€і±ЃЂ®¶ҐЯЭЪЧФТlcdfiiigjggffefefeeeba_^][VURL@9EGLZkЙЙБВЖЖНЖОЖЖЖЖДЖЕЕВЕВВВЕЕМВЖВЙДЖДЖВВДЖЕЖБЖЕОЖОЕЙБЙЕРЖЖБОЕЕЖОБЖ}ssq_UFB84!',,.).*.1252648;55242110333.00154E11/01611145G52146F5@440404473549254:455835454925455<44261124221.,2264:4=142<.22=221/0//0..,,,///.006,20202/0/005..*++0-0*+/3.+++(..2.**,(+---/.,*5+*)**.,,,,**,*)***)**1+--+)**+(+,6)*)*,,*)'')1)('.*6,****+*1*))'*.)*(*(*),,2**)**)),*.)'))'')*'.''&((&&+&)&%''&'''%,$()+)*(*(,&&%'% '))+')"$&#&'&+&&&'%### $%%$%#!$"&-'&$&$&&&$%&,(((+)++*''*0(+++),*,++)/.1,/,04:::KQVUYxЫЄ ‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежззззийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€і∞≠ЂІ§ҐЮЬЩЦФЭW_ififffgfffcbcbeeebb^]\[WTO9F?:ATfm{МБВДЖВЙЖЛВЕЕЕЕЕДЕЕЕВЕВЕДЙБДВЖВДВДБВДЕДЕБЕБКДИБЖЕГЙГЕБМАББЙБЖДАxspjhaU<951'))*,,,.0.504459555=550..+40;(////211/33=33442@5<141414454446.2251445+524.51214262426.2242111.105*74924.9.116.2//././.../*///)-,3/2/0/0+/,/,2..,+*/(.)++1-+++',.1.,,-++,-,-,*%0))'**+*+*,*,,,'*))'))0*+**&)*+***2')%)))')&'(.('',)1***+(*','((''*'('('))+)0**'*(''*).)))'%'')'*#&%&)(&*''&&((#'''#*&(()'(&('+&&%%# #'')%'"#$&''&)#&&'####!%%&#&"$$$$'$""""%$%#$%*&(((#)),*'*-%++++*(*(()++0)..//20,7:0@;:@Q1QwЮЅ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≥∞≠™І§°ЮЫЩЦУѓOZififfffefebab^beebb^\\XUPK2><:MevГЕНВЖЕКДЖЖЙВЕЕЕЕЕДЖЕЕЕЗЕЖДЖБЙВЖВЖДЙВДВИДЕДИБЕБДБИЕБГБГАЕАЖБДВДДБАААsg_UE))'& %))++'5.0116455?<7@04.20/*////.03/0031354195:141419454555/4210414+512.1..1622244914242.2:1208)53544.41211,11501...../*///(,,1/302//*/,.,5..,,+-(0+++/-,,+(....1,-++,---,,%,)*)'*,*1,,*,,,',*))**0++*)&**+*&).''%)')'*')(+'').'))+*+(*',&)),((&'''')((',)*())(')(/**)'&.'(('#'&&)*((('&((("&'*#''''('(&'''&&''%!#%#%%'""!&'(%'$&&'&#%&#'&&#'$'&&$$ "$"$$%""$'&.((!,(2*)**%))-+'''%&())+'))**,*,/0$2/,+./2/5[=C=T=;;8554566=56565;5=455<555556557?55151@412=455B465<56452:5=44444545111;0.12112>1122.21B142446200/.1.'1:22///6/0///+,,,1.1111.-/++-/-//?/-.=.,.4.,,4+)-=.0....*,*)**+,,/,1+**,,.*.,/,2.5---+)+***8+*+=//,--/,,+,*+*/(6('),,,))(('(*+*+((&&()***.*,,*)))*'8''''*:)#(/))&#&((/*0++)1)(&0'.'&&%&.(&(.(''/&&#%"" #(8))))).''&'&&$$(((*(6("(2((()(((++6+1)))')*'**((1(+')'+))(-./../56:>AHNUbhВ•¬”‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€∞≠™І§°ЮЫЩЦУЧhXeefffebbeebbaa_^^[ZYUNJ6A9I`rНД}Д}ДБЖБГДДИЕЕЕДЕБИДДДДЖЕЖЖЙЖЙЖЖ}ДДДАИГЗЕГЖ}Е}ЗВЕ}ДЖДЖБЖВВ}ЕАЕАИДЕБДБЕЕЕГГБЕxДДЖГЕ|ДГ|}Б}{qhVO=+)/=A=::77737$726,;>DEAQBF==<5:2:*5455635.4.404450544451100+1...2,005&414.224'5462212122410.1*...'..2)021*1.4*2.42300/0/01,,1*..1/1(+#,////&,*..1..)/-///,-(0--,0*,....,.+++0)-).--)))''**,++*,*)#+++&++,,.,0+.+*%(((!*'))/++&++.++((')(+#+(()**)('&#&'((*''%&((*()*'**)''(('*)' '',''))%&%%%&%)%'''()'&%($'&'(&&)(&")&&%&#% ! !$)$'%((('$!##&###''&+''&'$$&&&&&(((&('((')'&&'&$)%&%&&&'')(*-.).+./2&6+,&1=UauКІ ‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѓђ©¶£†ЭЫЧХТБQ_jffffe\bfbbbaa_`b\YUZHA<3H\mПЛЖБДБВДДДЕГКЕИЖЖДЖЕЖДИЕЖДКЕЖЖЖЖЙЖЖЖКВЖЕЕГРЕЗГЕЕМДОДЗЕЖВКЕИЕИВЖЕЙВЖЕЖДМЕЖДДДМЕЖЕЖЕЖБЙЕЖЖЙГЖЕЕГДДОВБВБwm\SLNMBDHGEAA<;376,34;4>8C>HTBG;7W{Юњ”‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЃЂ®¶Ґ†ЭЪЧФФ[Qfjeeffe`eebbaaa`^`[VTT7DIPlq|ОЖЖАЕБДДЕЕЖЖКЕЖЕЖЕЕЕЕДЕЕИЕКЖЖЖДЖДЖДЙЕЕДЕГНЕЕГЕЕЙЕМЖИВЗЗКЖИЖИЕЖЖЙЖЗЖЖЖКЖИЖЕЕЙЖЗЕИЖИИКБЖВИДЖДЖДЖДЛВДЙНЕАpjeaYWWVSNIB=:<<688;4783:7C9C;>69055<9>CBFCTDCM@B;B.5505455575775054945686>65.25767666:55256:762:4545444=44220526..5632420022232202.1120100/2.//625/1*..0/030--,//0001124.1..%1....++&.+0,,,**+,5*****1,,*+++,,,/--+...,*))*+**),,*),*.,.'*).)***+,++*-**+)*.**(('(&'#((,&'(/'()-)('('''****((/)''*)*)*(*(()'###(&&&'''&&!#'&#%%##&%&"&$%!%$*!($'&(&&!$'('(+.('((((%%$%%($''+(-))))*0'(&())))((/-+0%*(+*,,4*,.0,,'3-//224/137367;@MV\]]wЦ≤ќ‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≠™І§°ЮЫЩЦУє=9:7:7:7:6<8>BCELORYlЯ»Ќ“‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ђ©¶§†ЭЫШХТ±8Zgbbbeebdda___^\ZVSLB7QdvЯЕАБАББЕДД}ДБДДДЕЖЕВВВБДБДБДДЕДБЕДЖЕЖЖЖЖЖАДВЕГЕДЖДДАВДИ~ЖВЙЕЕАЕЖЖБЕЕЕБЕДЕДЖЕЖЕЗВЕВЕВЕВЕДЕ}ДБЕДДДЕЖЗЗЖЕГЗКВЪ†™ј®ЇЃЮФЕ{vxzvtssngfbZNIAB==<=3:/9(6,648<=ABDDOCCD@@59,64.24565554+545.4373607551516263415242425.62200.1,22.23..15(/111222141214.40011.0+3-2,////100../.,.//++(,).....)...).,.*,(++,+-,+,,!(+,,,**)**,(),,-,-&**))),*),))')'**((('))****+++)*$*+)(&(+())'&''(((#)***++*++#*****))'.)''((*,,() (&(')'&%'''&&&$&''''''!!%%%&&'%$$!!$$#&('$&#&$&$$ &&("&$#$!$ %$$"$'+())(%%#&$'%''(&'&&&***))&'&'&((++,(*%,,+*,,.*++.$./2+42/.:?8)>N\gЮі≈Ќ”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ђ©¶£†ЭЪЧХФХG]ebbabbbab``^^Z[\UPF*HWsФОРЖДБВБДБЕДМДЖДЖЖЖЖЕДЖЕЖЕЕЕИЕИЕИЖИЖИЖКЖИЖОДЖЖИЕЙЕЖЖЖЖЖИОЖЙЗТЗЗЖЙЗЗЖИЖЖЕЖЖИЖИИЗЗЙЖЕЕЖЕЖЖИЖИЖИЖИЕЕЖИЗЗЖЗЖЗЛРЫ†І©™®©њ§Ћї≠ҐЩСЗ|pxzyЛДДtj\QNGJKIFEEC@<;:::7;.=@@@BVCVC]B@= ,.:98855455:436;666@66695@6=695656555C5730/-..141%2;224D2125254424222;481012102?3710.01221.0/,../5...1.111...4.....5..,/.4.0.+--**,5.,,.,,.2*,+----5**,,)),*,2,.+2*))!')''*+,*,,--+))++)((+++*)('))+))))++++*(*+(**+)')**@,,)****+**&(''')''&)))((((&%(''&''$$$&&&'-'$$$&$%%''+&&$'&&&$$&(0&''''(%%%('#$'(,((()( '(')'''(')'))*)-)*))'''+(+++('(**((*,,,.,,.+/11/00279:>FIIUYkryОЕЦѓƒ“‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггддеееежзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ђ®•ҐЯЭЩЧФЪ~Q`ebebbbaaa``^\[[UOK1>fБ§≥ЋФ{|ДАА}БАЖВДВЖЕЖЕЖЖИЕЖЕЕЕЖЕИЖИЖЙЖЖЕЖЖЖБИ}ЖЖЙИИЖИЕИЖИИКЖИЖЙЗЙЗЙЙЗЖИИЖДЖЕИЖЙИЙЗЗЖЖЕЖЕЖЕЖЖКИЗЕЖБИИИЕЖЕЗЗНЕЫЇ™™©†©Т™И≠Ђ≠≠™Ћ«¬∞ҐПwuixxog[M[[]_WJH=ACDA@<<369:*9:95AAHEEVUWKB>;855.545.2362549.566.969554546561956541122441037.44645542222.1121524..1210043421*01210./+../01)..1.1....*.-....1..'1.0*0//,,*+,/......,.),,-..,.'**,',,,+.././++*()****.,,/.,,++++)+++)-.,+++++,+++*---+)**(')*))+-**0+,,,+*%)((&&')&'&'&(')+)())))('%''#%$'&'((''&$"%%'#%#'###$$&'''('*'(''$((('((' ((*(((('(())+))%''&%)**")**),()(++,(+''&))'(****+-.10010010/344/6:>@;49CEDLVdsУѓ…“‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяааабвввггдддееежззззийййккллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЂІ§ҐЮЬЩЦФОiU]bbbabbab^^^^[ZULL>BNeУЗЁгёloЕЯ}|}КБДДОДЗЕЗЖЗЖЩЖИЖИЕИЖОЖИИЙЖЖЖЙЖОЖСВЖЖОИКЖИЖКИОИКИОЗЗЖЙЗЗЗЗЖЖЖИЕИЖИИУКНЗЙЖНЖИЖОЖИИКЙЙЖЗЕОИМЖЗЖЙЙЗЦ•їњµ≈ѓµ©ѓ£™ђЂ≠ШµЄЊќ©…ЈІУКЖ|hMbppjpАxvf_[UK@HICB@>66:372>@@8HKR]EPAK@C==<:4'665656156:496966455669455=6<22245:366725444;41144922261221002927221107.03>22//.//018...1......,..5...3/0,900,3////+,.5...4...**++,,5..)*,/*..1,..2//..+1*+++*.,)-4,+,0,-,,,0+.,*+,++,7,,++-.++*+*('**))4*))+**+1+*'*))(().')'.))'()((((+)+&%&%%'&.'('&&,',#&'+%+&&$$$$$'','%%((5(''((+''(1'**+(3+((5(+)/,(''%(%%)*&&))()),(+)2+)()',,)*1,***+..00119170)031668886D<;>@IS]doБТ¶ЊЋ—”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€™І§°ЮЫЩЦФs\Z`a^a^aa^b^\\[ZUJEIL^[UpiћчфafПЊyxxДБВБЙВЕ}ЖЖЗЖРДЖЕЖЕЖЖМЕЖЕЖЖДДЖЖКЖНДЖЖНЖИЕЖЖЖКЖЖЕКЖЖЕЖЕЕЕЖВЖЖЗЕЖДЖДНЖКАЖЖКДЖЕМЖИДЙЗЗЗЗВНБЙЖЗЕНЙТҐђїјї≈ЄЉґґ≤ѓѓЃђЮЬ®ЫЊЦљљµ≠£ЉЈ©ЙЩОАxwЗЛНЕАxsg\\YLIGC<=A;;7<>;76>5<:76.5.44966261515655655,94:43.4495516142415.002262345+111/1.626000004-03;22./,/.0.4......),,.,..4..*0,-,3--,/,,--,,+0*..2..,,,++*+1.+**./).,/+,)/..++(0*+*+',,)+0+++/,...,/+,))*+*,,3,,*++-**(,**'**)'.&''))((,)*'*((&)).)*).*)''%&&'')$($&&%%'$,'('&#('+$%)%)&&&&$&$'%("$'('0'((''(''&.#((*(/(+*2(((,((''$'&'()''(%'(,)(((/()')'),)'/*(((*+(--0.806,(,25533062?8999>CGHJLOV[rЕЮµ∆ѕ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€©І§°ЮЫШЦЫWP]aa^a^a^^^\\\\VNC7SjrkXIiУ€ы`dЦ”tam|АВБВВЕ}ЖЖЖЕИБЕЕЖЕЖЕЖДЕДЖЖДДЖДЖДЖДЕДЖДЖЕЖЕЕ}ЕЕЕДЕЕЙДЖЕЕЕЗВЖЖЗЕЕДКБЕЕЖИЕЖБЕЕЖЕМДЗЖЗЗЗЕЙБЗЖЙЗТУ§ЃЉЉЊЊЊЊЊЉЉєєґµ±Ѓ£™Ч≠ЦҐ•§І°≈ „Ўƒ—њ≤°ЪЪРТОРПДvmb^\VPPNKGDDD>=7?666>5@CDNGQGEJCN?=4;446696291326654559,4255705454416144501.101142351+11111.2060.000<.02322..,...,.,/..,.).,.,....1*/,,,/-/,,+*.-,-+,),,//,,,.,,+*..++*.+(++2,+(+,.+.)0+-*+),,++,*,+.*,..,1,,)(*.,1.,,.+++-+)(++,'**,&&&('((')))-(+((&*)*)*)+*)'+&&''')!'&(&$$'!('(((#&&(('(%'&&&&$(%(&&!''('((((('&&'&+#*'((*(+*+(((*(('('''''*''((((.('(((('')'),.'**(((+*'0*.-106,/-22411+1.2266777:876231DS_goЖЫ≤Ѕћ“‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€©¶§†ЮЫШЦ≥DJaa^^^`b```^[Z\NJI=rГ{{mPИГ€ыjeЉиiHezАВВЕВЖЖЖЖЕЕКЕЕЖИЖИЖИЕЕЕЕЕДЕЖВДЕЖЕЖГЖЕЕЖЖЕЖДЕБДЕЕДКЖИЖЖЖЛЖКИИЖЕЖОЕЕЖИЖКЖЖЕЖЖЖЖОИЙЖЙЗЙЗЛЗЛЖОЦЮ™±є∆ЊјјјјјјњЊЊЉЉїЇЇµіµ™£ФЗ}СХ§љ—Јкзжг»ѕЄ≤®©ІЧУЕ||xvuoic\VTPHBDFEB>>==>>>C?C=OE\GGJEG<:8<576735545:44455;153542494547011414144222/25225330711200?000022/....1..-/....,....,.//4.0/-0222./,)-/-/-----//-//....++...*++*..5.,++.....3-----..,..*,*.,*...2..*+,1/4....++,/++*,..,,,.())****(+**0+/*'(+*,**'*++'.('()(*'((+(&!('''((,((((&,')''$$&$&('+(($((('''''('#&''-$-''(**,*,((),((&+''&*,,&(++(--,+.,,+)(()(-1-++(+(+*(1-..226/301.212010223477789:=>AACKQON\fnvВЪ≤√ќ””‘‘’’÷÷„„ЎўўўЏџџџ№№Ёёёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€©¶£†ЭЫШХЄ2Rdba^`bb`b^]ZVTBKXuђГ~ВГПЮЄ€иvrры`T\|~ВЕЕДЖЖЖЕЕЕЕГЕЕЖЕЖЖКЕЖГЕГЕЕЖБЕЕЕДЕБЖДЕЕЖДИДЕ}ДЕЖИЕИЖКЖИЖИЖИЖЖЖИЕЖЕИЖКЖЖЕЖЖЖЖЙИЗВЙЖЙЗЙЙНВЧ°ЃЇїњњЊјјјЊ¬¬јЊЊЊЊ¬ЊњљЇЇ∞¶АkVИxВИЦ†Јƒ‘н‘хфтлв‘≥ЮМКЗФСЩ£ЯЩЛ|xneUSOPOIAABA>>7>7?-CCDHFUJVK\NBC=>6:7:256655444413.31545154425.1010101221116652633,22251+1/0/002/2..14.//3..21.../0-/60/-20/3662-/,,,0//-0//-/0/00......+0.+./*++1,/,,,.+.+----*-0....)*),*,..+.,,+,/1,/,...+++,,.'.,.,,,.*****,,+-,+-*,*((*),*)%))) ('''('('('()'&''&(**&(+*')"+%'#$($$(''**'(''&&&''''"&&'''#(''(,(+(+++((!('*%,-/%*+-+-......+(()++-..,,*,*,+'.*..210)00/)/.1.0.21116668:888=9;>B7D78:76HQbsЖ¶є»ќ”‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€©¶£†ЭЪЧХ•@Tb`a^`b`\^[ZXRIKEmУИБВГ~ЗбЏ„zИ…€fNh|}ВДДЕЖЕЖЕЕЕЕЕЕЕЖЕЕЖРИИЕЖЕЕЕМЕЕЕИЖИЕОЖИЖИИРЖИЕЖЕМЕОЖИЖОИИЖЖЖИЖИИИЖИЖОИОИЙЖЗЖЖЖЗИЙКПЗЛЙНОТЪҐѓјњњњњњњ¬¬¬√≈√¬√¬јјЊљЇі њєgbtЕНЧ°Ђѓ≤ЈШ≤ƒќ№мю€€€€сё ЩХНССҐЮІ∞¶ЬЗztpdMUUPIHIGDDJ?>>7?8@BGKQ[DXEcGDEDA1<<:866452235565;5656555545454544202A523:66363216///223332:122@224@2.1211020/2J0-/7/-0:22/--0/7020>/-----/0/....1.5.+/6,/.:01.,.5.5..--*&+5....,.,.+..;..+/,,/:,,+2,.,*((+2,..4...1++***++*+-+,)')*)/*+**)*))'****+))''''&'&)')''(''''&&((5(('(&$&.' (6(('('''(((&$''*&*'+(,*9,-)/((((''',*--B,,--,.---..6++(((),,-,,,)+,.+7,,.8022220-..0.0181,3=667E4537779;:?>QDDGLNMXcoyДРІ¬ѕ’‘‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®¶Ґ†ЭЪЧЫЖEY`^bbb`^[ZWVN6PcnНЗБББВzВБАv~ГСЬ°phtyyБАБВБ}ДБГБГБГБДБЕБИДЕДДБДДЖБДДЕБЕВЖАЖЕИЖКБЕЕДБЕДИДЕБЖБЕДЕДЕБЕЖЖДЕБИЖЙЖЖЕЕЕЕЕЖЕЖЖЛВЗ}НЕЪ®∞єњњјјјњј¬√√≈«≈ґ¬√√јЊЇЇ≠ЮАqRx}МЪҐ™ѓ≤≥±©®µЯЪЪІЂ‘зт€м€€юнёЋІО{ЗУ•£§™™ҐДztmePKBDABD=466;2=0@.61>AJHH\LWQNF@<51.4.42555)6554445355544441400/5//,3022211///1/1/22314...412251..1)0,00/,3//-0#/-0)0/0-/.1.1.2.,+-,,,.,..-'.,1),+1(,,2/-...1..)...***.**,,*,**&+*.*+*+++,/**&++))#)*+%+,.**#+(*(('*(*()))(&''%(()')))'('+*,))('''#&#%&)('''&'%%%$$%&+'''&!&'('&&( %%(('$'''(&'$'&'%***&,))')%''(&&&*'*,/#(+(**)-))'.(,'' '()),,)',).'0,.-1+002/-,,+0,.120133(/3611(32237372>=;62L[oz°їЋ—”‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббввггдддееежззззийййккллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®¶Ґ†ЭЪЧЯdPP^^a``^^YWVU>DPqННДБВВЗАВВВБКЦ¬є®tq|}ОДДДБАГГЕГЙГЕДЖДМЕИЕЖЕОДЖЕЖДЕЕЖДДДНДИЖКИИДЖЕЕДДЕЖЕЕДЕГЖЕЖЕЖДЖИИЕЖЕИИКЗЗЖЕЕЖЖЖЖЖЖПЙОЛЦЪ™≥њњ √»√√јЋƒ≈√≈« Њ√≈ћЅљЇ–ђПw\gВЛЩ¶≈µєїњєґ±ґЃЈЃ∞іљ√√№№тщ€€€€€€л–ƒ°ЪФҐЂѓІ•®£†Гqhe\ORQKLGFAE=B::7:??B8LJRUVZGMCN>:66558;38855555555;544;3832251413022522/12712132911.(.114452112/20220///../,;//-607/....1.5.......1.///,,/9...1,,.3-*....++*+.4.++.,+,,,.+*'+*+))***+,,++*+',+*)/*)()++*,'**,+)),,1*)++)+(('!)*)*),)))*+0+)(''-''%%'*)''''(&$&$&'(-(('(%((((,'(#''(((''('(.'&(.$*((*,**)))('(((('*-)'**&'((((,0,,(.+.(*%/(+,,,)),,7,-,/,0+/13.'++,600010/0/.02528093*37333::77>38;;8;?H;ELS^nyЗЦ•є –”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццчччччшшшшщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®•Ґ†ЭЪЧКRZ[^^__^\[VUQFMgmГНЖЖДВБЖВЕБНЩЩ≠ќ‘¶w|БББМЕЕБДАЕБГАИАГГЕДКЕИЖЖЖОБЖЕЖЕЖЕЖЕДДКДИЕИИЖДЖДЕЖЖЖЖЖЖБЕЕЖДЕДЖЕЖЖИЖИЖИЖКЙКЖЖДЖЖЖДЖДОЙУПҐґµЉ√ƒ √∆ƒƒј ƒ∆јƒ≈ ј√√…ЅЉєµ{wom}ПЫ©≤∆Љњњ√њЊїїї√њњјЉґѓЃ∞ђґњ„гэ€€€Ё€юцёЌЅ•ЪП†©±ІЧЩШХ|sngbUPHIDB>>=>;>88;D;CFNGNLRQFUKD>?D>BEGFSMQP`iuzОђ¬Ќ“‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®•Ґ†ЭЪЧfD\b^]_^^\[WQ>Gc{СЛВВЖДДБВВЖБНЩЪђґјФ}ДВДДЖЕЕБДБЖБДАГАЕГЛДЖЕЖЖЖЖОДЖЕКЕЖЕЖЕДВЖДМДЖЖЖДЖВЕЗЖЖЖЖКБИЕКЕЕДЖЕЖЕЖЖИЖИЖКИКЖЖЖЖЖЖЖЗЕЙНЪЫ≤јњњ√∆ √ƒƒ∆√ ∆Ћ√ƒ√≈ј»¬Ћƒ¬ђНhctЗС†ђњЉјј√√√¬¬ЊЉЉњјјј»їґІ§УТН†Ѓ»џп€џ€€€€€ьиё¬ЉєІ¶Ю≠ЄЅЇ•ЧПЖvnb]WPONIDCB>B>C67:>B?KJQJ\VKFQT;>6B972?FGHQ`rЕН£≥ЊЌ‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®•Ґ†ЭЪ©K>]a]\^\\[XUF9er~ЫБДВДВДБДДЖВЙНПСЦОМЖЖБЕДЖВЖДЕДИБДГЕГЕГОБДВЕВЕЕОЕЖЕМЕЖЕЕВЕДЕЕОЕЕЕЖЕЖЕЖЕЖВЖЕМБМЖМЖЕДЖЕЖЖЕДЕЕЖЖЖЖЖДЖЖЙЖЙЖКЕОЪ§ѓљњƒјјƒЋ√√√∆ƒЋ∆ѕ∆∆≈√√»љ–ЊіА|rfИХ§≠єЋј√√«≈≈√√њњЉј√√≈–Њї≤≥§ђ≠ґњ≤ґґ»—№кц€€€€€€ффёџјњљ≤ЉЂ™Ђ≥™£ОЕ~spjbVVOPKFE>AA>=6@A;CCJAEN`JVNFICMB<87444040334454>55455<66202:2412122:4525/149.24?0233032.,..111.:.211,2.1.1122101.../-0-/,00016.6..,11:..,*+..8+.,..--/---/.5.5.6.,+/--/.,/,/,++1+/...+.2,,,,+...+.,.,5,,+)-.-2,**.,-(),0+,,,,+(('++4)+)*)('(''''&&&''''''(',$'&'%('$#"'.'((((((/'/,+(((,'('('(((+0--**'4'+*1(+,/(,*-**-/-/,,'+++(++,./1/...3.6..(.0;20/30//1/22<553418355B32266A5456477769798==>>??EGFMX^_cijjЙЂ«””‘‘’’÷÷„„ЎўўўЏџџџ№№Ёёёёяяааббвввгдддееежззззийййккллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®¶Ґ†ЭЪї/Hb_\[]\ZVUF8eКИДВАБББББДБД}ДДЖБИЕЕЕБДВЕ~ВБДБДБББДБДБД}ВВВВВВВБДДЕБЕВВВВВДДЖДДДЕВЕВЕАЖ~ВБЕxЕДЖДДВЕВЕЕДБББЖЕЕЕЖ}ЖДЗЕЗЗЙБЪ¶∞ЈЉњ√ј√√ƒјЅјƒЅ»ƒ∆ƒƒ√¬Ѕљє…ФsQrtИХ•ґЉј√√√√≈√≈¬јњњЉјјƒ«≈ЊЄ±≠Ъ©І≤ЇЉјЅЂ§ЬЩР¶Їёс€€€€€€€ьдЄ§ЗХЬЂѓђђ≥ЈІШПД{tkaVJGCIFB;?>>+=/10?6DHKQIXMh[II<<8:-5/1142445442446564115221512242424112/#//2+122,11.'..2..*..112%1.....411..*.,///,-)0//-.....'1.1...++...&*'.--,-,,+-,../...,+,+,//,-+,+**,*,.//../+,+*'.*+*++,*.++++-,++'**-++$,,))++,+*(((**+#)''&'&&&&&'$$$&&'&'%($' &$##&$"!#$'$##'''')"++*(($$#&#$!((**-*-*)#'''''&(,+'(***+*---)+$((('((++...,--/,/,,$.030311./,/.1042310(212.72323561201*253/335565<99397:/EA97=:ACWdzШ≤√Ќ”‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®¶Ґ†ЭЫњ0Fb_\[[[WLP,`zГЪДБДЕДДДЕДЕДДБДЕЖЕЖЕЖЕЖЕЖЕЖЕЖЕЖВДДЖЕЕЕЖЕЕЕЕВВВЕВДДЖЕЖЕЖЕЕВЕВЕВЖЕЕВЕЕЕЕЗЖЛЕЕЕЗЖЖЖЙЖЖЖЖЕЕЕЖДЕЕОЖИЖОЖЖЖЙЗЛЛЕЪЂѓ…Љјјјјј√ƒ√Ѕ√ƒƒ»»»»«√њљ¬¬∆ybnpИЦ®Јњѕ∆Ќ««≈«≈«√√јњ√ƒƒ∆« њїµ≤Ђ≠ѓґЉј√—ƒ∆ƒ»« —«Њґ‘йь€€€€€€€€о”ЮЦЛЪІљє¬ћ≈Њ≤©О}the_WLLIIGEDA>>>?8BD?=GNOOJcJbTHEB=574548956412666545;355<5642022821///1121424112429291211154<24241.1:.....11002020712.,,//115.0.0.........10200/--0.'..,,,../,,/5/0//,+,/,/.101//,,**+2+../.,*,+*+,+****,,/---3,$))+/*++**,('')'''&''(''('('+''''')'(('&'('&$(((&'((')/(+++((($&''''(**++)))*'''(('(+--,+***.-0.0.....,+..,./..,,,/./.,,/0/0300/////119///../025G662552441215565652569G;>:;9;=G=;;=@EJPYWjvЛЫ≥Ћ”‘‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€®¶£†ЭЬЮ,Oa]\[bWLQXiЫДВЖДГЕЕБДЕЕДЕДДБДБЕДЕДЕЕЕДЕБЕВЕ~ЖВЕДЕЖЖЕЖЕЖЖЕВВВЖДЖДЖЖЖДЕЕВАВВВ}ЕВВВЕЕЕЕЖЕЗЖЖЕЗЗЙЖНЗЖБЕЕЗДДАДЕИЕЖЕИЕЖДЗЖЛНУ≠ѓ≥љЉњњјњјјјјЅ√ƒњ∆» «≈¬¬√≠Щ|TozЗЧ®»њƒ «…≈«««√≈ј√ј√ƒƒњ«««њЊЈ±©≠©ґЉј√«««∆«∆»Ћ»ƒƒљ≤§≥іƒ“ш€€€г€€€€п‘ЪОЦҐѓЄіљїЇ®ЧК~jb[GNPNHIFDDBCC=>2C6F9IKQ[QeNXVXIDA>5'955122555-503375552+/04220//002,21222.52414.524.445.2242212&+.0)112/2022322.////1/1)1..)...),,..220000000.,.,*,*....,*/////'++/(..1......**+.+/..++%+++**)*))'**.--,.-*+*++&+.,**''''')''(**+**'(*-#+))')')((('+((*((*(('(,,)(*(('(((*''''*+++..+*)')'(((()),-+(****-*--///..,.,,/,(/.,,,+.+....//0////././(214(////.022964$00220/521255355379>::7;9::;87686:>>E??EDKJTMUT\\K`JM@C@=66988855333757540026442201150814444B4422.<370322.1294421+.0;=58>DBGJP\gxЕУҐЈ≈–”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€©¶§†ЮЧk?T[Z[WMHZdЙНЖЖДДББГДЕДЕДЕБЖБЖДДБДЕВДДДДЖЖЕВЗЕЙДДДКББДИЖЕДВВДВЖВДДЙВДДДВЕВВВЗВВВЕЕЖЖЖЕЗВЖЖИБЙ°ЈЋУ]p®ЈЖБxВВДДЙЖЖВЕЕЙВЗУЮ™≥≥љїїЉ√њ√њјјјњјї√√«ЊЇЇЉДxfgxДЮђњ√ј∆√√√∆≈«√≈¬¬ј√њјјјј√√ ∆ƒљµ≠ѓІґїњ√∆»»њ»√… Ќ ЋЋ“ћЌЌќќЊЅ≈Ѕћ÷икш€€€€€€€€€щб °ХГҐ≠Љbkhx§ЩОАvkfa\VONIDAEEC?B:CBDDBLIOSZ\gxОЂЅћ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€©¶§°Ю}SGV[[YUIGmМШЖВДДДААГГИДДБДБДАДБДБВВВВВВДДЕЕВЕВЕВВДКББДЕЕДВЖБВБВБДДДДЕДДВЕВЕВЕВВВЗВЖЖЕВЕАЖЗМ{yѕпгЪHbєЋuqtББДЕЖЖЗВЖЖЖДДУЮ™ґѓ±µїњ√ЉјЉњљјњњЇњњ їЊѓЩk\b{МЫЃЈ√ј√√√≈≈ ≈»ƒ∆ƒ¬¬√ј√јјј¬¬≈∆¬ЊЄѓ±©ґїњƒ»  њ √ Ћ–ќ–Ќ‘ќћћЋЋЋƒ ≥≤Ђђ≠¬”лэ€€€€€€€€€йвЅї™ХjnrЙЅї≤Ѓ¶ЩЛ|qkcb]YPLLHGJ=F5:9;76GQ[gvЛ™ЊЋ“‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммнноооппррррсссттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€©І§ҐҐ[DQV\\SXYU°КДДЕЕГББДЕБЙЕВБДЕЕГГГЕДДДВВВВЕДВЕЖЕЖЕЖВЕЖОЖЕЕЖДДДЙВЕДБДЖЕДЕЖЕЖЖЖЕЖЕЖВДВЙДЕЖЕЕЖЕИМС|gю€ъ§B]ЂяW_tБДЖЖИЖЙЖММММЖЦ°∞ЉЪ£Ъ≥±јїњїЉњњњњЊЊљ–ґґЕzn]zУ†ђє√√√∆««……Ћ………»ƒ∆»∆√ƒ¬ј¬√√≈∆¬Њї±µѓєњ√»ЋЋЋЋЌЋѕ—‘—‘ѕ„—ѕѕѕќѕћћќѕ—–“ЌЋЅ≈»ём€€€€€€€€€€к√√њµ§Ъ§ҐґЄљ≠†ХНДЕД~qebX\ZQOJGEGD5C=C;=FFNNQK\N[VQQEMK?3=;77754746916:555655522222223322262:44455:1B44452/12021225121./1//,//1.1.2021../---000-22..1.1...215/,....+.......'..4...2.*.@21/,,...+0.++*,,,1.,+,)$))****-**+..-,+.-..*(*((**(+(*+.''()&((((#(.(+**+*+,*++,,,,.++***($),-))+0,***++,,./..,-,8-&*&)((!(1**+.+,,+,,-/-,,,,./++,.*.011/2//1716000013/11.1.2567631/002024/0/20-133773665666677774562:7969;=:@@CC3ILLRVYhu~П•Њ —”‘‘’’÷÷„„ЎўўўЏџџџ№№Ёёёёяаааббввггдддееежззззийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€™І•ҐЄAK[\\XDgqГУНДДЕЖЕГБГЕЕ}ЕЕЖАДЖЖЕЕГИДЕДЖ~ВЕЕЕВЕЖВЕЕЕВЕЕЛЖЖЕЖВВДЖДЖЕЕЕЖДЕДИЖЗЖЖЕЖВЕБДБЕДЗЖЖЕЗЕИПФw]€€€ƒ9lЯш9VmДЙЖЖКЕМКХРСОСЩ£ґґyНwѓСѓѓ≠≤ґїЉЊјЊЊљњ®|N`nРЭЂїЅ√∆∆∆«   »…»ЋЋ…ƒЋ……ƒƒ√√√≈≈«≈√їєђ≥©їњ«ЋЋѕѕ——ѕ“’’‘‘Ќ“ѕ—“——“ѕ’’’”’–ќЌќ»’іђЪ§•’с€€€€€€€€€€т≠™Ы¶©™±≠±ђ®ЉЅЇ®ЩНЕ{o_ZSPNPLIDGD<4B:62=HJNO[Sbeh_XQGJ;?=;594:;6995556565733366766333646454555)422251/01011124121242/1+112.0.1.102..-/*/00,07/.2/2...211./...1.1//,0+. ,.....2.212122/../.+.01.-/0,.1.+,*'++---1.*)-//...../2.+-))***,+*-.'*--&*(+(())(.+.----,,..-,).++*++(*--,,).+.(((,/.12./0.-...,***(((.'**+'*.---./-/,,,/..+,*,,025/2//./.2102007/5212127787303105252-2000223386677666668877769)988188:8<<:::>@3D=?:;7ADTftЙЂЅћ”‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЂІ•Ґƒ4BV]]H^ny®ЙКЕЕЕЕЕЕГЕЕЕЕЕЖКЕЖЖЖЕЖЕОЕЖЕОЕВВВВЕЖНЕЕЕЖЕЕЕПЖЗЖКДВДКДЖЖИЖЖЕИЖОЖИЕЖЕЖЕЖЕЖДЖЖУЗЖЖОЕЗКСw`в€€гPБЌ€[JtЙЖЙЙПТТЩ©ЦУСФЩ©ѓ™ђЫЈЏЅ™ХЖЦ™≤ґњ√µ√ЅћЛ]dZНЄ¬ћњЋ√Ќ∆«»Ќ  »…»Ћ…Ћ…’Ћ–∆ƒ√ƒ√«≈≈« Њї≥≤≥ЉјћЋЋЋЌќ–ѕ“–‘‘’‘’“————’’џ’Ё÷я””“”’я”№”’÷÷“≈ ¬ч€€€€€€€€€€хўІЯУЩЯ∞јїѕ≤…ЋЌЇђСБyskc]RTVTQMJFDBADDE>CIMQ[bckQy?QKG@=@>?;;;755<566;666:7?77304<5<565:5645454B4424220//2..144429294<0101041812.5...9./200726111200/-/1161=///50<.....21:191....1.,.*,..;//0=/--/-1*!(*---B-*)-*-*++-,/00/3++++-,((+8+..0*,*/+*)*)3,/-/--**,,+(+-((*/++(,,)),,--3,++/,..<.0/.*)*5-,*-*++6--+.*(,3----./.,/9/9..../22:2222....,0.-2N5>21/02=8=513>322555252004264;55333<666742777>5>6625686::7888<;D@CAEACEZnЙ™≈ѕ”‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ђ©¶®Х)CNJ`tВПЗИАББГБГГЙЕЕДЕЕЕЕЕДЖДДБДБДДЕДЙВВВЕВВЕЖЕЖЕЕВВВЖЕЕЕЖДДВДБОЕЖЖЖДЖЖЖДЕБДББДТЕДБЕЖНЕЕВЕАЕЖЖГП•Ѓћ§СОЁтxzАЙККОЧђµїґ™ШЛИОЪѓ≤µђЅѓзжкннсЪќґЈ±®ИpT[|°ћќЉњњ√√ƒ√√ƒƒƒƒƒƒƒЋ∆ƒƒƒ∆∆¬јЉјј¬√≈≈≈ЊЄ±ѓ≤ЈЇ≈ќЋЋЋЋ–——ѕ“““÷ў‘—Ќ—“’‘’—„‘’“’“’’а÷’Ќџќ∆Ґ{u{РЬ≠ґ√—џепс€€€€€€€€€€€ыжµ≤®®™Ї¬¬јєЇ∞£ЪУНЙsnge[ONKIMID>>@?=DE6IDOJU_\XJ\VQIE?5755469696<5500182519442523222911.0/20000+12:5:.21.12.005/0/0///2,/,/0222...1.20200.4/-...,//.0..*..1....+-.,,,.....,+,,2+////+++-*(''((&')))')))')'))'+--++*(**(&))---..+-(-++'+**+-+-+++0**(-(('*)-*+(+,,*-**+..++9((*,*.,*,*#**-*-+.+4++-.,../--,,-,,,*,.1.//.0.,,----./.,(++-//,2/./-/+2325350022033800.1/31.11,213030//1112;11.).0054=66692236666;86697===93;CGGFOW_]l|Пђѕ‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≠Ђ®ЦZ9A\zУВЖОЕЖДГЕЕГГГЖЖЖЖИЖЗЖДДИДЙВДДДЕЖДЕ}ЛЕЖЕЗВЕВЕДЖВВЖЖДДДДДДДДЖИЕЖИКЖИЕИДЕДДДИДЕЕЖЖЖЖЖ}ЖЕЖВЕЕКИНПЪзгe}НЗ}КЗНЮЌезбггзлслџЯƒ»∆≈ƒ√њ≥¬ЮІђљ√ƒ÷≈змнйЋив÷Јњњ≠Ѓ≠Ї√ј√√ƒј∆јЅ≈ √ƒƒƒ≈ƒјњЉј¬¬¬«≈√ЇіІ©Ѓ±≤ј»ЌЋ—Ќ“‘’’’‘’’÷‘÷Ћ——’“‘“‘“÷““ѕ’“’“Ў ≤ЬtdНРЯђЄј…≈««ЋЊЅњљЉЅ≈ёл€€€€€€€€€€€€щик‘ЊіЂЈЊ»»…«љњєђЭОГ}sf][VTPIKIEF>ENN\Oc_[VVZIQF@7?;944555515589<2655554944241411.62445241122110415////,/+///.006...1121//022/12..211.1...2.,.//0/005.1..,..///-/-//72.-,,*,+*+/*).++))*-+++**)/))%****)/()+-)*-.(.,.(,.**,,,+-..-.++((+-(-,0,/.*....(,,4/-+.(,..*&,-,,,,,2/+(++-&*-0.1/6,5,.,,,,+,.2101./5/5.,,..1001/.7,,,/00/6/(5>3311.5000..20.11133503331444/70113393411.222,330/2//24242623551=5635456948993:@=DFDDDQJKV_M_VKQJNDC;<:8758575<4646465:444545555<2225351222..0106120//0/0/..0/6...11411//01/111.512.1.1.6...1020209.1.../-/-/--,/0<0-+++'+,++,+)1+-))*+(+*(((*((!()),,4-,,,(((,+--0+-*((-.,+,+.*.+.+'..--,1),+'..+,'+,6,--+(,.,( ++((+++4*+++*+(+*1-..6.6(,++,..,+1-,.//6/7/,,.00,/./+=/+,//009-"2E12130920,,,0,,,00/05/1/11014/;/1.3292212/01323/2/30.22/4/423252@63/1/14624547;;=<=;<8=@CDNU¶ƒ—”‘‘’’÷÷„„ЎўўўЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ѓђі?;U}ҐЖБДБЕБЕЕДБЕААБДЕЕВЕ~Ж~ВВЕВЕВЕВЕЕЕВЕБЕВЕ}Е~ВБДББ}ДБВДЕДВДЖЖЕДВВВДЕДЕБДББ}ББДБДДЕБВВВВЕЕЕВЕЕЖВЖЙЛННОММПЕТЭґйвмзкмрсфэю№њ жйзвяяёџЎ“Ћј•Ч_hrВМ•їяшк€ж€€€€тў®ЮОЧЪї≥≥ЈЉЇјјјњњЉњЉњЉЊЊјЊЊіЃТЧЦЂ≥Їј∆»ЋЋЌЌ—ѕѕ ѕ»ѕѕ—ѕ—ѕ—ѕ—Ќ“’‘——ѕЌЌ“Ћ®БrdИРҐѓљ…≈∆»ƒ≈Ѕ««Ћћ““““ќћ∆ЫЭЭ††±њвч€€€€€€€€€€€€к∞≤™Ђ©¬ЊљЊњ¬«ƒЇЂ†УЖ{n_[QQMKGGCA?DKMICGMGCCAC>DAGJKMV]KQJOKKID8.<<;:695*124556555546456F55440011.//02425121'.0/---/02322./00/2294214112<22230212.1........-/-,-,,2//,,,/,++/../3+$,,.2-(' *1**+.+**-)./.,,,.,,,.,-..-++)))+*-.-.,/-/-,,5,**-*---...*(('*1.)),,,,2+$((,..<++-..6++*((++-,,((+,,,/,+,)*-.-,./-,,.0200/1..//.,/2230006566:300.07//,,,//...,./111171311..120-1317312:3<111,//...//12225531100130.25553/1.3333537;JJNQSeTb_[OID?6):7443565545454555.95444144211121412/52/.02200022322./0/(//4441214463332//...0//.....1///../+/+,,/10//-/(//0/,00/0.-)*..-.2/'...%-..**,/,.*.(,.-+/--+++)+,,,-.-/--,0//*-+--++....,**.//.+,..,.,(+,..*.+++,,.(***"+..-/.((,+,,++,+--+*,-/..../122.11//.1//3451006366663321111//-11//1.//311,3+2.1,.000141)22/)3.1./11////0//1121212231000...33103/1321253577::<8E919<:6565<56564=555529542225252517520-3>22032726./05+00512242=452022/....B00/4.1.=/000//,,,//0012:/0-0000/0:03..*2..*-//+-.8*../+*,3,,,6,,,(,6//--+')...,-.2//..,/-/-1.-+++,..--.///,+.1./.2,,.2+.-1.,**((*/(..1/9/((,,-,',/.0-+,.//////..0001/1.,///445140933323320.//1///0///8/11213/2/201/1///621,100.9/..//1...././////1/1121111000:2/05/0022/223549886>:?AECFS]l~Р§є»—”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≤∞√ЄЃЂ¶ЦМПЙАМЗИЕЕГЗЕЕЕЖЖКБЖДИЕЖЖЖДЕДЖДЕБКЖЖЕЕДДБББЖДЕЖЖДЕВВВВВЗВЗЕЖДЕЕЖЕЕДЕБЕБДДЕДЖДЕДЕБЖВЕБДДЙДЖДЖВЖИМАУ•∞ћЌ—“““—“Ћ ЋЋ√ њћњѕЋƒјЋƒ»Ќ„ЏЁв–}yo{ЮјмрступлйжебаяЏџ «јј№ћадмт€€€€€€€€ьцбƒ≥Э°°ѓ≥≥°®ЫѓіЉј «  ЋЋЋ ЋЋѕѕ‘Ћ“∆ѕЌѕѕ—––ћ—Ќ≈™Чy}ИРҐ∞ƒћЋѕЌ—√—Ћ“ЌЌ√Ћ …«»» »ѕƒјЉј∆Ћ ЋЋќ—÷’’’÷’„Џ„÷ў‘ ÷всфцю€€€€€€€€€€€€€йЊ≥ІЃ©єЊљіЂЈЩЙtmp†™ЅfZZVOEDEFEDCD=B>C4GIIE[OWXQ]MUJDD?911.<55454:56251954.224.2121511-/3:22/20603./,5//02+..1.9220-/0-/.11<01.1,1*70201..+++,,..007/0-////0/5/0+-'/*-)+++***1+.,.**+/+*,2***(+2,..,.)-.+,+,-0..,+*-+-*1..+..+..-.*--.,,./,.,/+++.'.,1,+'+(+*.*+-.'2.((**-.,./..++*.-.....*++.,/..++,//1/1.1,5/222/0//,,//---/)..4&000'//1/1/1/1/,+2/.,/-..4..,/..**+*#.//....,..1.10221170..2'..0/.//000634487;;<==BFHMPRP`rОІЅЌ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€і±ѓ≤ЇЊЅґЃІЧМРММИЗЗКЙЕЗЗЖКБДДЕЕЖЕЙЕДДЕДЖБЖЖЖЕЕДЖБВБДБЕЖЖВЕВЖВВВЕВЕДЕДЕЕЕДДБДБДБДДЕВЕВЖЕЙВЖДКБЕЕЖБЖЕЖВИЛРДУґЌЁяЁџ№џўў‘––‘∆»љ«ѓб≈ЇЈЈѓ≤µњ∆ћЇВbmА§Їџфшцуцутсосммкжда№Ўќ№Єі™≤ЅЏпэ€€€€€€€€ытдЎ»їє®ЧЧХ™Јјј∆« ЋЋЋ ∆Ћ ЋЋЌ Ћ√ЌЌѕѕ‘–Ќ«—«±ПrnЖФҐ∞»—ќѕ“ЌЌјЋЋ—ЋЋ√ »«≈«»Ћ »ƒ√Љ√∆»  ЋЌѕ’““‘’““’”ќ’“ћЅЅЅ∆ЋЏвэ€€€€€€€€€€€€шслй”©∞ђђђљІШvstЅэлБqpke[XUTRNJIA@@B.5<>AGLPWN_R_[WYHNC=9>9.2266994626651422.6221112/03327020710.//71000*..1.2110--0/3/111/1//,.*113221.++,0---2.-..,/////-/-.**&))*)++/((*++.+,+.*/*++,+**,*-+..'-++.+&),,...,**+,/*....2/*..--*,,2,,.,,,,+,,+,',.6.,(0+++++++.'*,(**-000//..++*-,1.//-**+,,.,,++.6/1//,.,//023...,,,/----2+..0'824&,//,////0-/+0..,.,.././.4+(**+*#.,/.,,,,/./.0112212/..5'.+0..-////624244767677:9;8618?HQ`vКІє —‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежззззийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€µ≤∞Ѓђ™®™≤їЉЉђ≠£ШФЦТКЕЗЙЕОИЕГЖИЖЖКЖЕЕЖЕИЕЖЕЕДЖЕОЕЕЕДДДДЖЕЕВЗВВЕЖЖЖЕЖЕЖЖЖЕДДЖЕЕДЕЕЖЕЕЕЗЖМЖЗЕОЕЖЖИЖИЖКЗООЭ§®Ќя№вааааяяяёёёЎ„ё ≥зњ≥њњЈ±±і±ґЕt||Ь≠«идутрсттхущтхурропмлизжяўа ≈ЇЋёоь€€€€€€€€€хк÷÷ƒљ≤ђґєњƒЋЋЋЋЋ  ∆ЋЋЋЋЌЋѕќ––‘ќ…ј ІЦГnДЧ®і√ў÷’“’ѕ—ЋЌЌ“ЌЌЋ «≈«… ЋѕЋ∆ƒЉƒ»ЋЋЋЋѕ“÷‘’„’“‘’““’’÷÷ў№ааไќЌбф€€€€€€€€€€€€€вя„№ќєѓФv{А™€»©£ЬЩРЕ|wplfaXPILJCCEEHBEICEEKHNWbN`\TTJN=><@=::6:699656441954242512333;333:52212=122401144422/0-22:230/02001112254421.,.40..4+,,,*..../-..+*-')*-+-.3(*+++..+,./1*,,,,,,.,.--,&,-...%*,-0//...//110/./6/)././,,,6....,,,+,..,,..9...2..0.+..0+(,**-.1.0//.,.....2..//*,,..0.,*,0:2111.000,2260.0///.//.06/1331=561/..///0/-/0/0......//,/.9.(+,/../00..../111..0003120/.9.0....+,//1735353433233778::;>BDHGQV]\myО™їЌ”‘‘’’÷÷„„ЎўўўЏџџџ№№Ёёёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ґі≤∞≠Ђ©І¶§Ґ†≠ЇЊњєЂ°ОМЙМГНЙИГКЛЙЖЖДЖЖИДИДЕДДБЕДЖЖЖЖЕДДВЖВВВЖВЕВЖЗЙЖЗЖИИЖЕЕЕКЕЕДЕДЖЕЖЖЖЕЖЕЖДЖДЖЕИЖЙЗММОМ∞…„а№авбебввгвбббаоы’ѓґ≥√∆јЉґ§≠Зtb~ЙЬ≠љ–ЏЁбддбмптхцхххццхшщшщцсмлзбџ’ќя≥£О°∞Ўу€€€€€€€€€ъвђґЃґЉ∆«ЋЋЋЋЋјЋЋЋЋЌЋЌ—–ќ––«ґШsxyСЭЃЇƒ—÷„‘““ѕѕЋЌЌ—ЌЌЋ ≈««  Ќ‘Ќ»ƒ≥ƒ«ЋЌѕѕ“‘’’ЎЎ’‘‘’’’÷’ЎЎЎўўЎЎЎ÷Ѕ“їµ≠±ґѕё€€€€€€€€€€€€€г≈УЫПШҐ∞ЈЄЊ¬…Њ±≤ђ£ШНАwgbWSDHLNKF>D2C6D*/2AJN[TdRhf`VNL>:5>9::96555144545272224376646654255/546442425221//32333/023223111254421..-1100-*./,*/.../,..+-*(-)--../'+.-*....0./'...,.,-,../+,-.-00-,./0//..0201110////,,../..(1//.1,,,/,,//,,,.(./1..10+++.,+/--001*1//.//02/,.,.//-///.0-,(/122213/232$0073/2200002036135532141///11/0//,001.131../2(,,/+.-,11//1.*,/115/2./3000/2//)/0.+-+.*,.2/525131222/11557887:999:;=>91;?@.(.5//./,),/....+*+/++,.,1022800-/0///+),,///102.2.,-./2//1A2227/02=3(222200.03A3313//151.///144000//.16.0-..<...4/.+'.6//1/,,,62;170/2300/7//-/0,//.1/./<3556110123/.1448777>72256.9E9:>BEJJDgАЧєћ÷“‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежззззийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€єґі≤∞Ѓ≠Ђ©І•§Ґ†ЮЭЫЩШЦЪ™ЈњњЈЃ¶ЩИИДДДЙЖЖБИЖИЖЖДД}ЖЖИЖЖВД}ЙЖЕЕЖВЕВЕЕЗВЕВЖЕДБДБЖБЕДЖЕЖЕЖВЕВЕАДДЖЕЖБЖЖКАХЦ±”ўаяЁё№аагабяааггзгэюѕ†≥ЋџжџџЊА|fuР°Љљ≈Ћ≈ћЉ–…«Ѕћ’ЎўяжзйммноттххчцшшццххфтлзбЏ—√√∞Ѓ™∞∞ґЇн€€€€€€€€€€кћЫ£Ъ≤√ћЋЋ»»«≈»Ї™Д_ЖВС§Ѓїƒ—Ќ—‘‘—–——–ѕѕѕ—ЌЋ »»»∆»∆»» √јЈј≈Ћћ–Џ÷„ў№№Ўџ÷÷÷’‘‘—’’÷—÷’’“—ЌѕЌ––”“”–÷ѕ÷Ћ∆¬¬¬Џд€€€€€€€€€€€€€з∆ШЧМ•і»»∆љЇ¬¬Њµ§ШФ}tld\OKED>DDA=>@@3?/:>FHSW]cVg_\QME=914185548445545421411.211051533000//20./0/00101130220/./1//,/.-0.-0.-00,,+///1/',//,.+/+.-../----,.-/././.+*+*,--,,*.+../.0--+--/-/., ./.*,***-//././.,*.*,,0'..1.,+.,.*,,)).++++.,+,+++)(..0/1.0-.//*,)((+,////.+.*///,/+..2/202/003205320*0-..3..././//..,/*/11,///(...++,,(.)))---(+-////.',,/,1-0..0/'//2,.,.1/1/+///*52232111012//-333333720/15144,3356;6=08=CIONfЙ™»”‘‘’’÷„„„ЎўўўЏџџџ№№Ёёёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЇЄґі≤∞Ѓ≠Ђ©І•§Ґ†ЮЭЫЪЩЧЦФУТ†ЃЉјґ∞©ЬШСЙДМООММЙЖЙЖИИКИЖДЖВЙЗЖЖЖЕЕЕЖЖЖДДДЖЕЕДЕБЕДЖЖЗЖЗЖЛЕЖЕЖДЕЕКЖИЕЗИЕОЧ∞ќЎбяяяяёабеабаббгеизююґҐЮЋйжж—Ђx`m}•ЉЌџ’’“’ќ’ќ…Ћќ—’’Ў№ЁябгжзймнрухчххчщхчхшпснкЁ„Ќ√ћЌ…ЅњЌц“кс€€€€€€€€€€н’Ѕ§Ѓґњ…Ћƒї™ЬfkЗЧѓЈј√»ЌЌѕѕ—–––––———ѕЌЋ  »»» »»∆√јњЉјƒ…ћЋ’’„ў№зџя„„÷÷’‘“÷÷№’„÷’““ѕ—ѕ“—““–ќ”—‘Ќ…Ѕ Ѕњљ«гйъ€€€€€€€€€€€€€й≈љµµ±≥Јљ√ƒ∆ґњї≠¶°СВung_UJLJJLJD?E;>>3EII@QPW`__QeKTJFCA<77;84655553354.162213233-00//171002022+0;340220111100//.+/0000000/////120,,-..3.../../8.----..3.+///++.+..-.++,-,.////.-..////5*-1/++,*-*/..///.,+1-...+..../.++1,,,(,2,..+.2,.,,,,)*.2..06./04,.,++,001.//...0../4+.///2220200021121.0...2...../1//0/5.114..//.3..)',2)),++(--*../10//*,,.,0/0-)0/,216//..1111../1/5011001101310.11,233311/42/1/.1/126293777;=AABFH_Б•…”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёёяааабвввгдддееежжзззиийййкклллммммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€їєЈµі≤∞ЃђЂ©І¶§Ґ†ЯЭЬЫЩШЦХФУТРПШ®Јј∆ЄЂ°£ЩУОЙКИОММЖКИИВЖЖЗЖЗЖЖЕЕДДДЖДЕДЖДДВДДЖЖЖВЖЖЗЗЙВЖЖЗЕЕЕИЖЖВКДНЭЃ ‘ЁаЁяяяяабгёбавгежикэс™†£’йаЋРВjoЕЮ“ЎяббяяЁЁџў‘’’—“Ќ‘“÷’„’№’„№явзмнносфруушуххтнизвзиизидуЋј÷№биппюъ€€€€€€ю€€пёЉ°ДЕАxЙЫѓЉƒ«…ЋЋѕќќќќќћћќѕѕ—ѕЌЋ »∆»ЋЋЋ »√њЉЇљј«ћћ’÷ўџџгџё÷„÷„Ў’—÷Ў№„÷’’Ќ“——ѕ—ѕ——“—‘‘—ѕ…√јЂЫДЧШ¶Ѕ”дтофы€€€€€€€€€€€€€хё≠ЂІ≥± јјјЊјґЂ£ХЛАvpgc_UPKHBDD;DF<=E:64=EJORXU_cgeb[JQJD=C?;76996656453655542747676663732323/3332621..11/0/036,-0001181112/002140/1/1*.7-4.-././/015////..///1//.//8////.-..///12634//050//2.--...-/.1..////1/1/+.-1../4*//,-/-/3111..00+..1002/.///20-02621112/,4.-+.11-237211200*1..22/53>57/.+/0..1/0./,2,.12.//,(,..+(/6----*0//..-,+*,5,,/)--/.+..111/9011=//02/1/6.00..314.1///0112//0,/1////1/15:-2220314045616-58BMIDKoП©…‘‘‘’’÷„„„ЎўўўЏџџџ№№Ёёёёяяааббвввгдддееежжзззиййййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЊљїєЈµі≤∞Ѓ≠Ђ©®¶•£Ґ†ЯЮЭЫЩЩЧЦХФУТСРПОННМЫ™Є¬Ѕє™®†ЬФНЙИМДЖЖЖКОЕИЕЖЕМЕЖЕКЖЖДЖЖЖЖНЖЙЗПЗЗЖЗЖЛИЖЕКВЙГПГЋЎЏа“жгџеЎаЎЎ№№ўаябаггееюџІ±њ‘№ЦБ{wИЬ…ЎакбвбггггеезбваяяЁЁ№џЎЎ’’“–“–÷’÷÷„”÷„ягзйконрытшуффщш€тиЏдптппиЁо—÷ћжц€€€€€€€€€їЎ…“–÷ѕ«√јƒƒ–ЋѕќќЋћЋЌЋЋЋЋЋѕ»∆ƒ∆∆»  …√њЉЈљј«ћ’’’’÷÷Ўџџўџџџ„’‘÷ў№„’“’‘„‘÷—“ѕѕ—““‘Ћ’ћƒЫЦВyРҐђіЊ¬ Ќ”÷”ЌЌќЌЌн€€€€€€€€€€€€€ъяёЎёЌ¬Ѕ≥Єѓ—Ѓєєґ≥©ШСКЕyjf__]UPLIC>CCCDDGCJGNV[\_M]\[WNRMD:>?:977544525554<0667663236336636362941..11-20207/,,//11<1000,0.1.2.////(.2.'../.1/1/,/5...3,/,-,,,,+$.8-.,-,.-/..++++-9..,*--/.+.*-..1@/11D2.-0-/-:.0,.*005+1///100/,.0,.//////133=/1//-0.1-043156758=>ENU]hWlicZOLCD><9411044444'43333002324522326/32.,/02&0/0-//,+///02010/'-.....-*2/,+/+/*..//,//+.-/+*(..//1..+///11*.-+)/-/220522//22//1/...1..11/2//-//////1////,*,../.,,-,--/01--,,),),&./,(.,../-2+201'.,,)/.-+.///..///12//.0././.52<:82. +,.,/./,,,1+++/,,,-*,)+)),++-(*',(-..)+)+./,.-1,,.,)+)**-.1(1/1/-,*)+,0,,+,%..."./../,,+-+/,,/....//11/./.2).--&020.333+244,5/6:;3900//.$/1/7..//-,-/0//--,.//1/71--1//./020012/1/,.././;2.00000/2///11--//164=841-+///.20.,,-9/*/9/,,0--,,+,+$*---***.././+&.///1>/,-...*)*-.0/11//0*&---0-,,.+..0///////0.0.0-'.++&.200/../2C//.0.1156766136446335/7<=BIPTNX{Яі–‘‘‘’’÷„„„ЎўўўЏџџџ№№Ёёёёяяааббвввгдддееежжзззиййййкллллммммнооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ƒ¬јЊљїєЄґµ≥≤∞Ѓ≠Ђ™©І¶•§Ґ°†ЮЭЭЫЪЩШЧЦЦХФУТТСРРПОООННМЛЪѓљ¬Ї∞ІЮЦЛАДЕММНИИЖИЕЖИМВЙЙЛЗЙЖЗЖЗЕЕА~vspT)3GRZduВЬ±¬‘зпћЁџбЁЁЁЏгжжея÷륁0doПќ„б№агбваббяяаабггвггжежаижижжгжжееаяЁў’“ѕћЋ√ЋљЌЋ”ћ„÷”∆Ќћёикя–«Ўлуцшшьыэээььювћ≠fr{аЄаЊ Љц€€€€€€€€€€эн≈≥ЫђЉЋЋ“ѕѕЌЋ  »»  «√Є≤їјјЅ…––“‘’џ„’÷÷џаяёџЎ„÷„ў÷’÷џ÷’‘—ѕЌЋЋ «ґ†ЗlВУЪҐѓ»ј≈…Ћ… Ћ ЋЋ»ƒ∆∆Ћћќ–Ќѕѕ““‘„ЅјљЅЅЁн€€€€€€€€€€€€€“ЇУЮ¶µµ¬»ЊЉЄЇЄ∞£ЬФЛ{tlg\OLHIEGGD?D>@8D8=AHDT\bfUba\SJFA<;80654222555.222455536330236/77631/0/002,263220232.1...61121//./../+,/.1/1///133//-//02/13572423////,510).12//0///-1+...-/1131/1///1-.///,/203/1/20/./0/.0-/,/110320//--.0320..111/11000/430.011.141.171022211/5221...01/0..,,/3//54100110./+,++,-*+*+..(150..11//.2/--/-.-*)....1/0//0-0,*,+,,,*./--2/./11/0.,00-0-&*/1.///(//50//2/3-37755155333342135+57==>6H-EbТЃ∆ѕ”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€≈ƒ¬јЊљїЇЄЈµі≤±ѓЃ≠Ђ™©І¶•§Ґ°†ЯЮЭЬЫЪЩШЧЧЦХФФУТТСРРРПООНННМФ§≤ЉЉ≤І†ЧММММНННИИЙМИККОИКЖЙЖЖДНzГrfU."*6?GMSS^jwВШѓ¬ЅЎеочыюзцолмнешЮlNVАѓЏдёбаббжббаааебггегггжжжгзжзжеекзйжгежвзЁџЎ÷“’ќ“–”–’”ќ…љ∆Ѕдажп∞ дрфшцшшщээююьлЭzwВЭ’‘сяабл€кст€€€€€€€€€€€€с»¬Њјјќ÷“ѕЋ∆Ћ «јЄ≠єЅљј«ћќ—“‘÷÷‘‘‘’№гџџЎ„’÷÷÷‘’„џ‘ЌѕѕЋЋѕ÷ї°ТpxР°™ЈƒƒЅ«……Ћ ЌЋЋ ƒ√∆«ЋЌѕѕћћћѕ“”÷ћћ«» –Ўзнмш€€€€€€€€€€€€€п…іЮ©ѓ≥ЄњЊЄіЃЊѓ£ШОМЖwkc\VRQNLLJJDE@?ACCEIIOMTX_f]VJQMFB@>6219966454:5:5457662026376322/6/2261432220022/1.105422=0..4/////1/<1/1113170//6020/115:424=1///.820,/2;2////2/2/1...///1//6///1./////01010?1320/000/7/.,///2612////.22=/,../1010126022001170/220230182621/1.11.0.161100,..0023;17210205,,,.+++1*++/.12/../5/.-1-/-.,,--+2..////.#-/.,,.,/-++.-+-==8B.;DOMQNTVN_NWNF@C>6619.9585455552223372101+5(/040212002230/1'1.40108+--1.//////8///1/0-3//-3/0.//039/2171/...3//.139222//2/31411-/-../0400//.//0//.0000:,2/0.0//*3,,*,//13/0--/.-117/.,,,.-0//0502/021050./2./...5,2//-/-....123./.0+-0.-..7+3-/-0/2(++.,+..*+(.+/.+++,1.+//+-*,(*++*1+.../,($,++,/0-.++)**++5-(*,,**+,/+//0-...),,2.5/3,/)0/6.**//1.510/220.00.022225588<=;;BGQWQ[yЭљ “‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€…«∆ƒ√ЅјЊљїЇєЈµі≥≤∞ѓЃ≠Ђ™©ІІ¶§§Ґ°††ЮЮЭЬЫЫЪЩЩШЧЧЦЦХФФУТТТСРРПОООНННШІ≥Їє¶°ЫЦПЛЕНЗЙЕЛЕНЛИГmZ.2,32:93:<=?>47==9DHPfЕ§Ј —”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ћ…»«≈ƒ¬јњЊЉїєЄЈµі≥≤∞ѓЃ≠ЂЂ©®І¶•§£ҐҐ††ЯЮЭЭЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННЦ§±їЊѓЭЯЯШФРНЙПППЙ}lNRNHA?/;@DFIFPSVQcmwДШЊ”мки«в—ЏЋљ”№–Ў“№№ЁяЁ№ЁўяяяяяяяаггббгвгежгжжзжжжжжижееиежежежггбаяўяяаЎяжѓЈ“’’’’џЏяё№Ї¶ЛjБЬ≈ЎмщшыщэьэыэююэщщшчсъЎёёц€€€€€€€€€€€€шпазж—Њ±∞їƒћѕ—Ћ—ѕѕ—ѕѕЌ“———‘‘ў“““‘—–——–ќ ’њ≠ПyГЗҐѓј »ЌЋЋ»»∆»» «« Ћ∆ƒƒ» ——ў—“ЌЌЌ—ѕ—“Ў““ќ““““–ќ““÷„ЏЁ“Ћ√Ќ÷у€€€€€€€€€€€€сжќ‘…є±∞©ЧРЖm}ИКЙЩ≠ЯОЖxle[\^YTPKHC=;B=DC??CHGQ\cMU\_TGNGG;<<8265124124541612222422263-230112152101/..1/1..///1.////*//0010///000123544221/111/234344121831230813//1///233400/000041.0337///////333//./2111100..0/./11//0..03021321/11/12011111111212/,-,,1/-.11..1060.00.--/,,,1*,..,,.1/1..---1)--,,(.++../-,*,*,.,.//1/--+(+++)+--/0--)'*3..-+(**+)+,-,,,++//,),,.(../.../-///-///.,//,//--///.00101/*0/1.1)5=8=?BD?R[ebzЙЩЃ√—”‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммнноооопррррсстттттууууфффхххххццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ЌЋ …«≈ƒ√ЅјЊљЉїєЄЈµі≥≤∞ѓЃ≠ђЂ™©®І¶•§§ҐҐ°††ЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТТСРРППООНР°ѓґљґЃЦПДЛФЮ°Пph\ZRNLOMIHFFGD@9=A?=C=2.:@@@KR\^qМ°і¬’”—»ќ”…ў≈ё’яяЁ№№–№№Ё№ЁЁяявббввбггггггжжжжзззжегжежжзиижжжзжзлсрџЎ—≈‘’÷’‘»—ѕ…ЊЪnvzПЩЈЎЁтмпухшщыыэээээээыээщцсбЎ »≈жы€€€€€€€€€€€южЅƒЇЋ÷ќѕѕ’’“’““—“——ѕ—ѕ“—““‘ѕ–––ќќ√ѓЩЕrЙЩ•ѓЅЎЋЌ—ќЋ» ∆»  »   »»∆∆»Ћѕѕ——ЌѕѕѕЌ—““““ѕ““’’“ќ“ѕ“ѕ“““—“ ј≠¶ЬЂ∞ёф€€€€€€€€€€€хЁ≥£ЛДВЬІ°•ї«њњї±ђ®ЯНЕ|xleYSNI@GGFED6?2?+27CGMV]bTcQ_[QK;@>:.45255751525252544453232/30203621112..000//621)/./1//11131///0233525565511335445655533343332/1/1.331/23622/0020402252135/322/0/5553///33332221/3///211110111121220-.//01/1/112001413...-(1...100102300.000,,)/,,(.././.1/11/--/*'*--.....2/1..,.,...21/2---,*-)+&*////++)*,.,../(***),.-----+0//),./ ++/+,,.+-//-/0/,//.+./,,0//...0-.--/-/02125.65777::9=99<@@Vs•њЋ“‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббвввгдддееежззззиййййкллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ѕЌћЋ…»∆≈ƒ¬ЅјЊљЉїєЄЈµі≥≤±∞ѓЃ≠ђЂ™©®І¶¶•§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТТСРРРПОООЩІ≤їЊЭЊ» ЅјѓЯС~fikbZTOTRMLFBDHIHRWWNcox~И£µ»Ўбир”равбяяџџЏ№яяяяяабябябаввгбггггжезжжееежжжжзжзжзимклфюжЋ»њ„аёаёЏ‘‘––™ДЕРЪ±√Ќджзккппхшшчыэээыэыэьюыюююыщщоъ’ў„ч€€€€€€€€€€€€л‘™Єј–№џў÷Ў÷÷’“ѕѕѕѕ—“—№ќЌ ‘—Ў≠ХМrИЭІ≥љяЋЌ–№—ѕ  »   »ЋЋЋЋЋ∆њƒ≈Ћ ЋЋѕ—ѕѕЋЋѕЌѕѕЌ—ѕ——“—“—““”““ѕ“ќ––“”Џёё“њ»–ы€€€€€€€€€€€€иџ≈≠МЯ≤√їїјЄїѓїґ≤ґЇЮЗАxskb[XQUPLIGDDDDDD=CIKNOOVbcfNUOIC.1387=;59655666552221233B442333002B1..2002F1../..///31111//00001:24446:33153445635644333522/2311<32044=2//0092=242<0&0:3922/3355333/./23321111:121811/2/310000721...007210115100127/.02/6...00...1800.007///6/,./././11.1/0,,----+.*..00:/6././...,/,/9/0-+-6..*(,-,***++,2,*.F-*-+++,2---0/6/;,),8...<..+,,+,*,,.0/0/.,2../:/..../12.11..//3232=34226977:>@DJBYgr^ЛІї —”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€—ѕќЌЋ …«∆≈ƒ¬ЅјЊљЉїєЄЈґµі≥≤∞∞ЃЃ≠ђЂ™©®ІІ¶¶•§£ҐҐ°††ЯЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТТСРРРПОООЫ®£МЛЛОЯђґЉЇ•МБwm]XPPIJHGDIF>=A;OPW`Qf]VVTMGA+=:62525212212444622,201,0/4..-.//.2/../-..////002/0-0-,,--/000400///214102434131100*13202/0/00200...2(2/0-0,+/0/2//(/03//./,/1///+.,.-/...2.///-0000..2*.-.--(102//.01.(..2.000//,,,00...03.,*,,/,..////,),*,+,*,+,'')-++(*!(+..2'.)+)+***++,-.*+*+).+.+((*,,,,**+,*(,/&**(&'()),),,.+/(((.*-*.(()+**+,/.,-&,,*(.+++.,,,,././.22/./(.11.1).,,-0-/03047:0240.7AIMqЬљЌ”‘‘’’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггддеееежзззиийййкклллммммнноооппррррсстттттууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€”—–ќЌћЋ…»«≈ƒ√¬ЅјЊљЉїЇєЈЈµіі≤≤∞∞ЃЃ≠ђЂЂ™©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦЦХФФФУТТССРРППООНННМЛЛРЬІ≠±©УЗ}sia[TPNPQMIIIB@@EAEDDCEKEOW`dozЛЪљ“йофчфоўйвззиииежаяя’яяёЁЁяёвяябггггжгегебегггеглю€ѕ™Є…зжвдажд„ШdiУЂљ“”’’÷’÷÷÷÷ў№Ёявдзкмнтуххцшшщьщщщющщццпйвё‘Ўомуо€€€€€€€€€€€€эя÷ƒ√Ѕ —’’——ќ ≈≈Њї†u|ВНЫ©ЈЅ«ЋЋ ЋЋЌЋЋ…∆»∆∆∆ƒ ЋЋЋЋ∆њƒ…ЋЌЋѕ““ѕЌЋЌЌЌЋЋЋЋЋЌѕЋЌЌќ“—ЋЌќћЌЋЋЋЋќѕќЋЋћ«ћƒƒЈљњЋ«…яи€€€€€€€€€€€€€йЋ®ЬПҐѓЇ≈¬¬ЇЉЃ≠≠≠†СНЖyohb]SOKNQMMCIAE??>@HELJTTOTTQKVKKD97655.!5524444544151312121...1:000//1.//1///22920030-,,,#031333111329444646443310/33211/11/0/3;0/02/200/6..//////./260//0./0///06//.....?...0/2261'0<00...0.8281//10/.//2/112/..5...1/000.,+,.,.//////,+.,+.+,,,,+)+.-+.-(*.3/5+++)+///-,,++**,,,+,,3,***,,,.,*+#*(,+*--)('(")-,,.,++(%*++-,-*&*++,,,..-,),*'(+..+*+...../2//22/6../1.(.6/,-0-,//-04;244838=<=:QiyДЂњћ“‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббввггдддееежзззиийййкклллммммнноооопррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€‘”“–ѕќЌЋЋ…»«≈ƒ√¬ЅјЊЊљїїєЄЈґµіі≤≤±∞ѓЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩЩШЧЧЧЦЦХФФФУТТТСРРРПОООННММЛС†≠ЄЇ≥ЯО}slfaZSPPLHGJIIIIIGGECNJPLR^_hwЛ§±…„ёёмочэрюшспкжжяваЎ№ћ№’Ё№№ёяаавебвбгаггггежкю€Ђ°®“зевввё√•lmЛЫ≤Ќвдаяёё№№ўўўў÷ЏќЏўЁЏяявдкммпртффхшьшщщыышцтпмфлййш€хщу€€€€€€€€€€€€ьиЎЅЅљƒ≈ћ Њ®ЂhsНУҐЃЄј«ЋЋЋ ЋЋЋЋЋ…»»»∆ƒј∆ ЋЋЋ»√∆ЋЋЌЌ—““ѕѕЌѕ——ѕѕѕ——ѕѕЌѕ—““—ћѕѕѕѕЋЌЋЌ—ѕЌЋЋ ƒЋ  ЅљµђЛДПХєёйнущю€€€€€€€€€эъъбєЃЩ§¶ЃЃЄњњЇЃ∞≠£ЭЩПЗyqgeb[UKKGGGFD?@=7B6D=I:GJV\P[GROKD:1<:.62545541425432222422:411224///////249644630000)0324463355496668664766533333020322212:22462644060/00033324444/32/222223722211..8.0.104461+1800000006/6511111.112/252///20//44100--.//./0.///,/.////.,.-./-//.-11--.2.2/..+.00///,++*)*.,+.+2+,+,,,..,,,',*+.+..+))*')---,,+((&+)*,**''.///.---*-*-+(*...,,..+//.+//2///2../..*/43/00++.../27464977:773=D=DT]^vС∞≈ѕ”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€÷’‘““–ѕќЌЋ …»«≈ƒƒ¬ЅјњЊљЉїЇєЄЈґµµі≥≤±∞∞ѓЃЃ≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЫЪЩЩШЧЧЧЦЦХХФФУУТТСРРРПОООНННМЛУҐђ±≠¶ХЙyqic`ZUQQQONKGHN=GCK>AIBJLXajyМ£љќ№мыш€€€юсюшрлжяв‘ё’„Џ÷№ЎЁЁяяёёёяягббгжжзэю®Ы∞Ўжжа⹫ЫohЙ®є гоизжееввёя№я№№—Џ÷Џ“„„„Џябввддилпттхшшщщшшшхщцщшыю€”÷Ќгнэ€€€€€€€€€€€€ффлё–ƒї£КЕ]wЫ≥ЈЊЅ«ћћЋЋЋѕЋЌ…Ћ»»»»∆ƒњƒ» Ћ »∆∆ Ћ Ћѕ—’ѕ——’““““—““—ѕѕ—“””—“ѕѕ——ЌѕЌѕ—ѕЌЋЋ √ЌƒƒЇЃЯЖ}ЖЛОМЪ£ѓї» п€€€€€€€€€€€€цов“«≠©†±їїєљїЄњЈґЂ•ЫПЖ|sh_]XWTQLLEE;>C>DCUW\DTMUQJMGGEB=854=6333232446241334/3211//1/024664=6;632446663:113>6536355<3668533511023<33/1094833220422222>3///4A4/44///1/./.14354219-.17.;112843121911.//22211372011100820///1/1/.,1//1;/..4/0//,.//-5,//1./.-.,.....0..../.../@0*,.,)+,)'+-)3..)),,(,+-*+'++**((+/.,,**),,.-+**'')+-,,,)++-++-3-++-,,+.++++,.,.,4.,(../,-,+*+.,+.-/,*-/.,,+,/.+.(./-0//-022044464>IH?Q_ej®Ї«“‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммнноооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъъыыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Џў„÷’‘”“—–ќќЌЋЋ…»«∆≈ƒƒ¬¬јјЊЊљЉїїєєЄЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶••§§£ҐҐ°†††ЯЮЮЭЭЭЬЫЫЪЩЩЩШЧЧЧЦЦХФФФУТТТСРРРПООНННМЛХҐЂЃђЫМodYYUPSVUNELKIBG7>.>.5696ENVcQ_[VTOF<;1<9635/3.44525.125.113211/./036434464423464304//053212/216+3553313/1/1-0/0+//3330100/22333153/)/151234////.////32321/3(.0/(4/202121200//,.///1/0020224310100//././..(00113.-,,./.,,,/0),%,-0-.---/.--.---,,/0....0,,*,,+++(*+.)--,)).,(.*-** )))('%*+,.**('(+*-+*,&&%,.-,,)))((()---+++...***+*,+.+-+($.,,&**(*(,*)))-()+..,++++++.+*.(0)-(/00/0//,/06-84-'))04EZtТµ»”‘‘’’÷÷„„ЎўўўЏџџџ№№Ёёёёяаааббввггдддееежзззиийййкклллммммнноооопррррсссттттуууууффхххххцццччччччшшшщщщщщщщъъъъыыыыыыыыыьььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€џџўЎ„÷’‘”“—–ќќЌћЋ …»«∆≈ƒ√¬¬јјњЊљљЉїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐҐ°††ЯЮЮЮЭЭЬЫЫЫЪЩЩШЧЧЧЦЦХХФФУТТТСРРРПОООННМЛХ°™ђ•ЪР{`efa[ZVVTSSOMLNLFNCSXOHXdp{КЪєЎр€€€€€ш€€ьыфкб„…√ђ√ѓ√Ќ–”÷ЎўџяаџёЎейољХБ_АЭЇЌЏивежззиййзизизизизззжеегггя№ў„’—ќћћќ…—÷ўёавжзккмммлуюг’лпцшшьшььъшщщжб–мэ€€€€€€€€€€€ъз¬њїЅЅћ’÷’ѕќЋЋЋ∆∆ƒ√јј√ј√јЅјљљЉјЅ√ƒ ЋЋЋћЋЋћ–я–ѕѕ—“’“‘‘‘ѕ—ѕѕ“’’’‘‘–ЌЋЋ Ћ√њ§ЛИkПУЮЂ∞ґЉњј»√√јЅ«ћќ––””ЎўѕћїЌў€€€€€€€€€€€€эіЯЖМО•µЊЇґµ≤ї≠єµ≤©†СБ}xsg\PPNKGIGFDB>?>>7B6@FJQV_[QJ]MFD=>=:988686<655=433345212444433642654266635:1*054222203?586655552212121426315533351123666:3/-.29//44242/////3532213>33342:5=2023220/.2//1/132330345:43110011241/.//01333/1-(.//..,/8,)+"-7/..,/6/..4.0/.,,...,,////*,**(*,.5.+,)((,.,6/4.-*++*('((+/.**+'#)(((*0*#),-+--***)*++*-/--,..2-*+/-++;+**(+6.-**-*(%***)*1*.+,++*((((,+-/0.:0/,,///00//,/22430348@DHMT]b{О∞ƒ—”‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщщъъъъыыыыыыыыыьььььььььььээээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€Ё№џЏўЎ„÷’‘”“—–ѕќЌћЋЋ……««∆≈ƒ√¬¬ЅјњЊЊљљїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§££ҐҐ°††ЯЯЮЮЭЭЬЬЫЫЪЩЩЩШЧЧЦЦЦХФФУУТТСРРРПОООННМЛЧІґґ±ЯМofbVISWTORRNLLPPLLDGGJGNQhwИШљ÷ны€€€€€€€юкњ±Э†† ђћ£ћґ«‘„ЎЏ№ё√ҐdА|У©ƒёябггггжжзиижззиийиизизззизиижегбя№Ў’—“ќ…—ћ” „–„ЁЁЁ№÷гтлб№ћлшшшщщщщыщщъшшрпу•§Щ≈ятэ€€€€€€€€€€€б«£ѓґјЅ–ѕћЋ ∆ƒ√√њјњјЉЉЉљЉљЉƒ  » Ћ ƒ ћ“ћѕЌ——“—’’“ѕѕѕ—“‘’‘‘‘—–—  ЉѓХqМИМЩ§∞≥ЉЉњњј√њјњјƒЋћћћЋЋЋћћћЌ ЅєЊґ√ƒйю€€€€€€€€€€ыў≥ГКЛЪ¶ЇµЄЈ≥±ђ∞Ѓ≠ђЂЮНАwle^ZQMG=99@5D9=>HKVdN\WVMFB@=125<46*:44444545576664646675467764995458468523385869555522-1/1/475356785353535846311-/12+2432224251212542227464644,6625544//./244544123123362443114464/1..11/130(010.11//,+/+,/++1/.///2..0.+.-,+,.,'0,///0./**---./,.)+(+*+*/.0--+-+,(***---...)(/'%(+--'++)++*---**+++),+++,*-'+)+***.*+.++/+-,,/.++.+*)*-(*/*(*,*(((+)+0/,1/.,-..-.,///,///./00-467;@@?;?AISjРє “‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввгдддееежжзззиийййкллллмммннооооппррррсстттттууууфффхххххцццччччччшшшщщщщщщщъъъъыыыыыыыыыьььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€яё№№џЏўЎ„÷’‘”“—––ќќЌћЋ ……««∆≈ƒƒ√¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©©®ІІ¶¶••§§£ҐҐ°†††ЯЮЮЭЭЭЬЫЫЪЩЩЩШЧЧЦЦЦХФФУУТТСРРРПООНННМЛЧ°Ђ¶†ОГwsj[X[[WYYWRTWLLLLLNPR\amwЗЦЉёош€€€€€€т€сб—« ўЋ÷¬Єјњ’  „£pm|РђЇЎёзбзгегжжззизззкзйзйзззззиикйизйгеаяЁЁ№Ё„„÷„”„’÷ў÷÷’—ЌёяЁ№„днфххшщшшщьшщщющмАo°Ґеѕ€мрб€€€€€€€€€€€€ц„ќњƒ«ћ’ѕЌ ∆∆ƒ√јЉ≥ЇЉЉЉљƒ» »  ћ∆»ЋћЋѕЌѕѕў—’“—ѕ–Ќѕ–‘‘‘‘–ќ—„џ∆™ЮnРУЫ•≤єњњњњјјјјƒњјƒ  Ћ………ЋЋћћ’ћ ƒ∆≈Ћѕџяесх€€€€€€€€€€€шзјЂЩЫЭ§ҐЇі±±ЃЃ≠ґ†∞ЭКА{sjf^UDMMJIIKC=>C>??EDT@HOPNJJFF@=5554877.2254310498849770449055522665556596642231227.2153334464835520211135425223301///76422112310043402/1164249242:7522/222,//.1201221212222130..//-///+..1,.0.)++4,/1102/,././/,/00022/.1.,3,.+*..*--5*+,/,-,4-.*+(*(/.,,+*++*((*)**+0**-)((#((((($(**)***))**()((())*(*$**)))*+*+(+*.++)+**++*+.+(+*))**)((''('*+****(*++,.,.,.,.,.+..1///1121318::779;FRQ[fsЕІїЋ”‘‘’’’÷„„ЎўўўЏџџџ№№Ёёёёяаааббввггдддееежзззиийййккллллмммннооооппррррсстттттууууфффхххххцццччччччшшшщщщщщщщъъъъыыыыыыыыыьььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€вбаяёЁ№№џЏўЎ„÷’’‘”““––ѕќЌЌћЋЋ……»««∆≈≈ƒƒ√¬¬ЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠≠ђЂЂ™©©©®ІІ¶¶•§§§£ҐҐ°††ЯЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЧ£©•ЪБwrnjbZZVUVUUTOTLLMIFLQW`hrЕЂЌлы€€€€€€€€€€юырЁЈ≥fm}£ІІ—ћў÷„ў№Ёягягбггггжбегжгдгжгзззжзжжежжжежжжжеежггая№№џ„—Ў„’Ёћі–“ў№яягзиллмок∆ФnhТ™ќгцьчцчтрйккщ€€€€€€€€€€€€€€стйџЌњƒ∆Ј≥≥Ѕјњї» »ƒ  »√∆ Ќ Ћ Ћ∆ЋЋЋ Ћ ЋЋЋ ќЌЌ –∆љЃЗxzБТЫ©ґњњјјјЉјјјј√њњєњ√» ќ«≈≈««……ЋЋЋЋЋЋЋЋћЋћƒјїЉ≤ѓ™љ«еы€€€€€€€€€€ьи„±ІЯХШ££¶≥ЃѓђҐҐФЖwgfjjjjg_\VUPKHD>D=>=95:AA=CGDLINONIBA?@:?<5.5554.36686936773649044422665556566542281147.2142323465:3535120/1363343/3316.//96125213322242201,024422428466522/222,,/111/-221221131133////////,/..,,..)**../1302/#./.3../000220011.,,.+*.1+---**+--,-...+0(((,.,,+*++1((*+)*+-**+'))#.('((#'(,)+**)))*'''('''(((%,*()(***.)))+++++*))***,(()**))*))('&''**(***(((*+.+.*+,1,,*../././/1/1.454/1247759;@@@Ql|ЯЉ “‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиййййкллллмммннооооппррррсстттттуууууффххххххцццччччччшшшщщщщщщщъъъъыыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€дввбаяёЁ№№џЏўў„„÷’‘‘”“—––ѕќќЌћЋЋ ……»««∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµііі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂЂ™©©®ІІ¶¶••§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЧ†©•ЪКАwlfdb^[VVRTROUU\W]^`_js{Д†¬ёф€€€€€€€€€€сЋҐГЦѓ™•ќ≈«ƒј¬≈”÷Ё№аЁяяабзгггггжжжжжжжззжжжззжжижижззкзздегвваз乄’»“”’’÷÷’Џ№№аая№і†НpЕҐѕЏпыцшцъшююььчхртп€€€€€€€€€€€€€€шжлмбЋј∆њїњЋЋЋЋЋЋЋ  Ќ“ЋЋЋЋ …   ……Ћ      » ЇЂОvЗБТ†ђґ√Ќ«∆√ƒјЅјјЅƒјњЉњƒ Ћ“…«≈«……ЋЋЋЌЋЋЋЋЋЋЋћћћћ—ћќѕ“Ќњ¬≈»ќр€€€€€€€€€€фа√Ќ√µІІҐЩ†ЩЬЗ{km|АГЗОХЖБ|qk_[URRMIFB@?>??=66=DCKIJCFNNJGJB@A?<9.79499;667:7:9;5454425776687887633;2/2825.44333355<422723223311/35/9336//1:5/46524455664333025442474:43553553332/12122+0235522321441123/222/1220.00+..011/2010+//5////,./00/22.0//.,/3.-/.---/--.///.4+*+,,,++'++5***,++++))+'*+)0(())(((.'+++))*+*'))'&''()*,******+.+++.+,..-+**((('((((((**+(('&'*+*+*****((+++*++2+*++.1/1//001114454222568;<=@2@LQPewЪі«–‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммннооооппррррсстттттууууфффхххххцццччччччшшшшщщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€еддввбаяёё№№џџЏўЎ„„÷’‘‘”““—–ѕќќЌЌћЋЋ ……»««∆∆≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїїЇєєЄЈЈґґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМНЫ§Ђ•ЪБzkd]ZSUVVVVVVTWNLBEEIKVdo|† с€€€€€€€€шёЇ»∆Ўг÷њ≥££Я»±¬Ќѕ÷ЎЎ№яввгбгаггггггжжжжеежззжжжжжйжйииизйззйыоџ—““÷ў÷÷÷’»’Ћ Ћ≈єФnw|УЬ¬жбцутуцццщъъыъэыьыснея‘дт€€€€€€€€€€€€€„–√¬Љ»ћћЋЋЋЌЋЌѕЌЋЋЋЋ»…» » …Ћ …√∆……∆™СВtИТЪ§ѓїјЋѕ »√√јјњјјƒ√јєј∆ЋЋЋ««≈«………ћЋЌЋЋЋЋЋЋ ЋЋЋЋЋ…………«…« ґ≥¶ЯЧ±√м€€€€€€€€€€фяЯЩЙРФЗАsaБТШ†≠Ї≤≤±©°ЭК}uke_XSSJGDBA@5=2@2@8C=FVKPJ][UOIG?=<;/::;979767:95256615899566:8:3225002514&547433414112424352204-255>536//24356963476678444735774474476444466555521214521227573322631223,25223241400+0121//0/01,,000./2.+.-/11321121//.0---1-.--+//,////+,,/+,++&*+,**+,,,,*')-/+/#*#*,,)*(* ***')*,*(*+%''()+,.,***))++***/,+...-))'%('''(*&**,,(*($*+*)+(*(*(''***(+--**+++.././/0/03306443366653474597:;;7>?JT}©√–”‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяааабвввггдддееежзззиийййккллллмммннооооппррррсссттттуууууфффхххххцццччччччшшшщщщщщщщъъъъыыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€жееддввбааёёЁ№№џЏўўЎ„„÷’‘‘”““—––ѕќќЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉЉїїЇєєЄЄЈЈґµµііі≥≤≤±∞∞ѓЃЃЃ≠≠ђЂЂ™©©®®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМОЬ®§ЫФЙ{ogVZ[]]^\ZVTPWX\CU^ir~Н£Ђбч€€€€€€€€€€€€юсмзЏЋ≥ЦЯЯќЌ–“џбвагзЁгааагвигвгжежжзжжжжжмййийиизййлю€∆Ј≈—яиаяё№№џ–…ƒ §zВШ®µ”’зиморрпфщшшщшщыщющюъюьэюрг’х€€€€€€€€€€€€€оЄЊ«≈ƒѕ÷““ѕѕЌЌЌЋ…« Ћ  … » √ЅЋ‘±ЩТuЙЦЮ™≤ƒј∆ ’  ƒ√јњњј√ √√њ√∆ЌЋ—««…Ћ……ЋћЌ“ЌЌЋ ЋЋ ЋЋЋЋ—ЋЋ …«…«…«Ћ ћЌ””∆»ј–Ўхю€€€€€€€€ьж≈РФС†Ѓ©Ч¶®Ђђђњ™≤Ѓѓ™§ЩНБyslgbVINOLIIGDAAABBA<>>GWUUJdHNDFGDBA>7<9947;5.464)38A;<0;0C)5=GFJIJVKNIGD@=<6*6225521568<965:8:7665.225/557*54888552255455753351////235+337776742,764272339775744666642,1331143443214566663.31.1.1.,.0313.../,/.410*0021---,+,1/0/1..//.///----++,000--+,-1,,**(*)((((++++,(+....++$((-*++('*)-*-*( '(&&(&')'*+**.&(&,#())%)**)**,')*('''+!'*+&*++*())(''($'&(#''''*'(())('()'$''(*++)'))+)+(*(*(*&**-'.+,*-12/,0-,-01120100340<@@6@?BB_НЯЃќ‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммннооооппрррррсстттттууууфффхххххцццччччччшшшшщщщщщщъъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ййизжееддгввбааяёЁ№№џџЏўўЎ„„÷’’‘‘””““—––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈≈ƒƒ√¬¬¬ЅјјњЊЊЊљљЉїїїЇєєЄЈЈЈґµµіі≥≤≤±±∞∞ѓЃЃ≠≠ђЂЂ™™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТТСРРПОООННММРЫ••ШЛГzuf`a[[TZ\VURSRWZV]`isГЦљгъ€€€€€€€€€€€€эхеЏ–∆Ќ∞ҐІЮћЉЌѕ÷№Џ„Ў№Ёяажбббггегжжжжзжздилоюю•Ї¬„еежжееялёјМdnДЩЃЅў’’’÷““—’÷Џ№ЁЁагзкоррррртфцщыцщшъопмпфтыы€€€€€€€€€€€€€тж «Љƒќћ»““ѕћ »≈»µ™ХnqВНЪІ±Ї√ƒ√√∆∆∆ƒ√√√јњњјј∆јњїњЅ« …ƒ……Ќ ЋЋћЋЋЋЌЋЋЋ  Ћ ћ»»»»»»«Ћ≈≈√√ƒƒ≈«≈Ћƒ∆Ѕљіµ≥ЈЇЊ»Ћџаы€€€€€€€€€щж‘™ШЗФҐ®™є±≠ЃЃ±®≠§§ЪРНЙ|tlgbTLIGIHGAC=D85=:C@DEKJKLIYEIED:7769;8888:<8989886=9700575887/4598<884558555955521/253357/6697661591952343347455750677942//333143655425566649210,..1..1252210/10/0410.22/0/.----000/0//.//./(..-*+,,//0-,,.00.-++**))(%()+*+/+/,,+++.()).-))((*)**++.%()((((5#'')*'*5'()0))+))),)**,/**-((()3'(*+(*)0*(**)'''&(''$''&(.'*)(**((((''(((*++))+1++*+***/(*--*.,**....)0/,,/0/6/0/./0.2442778;BF@?K{ҐЊЌ‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежззззиййййкллллммммннооооппррррсссттттуууууфффхххххцццччччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€лкййиззжеедгввбааяёёЁ№№џџџЏўўЎ„„÷’’‘‘‘”““——––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈≈ƒƒ√¬¬¬ЅјјјњЊЊљљљЉїїЇєєЄЄЈЈґµµіі≥≥≤≤±∞∞ѓЃЃ≠≠ђЂЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТССРРПОООННМЛСЭ£¶£ЛГysiaa][VVW[^WW\]a[^hrЪ адф€€€€€€€€€€€€€тв‘ЌњЋ≥™ҐШЌ∞Љ»–÷÷ЁбяяабвввегжжжгзззкмюэЫїћЏжгевавя’•УrsМІ«–ягяёЁ№Ў÷’÷–’–’Ћ÷–№Џявбаззилоуцхцхъшшчццосрьь€юсшъ€€€€€€€€€€€€€оџ≈≈љ≈ћќ…ЋЯ§gpИХ§ЃЊЊ√«∆∆√ƒ√ƒ√√ƒƒјјњњјƒњњєњЅ«Ћ«Ѕ«»Ћ ЋЋЋЋЋЋЌЋЋЋЋ Ћ Ћ…«∆«»»∆ ƒƒ√√ƒƒƒ∆≈…ƒƒ√√јЊљЉЊђ†СДЗ§љ÷зктъ€€€€€€€ющпЏЋ≥£ШЖШ§±©ѓЂЃЃ®®££ЬШРЖyqgc^[TIGEHGCC????@5C@IHeТґЌ‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежжзззиийййккллллммммннооооппррррсстттттуууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€оонммлллкййиззжжееддгвввбааяёёёЁ№№№џџЏЏўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћћЋЋ  ……»»««∆≈≈≈ƒƒ√√¬¬ЅјјјњЊЊљљЉїїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЦЯҐ†Х|rfd\^[ZU]^`ZXUSPSSVVftУЈн€€€€€€€€€€€€€ючсеЋ©ЧАјФ§ѓЅ¬Ћѕ÷„Џ№№ЁббаЁ“№яяёавЁ“СW|ДЮЃ√№яеееззиззжжежевваё№џў’“—Ћњ∆Є≈ђ±є¬ћЌЌ÷ЁЁавжжгоьужд…лшшщщшцшщвЁЌёи€€€€€€€€€€€€€оЋФ±њ∆—Ћ≈Ћ…»∆»«Ћ  ∆»√јњњЉЉїїєїљ≈ јјјјƒ» ∆»» »Ћ Ћ   Ћ… «Ћ………«≈ƒƒ≈ЅЅЅƒ∆ƒ√јњњїї±¶ЭЖmЖБКОЩІ®≠ѓѓ≥ЇЅјј†°ЪЦМЩ• дщ€€€€€€€€ыр”ЉШФМУШ£І£©™≥Ђ™™Ѓ≤ЃЯНЕДxpaTSMNMIGIFE/?=?/?@AFGKJKL[VLMNG=;7<:59<989<98955984/1/5554813000117224414556544/64434573555546567576612022//291/1/1245545434556223433-20000.///....+3./..,,,/..,/11/121.0/1/./-(*.-,..0.+'*(**+*,+-..+,&+*((('*#'*)''('''''&)(((''+(((''')*('"*')))))''&()))*('%&&)((+*#'''(()+)*(('(('&(((&&!&#%%'%(('''")*)''%&%)&$$&'''*"''*+*(*'(()'*'()))+++++++*,+.*+*...,..*$(*.,,/.*,0101..)0-/"2--.5/bЦЄћ‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббвввгдддеееежззззиййййккллллмммнноооопппррррсстттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ппоонмммллкйййизззжеедддгввббааяёёёЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—–––ѕќќќЌЌЌћЋЋЋ ………»««∆∆≈≈ƒƒƒ√¬¬ЅјјјњЊЊљљљЉїїЇєєЄЈЈґґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУТТТСРРППООНННМЛЧЫЬЪС}vjbU]ccbccccgY]^jsqmЙ¶…№€€€€€€€€€€€€€€юцлџїСgѓУҐЃЉ —÷÷÷№гбяЏбЁ№№нзбЂlwzЩ±√№џжежжжжзиизизйзжеевввбяёая„“ѕћ…≈≈ћќќ–“–¬”ў№яагкькз÷еншхэцшшэшьщьэхкџрь€€€€€€€€€€€€€№Ќњ¬∆∆√ЋЋ—“ќЌЋ— ∆√њњњЉїєЇјЋƒњњјјЅ«    Ћ»  Ћ …… …  —…………«≈«…«∆∆»»∆√јњї≤√±ЩОwЖИУШ†®ђѓ∞ѓ∞™Љ”јЉїњЅƒƒ«ћ…јґіђ÷пэ€€€€€€€€эиї†А{УІ≥ѓЂ≠©ґ©™∞ѓ©ЮЬШЙ{thaVZZVUOKJICCB1@CE>EAKWK[JVHMGDA):B?+FINVkЦ≤∆”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввггдддееежжзззииййййкллллммммннооооппррррсссттттуууууффххххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€рррпооонмммллкйййизззжеееддггввббааяяёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—–––ѕѕќќЌЌЌћЋЋЋ ………»«««∆≈≈ƒƒƒ√¬¬ЅЅјјњЊЊљљљЉїїЇєєЄЈЈґґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММПЭ®ђІРД{ke^]V]b__`]d^]Z^^el~Кі—ц€€€€€€€€€€€€ый∆ІУКАqbЂqґП™љ«Ќ–”„ё№я≈ѓРj~ЖЮµ аяягежгжжзззжзззжижжежжееегггя№ў÷‘‘“––ЋћЅ«јћЉЅљ№гкркіЁинпууххшцщшщщчъноѕНЬХњў€€€€€€€€€€€€€юйЇ≥ЂЇ√∆«“ћЋ∆√єњЉї≥Їљƒƒјєјјƒ«…«   ∆»∆»»»…«≈«≈…≈«…………………    ƒƒњњ≥®Эyz}ДПЩ£®Ѓ±іµ≤≤ђµЉ∆њЉґњјјјјјЅјјљљ™Ѓѓ≥ђƒ”рю€€€€€€€€рёƒПНДМСЃ£©Ѓђ∞ЂѓЂ®†ҐШНАwsje\XTM=CFC@CB=4BB?7GHJKLOJVURPMC??89488:8877555569455255578855466989965886898=378:7;767:9;97962666665656568787444147336223-36655250222144//..0,+.121./.111321231/122111222320/,-+,,//.+,./1.,.+++*+,..+**+)*(*(,,,*,(*('*-*++*(+*($*)*#'))')((#).-./-*''*)"'&'&'&'+*(('(())((((*'*(((*(+,.++((('&''(,,,*'))(((&&%&&')))**.***-*+*.///-...++.*++.+-+/***,**,,..**,,*-%.,0.0.1,,*/,./2469=>>8>EKcЙѓ—‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяаааббвввгддддееежжзззиийййккллллммммннооооппррррсстттттууууфффхххххцццчччччшшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€тсрррппооннмммллккййииззжжеедддггввббаааяёёёЁЁ№№џџџЏЏўўўЎ„„„÷’’’‘‘‘””““——–––ѕќќќЌЌћћЋЋ  ……»»««∆≈≈≈ƒƒ√¬¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶••§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТССРРПОООННМЛТЬЯ†•КАvgjgeb__cc`b^\cjmvЗЩјЏоъ€€€€€€€€€€€€шЏ ∞®њЯѓПБРЬ¬≠јƒЋЎћ≥ЧnzРЪ∞¬бябябгзгжжзззгжжзжжжжжжжежжжжегвзёёЁ№џџ÷’ѕ—Ћћ«≈«ƒгапрЂ“ЁбжймсуцчшшцшщьъењИr•Ыдрш€ьы€€€€€€€€€€€€€юрЌЋ«« »≈∆∆јњїЉјЋƒ√њјјƒ≈««Ћ»»∆Ћƒ∆∆∆«≈≈≈≈«∆««…««««∆»»Ћ∆јњ√є™ЧxyvИУЫѓ≠ЊЄґєєµ≥≥ґњЋјњЉњјЅјјј јЅјјЈљЇЇЈЅ ћ”Ўму€€€€€€х€юнЁћїЯФЛФЫ≥≠≠±©≤І©Ь£ШНЛЗ~vjcZMUZUOQLGHE:=BEGGBHGLMU]ULCD@A@B>>>98985567C788863665554466<98985566669F758E:A747:9F967767666<6<666E:77855544443346A2668663206250////1144A1/10.1/32111161//222//2=2011/,,1,,.0//..,./.,++,+,+/..**+-*+*1*+****(/('))+---*6+)(+**&)**)**,(+,.++*)'&)*&(','''((((*())*)*),(((0)*)***++((('(''(''+,+''('((('&&((**+*++3+++3+++..--.+*+++.+*+.-3,,*,******,***,-+/(2,(,7,,,*,,,2,/1226664896228OГ©¬—‘‘‘’’÷„„„ЎўўўЏџџџ№№ЁЁёёёяааабвввггдддеееежззззиййййкклллммммннооооппрррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€утттсрррпоооннмммлллкйййизззжееедддггвввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷÷’’’‘‘‘”“““—–––ѕќќќЌЌЌћЋЋЋ ………»««∆≈≈≈ƒƒ√¬¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§££ҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТСРРРПООНННМЛФЯ†ЮЯНБxvjeb\\Y[_g`gedho{ЗЬЌўзн€€€€€€€€€€€€€€сџ»≈їїШНЙЖµЕ{loКУЂґўбЏёЁябгбггггггггггггегжеггеежгжжйггвгваёёџџЎ÷’“—–гбшиЬ«”„÷ўябеежмоммкк№ЫНx~ЂЄнлщронцщьышэ€€€€€€€€€€€€€ъяћ≤≤™≥ґњїЋ≈√≥јјЅƒ≈≈…Ѕƒј»√√јƒ√√√ƒЅƒ√ƒ≈«ƒ∆√ƒ√ƒ√∆јїїѓЧПВzЕЕЦ£≥ґµњЄїєїµґ±ґЉ∆њњїњј√ј√ј»јјјјјƒјЅƒ∆∆јјїјњƒћ—Ёжшм€€€€у€щоЎ…є™ШБОР≠†©£®¶Ґ†Я¶ЬХqgf}Іw\ZROHBDFFFB@654545444122033=36663320.5/1/.,0/1164>110000+011///2//00//2//6////.,-//.//..,/..,,,+(++,*,,,))*+*+*.(((((((,(()))+(+(2+))((*'((*(*,-)+),)))'&&'(%('+!&((''((''()#)((&(&-))'**'''&&&&&&&''')*)')(#(((''#((((+)))/)+*/***+*+)(&'))'-)*'.*/*((*)))('(***+*,(,).,')2*(,****/+++..1110221,//=9ADQlЮЄЌ”‘‘’’÷÷„„ЎўўўЏџџџ№№№Ёёёёяяааабвввггдддееежжзззииййййкллллммммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ууутттссрррппооонмммлллккйййизззжжееедддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„„÷’’’‘‘‘”“““——––ѕѕќќЌЌЌћЋЋЋ ………»««∆∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛХЮ£ҐУwokebabZ_\YWZ^]^hlvИєёц€€€€€€€€€€€€€€€юйќ±†МЯn]iЙЦМ≠±‘ѕ“„№№яаагяааввввббгбггжгжггежеззжежежжегеаааяЁяЁиегт№ѓЅ–—ќѕ“’’’‘№ЁёяЁ«РrvzЦѓџесьууфроаяЎднъ€€€€€€€€€€€€€юпоЎћјѓѓњјљ≥«ƒ«≈«≈«Ѕƒјƒ√√ј√јј√ƒЅЅј√ƒ ƒ∆√√ј¬њ√њґ≠ТЕ~~ЙУЪ•±њњїЉїїєїґЈ≤Јљ√њЉїњ√ √√√ƒјјјЅјЅјјЅЅјЅјјљґђ™•®®ј’яйш€с€€€€эсЏ«™ђ§ІЬЬШСЮ¶Ђ®±±®РАotѓ‘Ђxnhg_\QLPOGE@B=A<:=@D=IIQJLJJJ@B@@7>>>67886797685546666656574:3546764417595146662676563/374650474535144132.226386.232222.//--61026442:120/+/0211////14/+2/////./..,././.,,-4//+(,+((+,+(++)**+*.**(((/**(((())))(+&*+))((+'%(+*',0)+(+'*'''%'(%'(+!&(''''(&'('!'%"$&%)))))''''%&&&&(&'&''('))(#'((''%'(('*)*(+********((''$&)'&))+'-***())))))')***+))&'')*))*('***((**&)+*+...*..*/,5*,+0079:9:848.3265655226612288668863464774453453412./*.01242332173146///1/./1/0/3///203//-*,.--/0-,+/0,./++**+(*.+,,+++,.*+)*'+,)+,.,+**+))))(('&%''('(((++)*'''+*((('(**'''&&())%))'&&''''''&'')''')))+''))+++.++*(*()&)))))+**(((*++*'))*)*)+**(****,**))*,#)*)&''((+*+((',(),,+(*++---,++-+-0/000/$/056933113;ErХЇѕ”‘‘’’’÷„„„ЎўўўЏџџџ№№№Ёёёёяяааабвввггдддееежжзззиийййккллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ццххххффууууттттссрррппоооннммммлллккйййииззззжеееедддггвввббаааяяёёёЁЁ№№№џџџЏЏўўўЎЎ„„„÷’’’‘‘‘”“““—–––ѕќќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННМЛСЫ•§•Ц}xsmhghkkkloqvx{{КЪЃґо€€€€€€€€€€€ы№ктхтниЋЬУ|th’ЯµЊ¬»—ЎёагжвЁяааггкжзеееггеежежжжжззйикю€Ёѕ’ЌЁлабвв№џ÷џ ’ЇЮУn~ЛЬ™µ…–”ўЏявжжзжзкрухцрштхтшуыцщыкб’зп€€€€€€€€€€€€€ЌЅђЈƒ ћ“ЌћЌ ««≈……»»∆∆ƒ¬ЊЊЅ∆©ХЙqЙФЪҐ≠∆їњјѕ√ЋјјњњЉјєЈЈљЅў√јЊј√Ћ∆«∆∆ƒ∆ƒƒƒ∆ƒƒƒƒƒ≈ƒƒ√ƒ√Ѕ√»Ѕ√Ѕ√Ѕ√ЅЅЅƒƒј∆Ѓґ≤ƒЌЁжсэ€€в€€€мџЁџ‘ќ±ЙЇ∞іµ∞ѓѓЋ≠√їЃҐХИБ|vpbWPTQNGLLGGDAABD?ENJJOVIdFDBAA<==:=::988:7799746666689::J:7997=9>:88K8::G8866986>45456<67556=212M66665447434620/35:311411-0..143A3,1<311;001>0%01123B1./600/.,,.0//.1.//1/',.*)*+**(*+,+*+,,2*((+(/(((++(*+*++-**(()(')'*(*((*3,,)))2)+((()**''('())/))()&&&%&'''')*.''')'''''.''''((*,),'*)))()(),*,(((++,***+)))/**(*,,,3*'&'(1'')*'()()++6,,*3))+1+((.+.+-,0++*'+*-/-----6231-377:>EGG]|•Њќ”‘‘‘’’÷÷„„ЎЎўўЏЏџџџ№№ЁЁёёёяаааббвввгдддеееежззззиййййкклллммммнноооппрррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€чччццхххххффуууутттссррррппоооонммммллллккйййииззззжеееедддггвввббааааяёёёёЁ№№№№џџџЏўўўЎЎ„„„÷’’’‘‘‘”“““——––ѕќќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦХХФФУТТСРРРПООНННМЛФ°¶•ШН~wof[]W]]i]k[^^_cn~У¶÷т€€€€€€€€€€€€€€щлв„ЊµИlni±АТ£њ«ћѕ“„ЏЁяявввабббббвввгвггггзги€€јє™„бжггеввёёё ≠iqoАХ£∞Єј≈ј…Јј≈¬Ѕ»Ќ”ўЁёгззиммннпнррсуонкдоў’«’„тю€€€€€€€€€€€€йљґ®µЈљЅЋЋЋ√∆ƒ≈¬љµђ•НmЗxВПЪ¶ѓїњїЊЊ√Љ√њњїЉїЉґґ®ЉјЋјњЄЊњ√ј√јƒ√√јƒ√ƒ√ƒ√≈ƒƒЉ√јјїјњ√јЅјЅј√ЅЅЅЅЅњЅЉїЇґњЃ™І≥Ї–”мю€€ъ€€€юбЌђЩМООЫІґ±µµ≤Ѓ™ђЃ±¶ЯСЕxske\OLFJJE@C;A6BBB266EDDJDDBMC??:=::99679767:64448697=97622968875;2667333535241212/766163600062232230423012/,225/10110*.+..//51114101100040,0000.1,.-0-.-+*,,000*.-.,/,+,,&'+*&'&(((((****'('((('&&'''&'(*(+))$))*''&(&'''$*')''')'''''''''&&%'&)((&&%%%%#%'&&'(*&$%%#&&'')&'&&''')*)&((&%&'& ('((''(#(+*((&&&*((#(,)(*(%%$#(&&)(&(**)((,++*+(((,(((*'((*'*''"'*))*)*)*(0/.,,-./.0227884=F^|™≈“”‘‘‘’’÷„„„ЎўўўЏџџџ№№№Ёёёёяяааабвввггдддееежжзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€шшччччцццххххффууууттттссррррппооооннммммлллккййййииззззжееееддддгввввббаааяяёёёЁЁ№№№џџџЏЏўўўЎ„„„÷÷’’‘‘‘””““——––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛЧЭЯЯЧЕwvohg`d]\ghhlnr~Р™Љ…Ќяи€€€€€€€€€€€€€юуз„ѕ≥ЈОzБДПЮњґ¬…—ЎЁбавба№яаааббгбггггззиэю±£єЏавбвевёйзжІ|ssБЦ∞«ћ“ќћЋћЅЉ≈¬ЅЇ≈¬ћѕ—÷ў№Ёядждиийнпрнннкузжаимцэхшу€€€€€€€€€€€€€фб∆ЅЇј»≈Ћ «√Њі®РjwМЙЦЮѓ≥ЈњњЉЉњњЊњњ√ЉїєїґЈ≤Їј“јЉїњј√ƒƒ√∆ƒƒƒ∆ƒ»ƒƒƒ∆ƒƒЅƒ√√њј√√Ѕ√√√√√ЅЅЅЅЅјјњљ√ЉЉґЈЃґ∞∞ѓђѕищм€€€€€€ььлЁЌї©ФШЪІѓ≥ііЇ≤≤©ђ£ШФТЛВrnfVTPNOLKDAEC=;;@A/DDBD@=>669999999977799=48::9:7:96689:8996686989788:2605522663656513365533441:7446563533363877654663163100,0/./12021///..........,+/.0,*,.*''+(*+(*(*(**+)%***)*.+++)+((*'%&&+)***+)++()+,*''((())))+((((''''&'''%&%)*)&%&&&','&('%&''')')&)&))*)*%#$ #&((&+()(()+(((*((((((+(((((&&&&&(**(&(((*,,*,,++)*((*('(((*((*****((++-++++'*+,+++,+,..00-.-.0105651:BKPSv•Јћ“”‘‘‘’’÷÷„„ЎЎўўЏЏџџџ№№ЁЁёёёяааабвввггдддееежжзззиийййкклллммммнноооппрррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€щщщщщщшшчччччцццхххххффуууутттттссррррппооооннммммллллккййййииззззжжеееедддггввввбааааяёёёёЁ№№№џџџџЏўўўЎЎ„„÷÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУТТТСРРПОООННММПЫЯ†ЩЛxplfm_g]bbd`aajyЧµёт€€€€€€€€€€€€€€€€€рЁ…ЂМїЗГЕПЪЮ¬Є¬ћ“„ЏЁЁ№яаввааажкпі≈÷ябваважяЋ¶zmКЦ©Њ”джгевваа№џ’—ћћ≈≈≈ƒЉііЇљјЅ««…ЌЌ”ўЁагжзкнсррую€в√’имаеўйс€€€€€€€€€€€€€€шнм„њМЧfxРЩ™јїњјј√јњ√њњњ√њјњ√їїґґµєљЋњљїњ√ƒ√∆ƒ∆ƒ∆»Ќ∆»∆∆∆∆≈≈∆»≈∆≈»ƒ∆Ѕ≈ƒƒƒ»ƒƒЅ√ј∆јјјјњњњ≥¶ХСИЩЩЯҐЈЊЇµљƒ÷айшю€€€€€юъщкбЋњµЄ≠Ђ™®©©ЊЇґ∞ЂЂ£ШОК}rlg]]TRNJDDBA6BAC:AA;DHLHOGGP@@:H><<8:9926979:?4:::9:::<789:<9:::898997588=26266326565565.1565536463:87565<5744353676477776144100,-/./1100///1/..-5...../,//,+*,,*((*(+,.+(*(+++*'-***,..-+*(((**'$&*)**+,,,+(%+.*)'(()+0++*((*(+&&'''''&''**''%&&&'''')'%&''')&'&)',*)'(%#$$%(((&((,)))*(((*(((.(++*(+((&&&&&'*+(,(((.+**++++)*,**(('(*-((**,**(''*2+++6&(,,,,,-,-..01-.**,.(./0(01641.7=>Z|Чµ““”‘‘‘’’÷„„„ЎўўўЏџџџ№№№Ёёёёяяааббвввгдддеееежзззиийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ъъъщщщщщщшшшчччччцццхххххффуууутттттссрррррппооооннммммллллккййййииззззжжееееддддгввввббаааяяёёёЁЁ№№№џџџЏўўўЎЎ„„÷÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННМЛРЫҐ•¶ЪЕxpppmkhdb`l}ЗЙДЧ≠“ч€€€€€€€€€€€€€€€€ысўґ©УРИ∞ХЧЫЩµЊ≈ Ќ”÷ЏяЏЏЁбя№№÷№аааябёяƒ≠БiЕЫЃљ—№ажвзежвжяя№џўЎ„’“ќЋњ»««ƒњљЄєєњљ≈Ћ–÷ў÷№длклнюца Ќзцнысцчсожнф€€€€€€€€€€€€€ня«≠ЫТЫ™«ѓґЉјњјњ∆јњјƒЉњЊ∆їєµ≥ЃµЇќљє≥љјјј√√ƒ√ƒ∆Ќ∆≈≈∆≈≈ƒ≈ƒ∆∆…ƒ∆∆ƒ√≈√√√ ј√ј√√«јјЉїґґ≥≠ЫИРКЧЯ©≠і«ƒƒЅ≈»¬Ѕј∆ќ„№зтфъ€€€€€шхяўћ√Їµ∞≤Ѓ°•§≥І≠≠Ѓ£ХПЖБvrhb[YVRHFHGD?B?7=DBEBEAYAAEWDC@8A;;36:7:7B:8777=:<876::=699:899953346=2866633666033300352258454;59555=38221215333666552131//////////././//11-7.0.1.//1+(((+,*)))(**.('('*)+*(0**),,+*(((''*-)$****)+****'!*.*))''((3))'%!*(.$#$&&'$&$''**'&'&%%&&&((''&'''('')'.'&$&%$&'&((((((.))))&('*(((/$((*(-('"'&%&'((*.(((.('(*(((((,(((*((*/('(***''&%*5(**9((***-,-,--**2--*)*,+*+/..-11113559:68=BDBBHDGCCD7;4;2:97625<9:662998565866682112/3+336333367+2250013//222435/33333/0.2.1/2521226111331/////1/3//,.,./..-+.*..//../(&'(*,('+))('('(*(((*(%**)$***((((()***),+*)')'''*&'(+)''&#%%)')'$#!$#$#$"&"$"$$''&&&&&#&##')*&&'&&')''&&##%%&'&$'$'((&(&('' )'''($&&'*$'&&&&%%&'((*''&'&&&'&('''(''(('''(&&'(((&%%&(*#('(&'(((*),),,)&,*)(((+*(*/++****)-,./0(.,3476:LvЧљ–”‘‘‘’’÷÷„„ЎЎўўЏЏџџ№№№Ёёёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ыыыыыыыъъъщщщщщщщшшшчччччцццхххххфффуууууттттсссррррпппооооннмммммллллккййййииззззжжеееедддггвввббаааяяёёёЁЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљЉЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛЦЮ†°ЬТВwgebegrcurz{{vИМЭ©„у€€€€€€€€€€€€€€€хгћ≠Нy`ihЯqДЭђ≥њ«“№Џ№яяаббж≤ИМeАЪ∞јЌзаявеввггвгггбаабааяяёёё№џё‘ЌЋ»ƒЅјјјЅ√ЅЅƒ«ћћќаюя№ћ ЏннмпсмхппрсуючщхцсдЏ¬ь€€€€€њю€€€€ућіУ†™≥∆ ∆јјїЉїїєЈґ±±µЇ“љЇєїљј√√√√ј√√ƒƒƒƒ≈≈ƒƒ∆≈ ∆ ∆««»»Ќ»ƒƒ∆√«√¬ј√ЉґѓЃ†ВФОШР°®ђѓ≥ЈїƒјЅјЅЅƒƒƒƒƒ¬≈«……ЋќљјЈ≈ќжкы€€€ф€€€ща≈ЩЯЬЪЧ©ѓ∞ЃЂј•∞£ЧПКБ|umhcVGVPLEFFCC?>=4><><>?BCFdC@BH?6>::+9K9896668989665568633533378988537A566C5153202225685455533229250255215>55566333/0/33A33//./.,.//..1//-+,3*!(*.2+*+++(****++)(***(******(((('*,*++-.-**+)''.'(*2,)'%% &((-((%&&('((('''&&&')(%$''''-'&'''!''$&')'%&&%%%$&&'(''''((&&&((()1)))*(&%((1(((((*(&&&'''((('''('%'(''(((''((&&)&!'''&&$&%'('(''&*(&(*))('(*(*(''((/*(*;*((****3,+,.+*+../259:ELfЙ™Љѕ””‘‘’’’÷„„„ЎўўўЏџџџ№№ЁЁёёёяааабвввггдддееежзззиийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьььыыыыыыыыъъъщщщщщщщшшшччччччццххххххффууууутттттсссррррпппооооннмммммллллккййййииззззжжеееедддггввввбааааяёёёЁЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФУУТТСРРППООНННМНЫ¶ЃІШНГxgb_YVpjo`bdbcnАКМЄЏ€€€€€€€€€€€€€€мЈ¶ММРxffbЬhЩ®µЉ¬»”Ћ¬Яe}}ОЫ≤ЎЏбЁяяяаббввбвввавбввввббгвббаяЁ№ў„“–ћ «ЅјЉЅ≥≈Ђ…÷Ё÷÷љƒЋ÷Џ№ЁвдийкмосспптмдЇo|ЙШ°ƒа÷∞рхю€€€€€€€щйќ©ЯН°©њЉЉґєєґґґЉ«љЇ∞їјјј√ј√ј√јƒƒƒЅƒƒƒ≈≈≈≈≈«∆…ЋЋ ЋЋ»ƒ∆√≈√¬ЊЉїђ†ТsНФШ†•ѓ≤µµґєє√ √ЅЅƒ«≈«≈ƒЅƒ«»∆∆∆¬Ѕ¬Ѕ∆іЈµЉЉЁиш€€€у€€€ысЏЌµХШРґ£ЃЂ®™©©•ЩУОИГrlbVRLMJGECA>>>7<<<8?CJDEPGFDLD>::=79971889986968897795355757788866.5696555246425345486666555.52545,25645686632+//1/531//./..//.0/0///+++**../2.-++--*++,1.)*++,,-,+++*+)(('(+*---.-,+++)'*'((-+*+)'&*'')')('(($&'())(('')(+( $$''''(''&&''$'''&&%&''(('()(&'&')&$&&&&((*)(((*)'(')'('*++*(''''#'('"''(%'(*'&(('((**)&&&&2('&&(''*('((('*&('*'(('(('''##'*,(('+'(*))))-++*+****(*.//1/5:=>FMpОЫ©љќ”‘‘’’’÷„„ЎЎўўЏЏџџ№№№Ёёёёяаааббвввгдддееежжзззиййййкллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ьььььььыыыыыыыыъъъъщщщщщщшшшччччччцццхххххфффууууутттттсссрррррппоооооннммммлллллккййййииззззжееееддддгввввбааааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУТТТСРРППООННММПЭ•™†СИvwmiilh^iiopvДЬњ‘Ёмщ€€€€€€€€€€€€€ож ¬ї¶ђpz{АТ§ђљЧjoА{ШҐќ—Ё№ЁЁЁяяааббаббвбгвгвгвбвжггггбжаяё№џЎ„‘“–ћћ«ЋЄіжб’г≥љЅ«ћ—”’ўЁбдззнппупз¬w{°¶њдзлбртзъю€€€€€€ю€€юлёЌ≠ЂІѓїЉЉє≥ї’љ≥ґїљЅ√√јƒј√ј√√ЅЅЅЅЅƒ…≈≈≈«≈»»»»  »ƒƒ¬√ј¬Њґ©ЦУzБХЮ®∞ЉЄЇїєЈїљ«Ћ≈√ƒƒ«««ƒ≈ƒ≈…ќ……«≈ƒћ≈≈јЅјЅјЅќ“ўЁкаъэ€€€€й€тбЋј™ФЧСЯ™±™§†Юђ•ЧТСАqe\\VTNLJKKEEA:>9899::88G898999945:895346566714676536266647445466666659252235155<66565522/2131<3/00//////./040//-,+*.1114--+++-+.*,.0*++++,,+++((*)))((*)+-+--+,0+(),)))++(*+'('&&)(+))((''&'(((.&&'")0#$$''((*(''(''''((''&''&(((())'''()&&''&&(&'('(((/))((((())*)*(((.%'*'')(1'((/($((('(0**))&&*($&(/)(*'&(((**'*(,)&'((.(''&&'(*'*'('*((()))++++*((((+,.,.,/1767;EPMV^iЙЄѕ’’‘‘‘’’÷„„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€эььььььььььыыыыыыыыъъъъщщщщщщшшшшччччччцццхххххфффууууутттттсссрррррппоооооннмммммллллккййййииззззжжеееддддгввввбааааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММСЮ¶Ђ†СЗЕБwjjfdddsnrssxК∞„Ёзн€€€€€€€€€€€€€€ьџњµ©ЪЖ}}v|il|А{Н©«…„÷ўЎў№№№яёяёяаабвбвбббабгбвввбеаваяяёёЁџџ„„÷’ћќцзѕ—©љЇјЄ≈љ»Њ¬…ќ—’Ё№Ё÷¬Ђ|yАКє¬ипптопузййзкоььюц€€€€ю€юъзў÷јЃЩЭ®ћЈ≤≤ЇЉњјЅј√јјјјјњњљљјЅ≈ƒƒƒ≈√ƒƒ≈√∆√ƒјјњЊїµЂ°ЗПМГНЮ®∞њјЉЉЉїЇїї≈ћ≈ЅЅƒ≈≈≈ƒ≈≈≈«Ќ»»«≈ƒЋ∆«∆«∆«∆Ѕ¬Ѕј¬√¬ƒћ„вйын€€€€шпзз”≈њ•ЩМЦЩѓЂ§£†ШДzpolhfa]\VOKBBCCC@;87>7?9P>>?CGCJ??<@==99C8858999429573233354422345522.4464555556636552823//1215265524//,0+011.830//0/.//1.-/3///,++'000./&+**'+-+')(.*+++*+**))))(((*)(&(***)+),/)))+()()(''*#&$%&('))))*&'''#%#(#'#(,&&$&$'$(!$$''''''(''&'&&((('((&'''('')'&%&%&'((&(.()(((''('((('('*#''***(/#'&+'&'&'''-'(&'&&&'#&'.))/($(&&''%(')''(''++($'$''(%'&'"(('&')))+**(''''*(*(*((+///-25777:>?A6:6:85899557786686.55565<444655886763144666533'585536554524453520130430//.//4/...+++-+0.9,,/.,1.,++---***+++/)*),+)+..**-)()-*-)+)$++**((&,+++((*' &('('''(')**''&)&&%&'''%''$&&&"#'*'''())'&''''''((''(($''&')')&%'+*)((''(''((''()*'"(***)%%)'((((/'"''''&$'(()()(*(-('%''*')*'&&&($&(&&'*&&''('&(''(('%%-%''+'&'())(*''''(''&&'(+***)('((**)%*'/22/1/@JQ\uФ™ЊЌ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсссттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююэээээээьььььььььььыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффуууууутттттсссрррррппоооооннммммлллллккйййииззззжжеееддддгввввбаааяяёёёЁЁ№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ……»»««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛЪҐ£ҐШИvod^VqWkV]]`[``rДіЁ€€€€€€€€€€€€щ∞≠УЊ—∆ђТxk\ЫiuzЗШ•ѓє≈»Ќ“÷ўЏ№Ёяяяябаяяяяааввгггбввеееежиъюџ®љ÷ЁЁ№ў„ў’Ќћ≈√≤≠ЧzcИГНФҐђ∞¬«ќ–’÷ЏЁаабджзйкмннлтмлпў”… Ѕаую€€€€€€€юиёґ∞§ђ≥љЉЉњјјјјјјЅЅЅЅЅјј√√јјјЊї≠†ОzyyЗХЮ™≥єљЉјјј¬√њљЇЉљƒ Ѕјƒƒ∆∆» »«ЋЋЋЋЋ»»ЋЋћ…«»» »«≈…√»≈≈ƒƒЅЅЅЅЅЅЇЅі≠ЯІ©љ–гт€€т€€€ыпа≈ ѕ∆ґ£ЙФ∞£±£іµђ§ЪЦМum\WMNNH?HHGEB8>/=9;AAABEDO@@@=>999;7578696<86895656484666=64643.24666585567532554554566563611,242/3./22/..1*+*+*.-.+,11.1----*.0..,***+%)).,+,0/,)+)))-++*)*,+***(*!,)(,+(,*''())'&%&'))*'(&*&&(%''&'&*&((% $''"''))%''&&&''((('''((('()&'&&'*+**(&'*(''('$+**&'++*-*''('('(&)''''&'#&&(*((***()('')'(',*+(('*%#'(%&&(#&(('%#''*(*''%'#&&'''&))))(&'(('''&%'*++,,)&#(*()'%$&'(%(+,+' ).:F]mВ†µ≈“‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччццццххххххфффуууууттттттссрррррпппооооннмммммллллккййййиззззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМНЩ££†ШРАwkjghhvrvzБВНМЮ∞‘н€€€€€€€€Ю€€€€€ысйё ≠ЩЖs]ioО£ђЄ≈”№ЏЏбиб№№зЁяяаягяаажбвбабггжгееюо’Ъ£ўвЁляяяв„г”᥀ИlГСЫ£Іђ≥Јљє≈««∆ћѕ’„ЁаёёадиллимрлщлукфлйоЏЏўтью€€€ъ€€€чиќђђ™ґ√∆√јјњјљјљјњјј∆јїЊ∆µ§НnВ}НЩ§ђ≥»њњјјјј√∆јјїЉљ»∆∆јЅƒ»»  …ЋЋ»»»ЋЋћћћЋЋ  Ћ    —»»»«≈≈ƒ≈ƒƒƒ≈√ƒЅƒЅ≈∆∆ЊіїЄѕЏещ€€€€€€€€–ЖДyІУ£Ю£≤£їЮњЈђІЩД|xslf_[WNQOMHDB@1AAA>>AAAAOAM>>=>=1999A9C858G89656C56256668662666635=69775/553344245<555D311322281/01..18/0-+-2-,,+16/..-**-.....*)*0)++1++,1.,+,+++/++*((0+****/*6(*2,2****),*)'''''*'&&4(&$%'&('/''(#$$&,'''))&+&$'()1**(((,(.(().('')(*)*)*(!(,''(**.))'%')')'%%'')'''.'*'''(&&&'''(/))(')*).)+(2*2)''.'#'-''&('(()(%'((/***('(%&&"#''(**(('((('(''&'(**,)&&&'&'&(&&'(&&((,2.62,)'7KWcnЖ£є…“‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббввггдддееежжзззиййййкллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшчччччччцццххххххфффуууууутттттсссррррпппооооннмммммллллккййййиззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»««∆∆≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУТТТСРРППООНННМОЫҐІЫСЙwnebZmWr`gjd^iuЖРЃ«кы€ц€€€€€€€€€юсЎ”…єѓУn^__lwЗТ®ґЅ∆ Ќ”÷„ў№№№№№ЁяЁяяяяаябаббг„ЅНїЏ№ягаааяў№ЁЇЗГmАРЯђіЅљњљЊЄђљЃєђѓѓ≥іїЅ∆ –÷„Џёагеиикзлкккиккньзћ©„лю€€€ь€€€щз”Ѓ°ОЫ†ЉЈЇЈЇєЉЉЉЇ±ІТrnhvЗНЫ®≥≥їјљЅјјљњњјїїєїњƒѕƒ≤јƒƒ∆»… »Ћƒ»»Ћ»ЋЋћ«»ƒ»  »»»Ќ» »»««»∆Ѕ≈ƒƒЅ√ЅЅЅЅЅЅЉЄµіЃ§ФЫЧЂЄ„лъ€€мя“Љ±®ЩЙy†}£С£•°§Я±ђ®ЯХГ{ulf]XQMIFA>EB>=9@6>1?9ADA@@L??>6<8<25185665885525666666*666544836996665/2321.130208121212/2//././12./---/,//003/,**'*--*-*+(((+!(,,))).*))*(((,(*(((+((((!+),''(,++&((**+*))&%%''%%$&%%""#%#$#&#$$#$#"'#'''($#'!#$(%*))'''(#(''')'(&&''#'&)*''*&&&)'*#%&%&&%'''#%#'&'')'''''''''(%'$(%''()*')''')&)''''##%''&&%'%('%'(#*+*((%%#%#"!$#&&(((&'('&&&%$&%'())&&"#%!"%&&&%%"%%''' ')(')!0)+$/6HVoНІЉЋ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшшчччччччцццхххххххфффууууутттттсссрррррппоооонннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆≈≈≈ƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМПЩЯ°ЦРvjoc]dgicrintИҐѓµ¬Ўэ€€€€€€€€€€€€укўћЊ©ЫЛВ}uvr§МШІ≤Ѕ»ћ“Ўў÷Ў÷Ўг№яЁяЁяЁяяаяз“Ь™ ўЁяябаяв№№ЉИГv|С¶µ∆”’ѕѕ—ќ…Ѕ≈љЊЈЈЈґґ≥ЄіЊ¬≈»Ћћ–÷ўёдкзжйкзккнр€зЋ≥÷иплмъую€€€€€юькЎЌґ©Ъ°©ЄЉЇєіґ†ui]zИХЮ™ѓЇЉљљљљјјљњљЉїїєґљƒ √Љїјƒ∆Ћ…  Ћ»Ћ ЋЋЋЋЋЋЋ»»ЋЋ»  Ќ Ћ Ћ»»»∆≈∆∆»∆∆≈Ѕ√ƒЅњЉљ≥ѓ¶ФФЖЬ©≤њ∆—ёЁЎ÷Ў№љ”ѓЉђђ†ЫСОЛЕ£У®©™®Ь™СЭЪХАuple_ZRUQNLGGCD>A?9AA?=DEAE=?=A9877766)5555266>66662666655=667<::665544212322232233391011021111/1/./9/01022/.++)+-.-..6***/(*,++)*,,+++(((+(+*+*+*(((&1*/)))+*('(*++,**)&&#&+&(%&&0&%%/%&$#$$$#%#%'&+)'((%'&$$('%(''$'($(''''''&#&(&+'')&')''()).'#%%&%'''-%'''''')'''')2'((-((%"'''')-('('''''''''%%''''&''((/(#(-')+((((('('$#$#$&(&'&''(''&$#&&('((''&%&"%&'&&%%%&&&%# '(')&+''&'/548IVepЖ†Ј»”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщщшшшчччччччццццххххххфффуууууттттттссрррррппоооонннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶••§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММРЪЬЫХЛ||wpfkcb`dyhjmsЛі“№всю€€€€€€€€€€€€хЁЋЇІЪЙЪБtur£С£±ЄЅ«»—ўЎ№№№ў№№Ё№ё№а–Ј∆“аёяавяяЎ…≥z{АИШѓќ“џёЁџ№Ёў„Ў“ќЋ»∆√њЇЈЄ≥±ЈЃє≠љєЅ≈Ћ–ЏЏЏявбжзлцюз—ЉЁиизбжкйлнъыюю€€ц€ъхг№ќ»њЃ§ЦЬСq^dНЪ∞ђґЇљњљЊјљљљљљљњЉїЈґїƒЋƒµљ√Ѕƒ »»«…»Ћ ЋЋЋЋ»…ћ»ЋЋЋ» Ћћ ЌЋЋ»  »»  »»»∆≈√√јљЉЈђ§УШЬЧ¶≠≥іµЈїјјЅ√«∞«Љ≈ЅЉћ≈ЅїЈІЂЩНҐЙ†Л©ЩІ©®££¶ЩНЕ|qkf]VIGLLKGE?>AA>8E>D:?AB?====9;/3564368=62665656997;678:6:5867455443.13323644723234653222/,..50101310./.*++/-0/6,,+/,+....,-)/,-+++*,,,,.,,*))'0*.+*)+(*(*(*(+)**))&&**)''*.)'&+$&&&'&&$%&&''+)(((%('&$%$%''('''#''''''''&&'&)'&&&))'*())-*%&&&''))-')*++*))'')''.'''*()(%('%%(*(()&&())')))''''')))***.'%'+().(&&(*)*)&$&##&&$&#&('(&($#''''('&&'''&%&&%%%%%%&&## #'''''''''.,$+069=>DJ_yЪ∞¬ѕ‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщщшшшшчччччччцццххххххфффуууууутттттссрррррппоооонннммммллллккйййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌћћЋЋ ……»»««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТТСРРПОООННММСЪЯЯСД|vofcp\X\bddfmxП±„зф€€€€€€€€€€€€€эй÷Ѕ©ПДxЩmpv{ЪРЮ≠єЉ√Ћ“”„№№№ёб„Џ—÷‘„бЁёбббёћЂyiЗНЭ≤ќЁЁаяаааааааЁў№‘“ќ ƒ¬ЅјЈє≠±ІµЃ±ЈЉј≈«ћќ”„Ёбжшэв—Њўдйннзнба—ЎЏвнтюс€€€€€€дщз“ґ©°НnlХ•ЉЇїњјњЊјјјљљЊЊљњЉЉЈЈї√Ћ∆Јј√√ƒ»∆…« »Ћ ЋЋЋЋ…ЋќЋЋЋќ  Ћћ ЋЋЋ Ћ    Ћ »»ƒƒ√√њї≥®§ЦМЫЮ•ђЈ∞≤µЈЈњєїєіЃґЉЉЊЉѕќ÷ўЎ–іњ§ђЛ£СШХХ¶Ґ™ЃіµЃ™ФЩМБym_]][WPPMHEFK=B>B:?A??=?A???7756764775266566<8888688888376=465558123324754313234643244/,/.2081321.../**+/.//0.,+/,/....-/,/,0,,+,,1,,,+,,**)*)*+))+*+*1(('*(++.*)&(*(&((**(&&#&''(''&'*&''*))((&(&&$%&''(('''"''&')'''&&'#''&&&))'*())-*''&&-))))'-+,,+(-''))')'''(')((('%%')(.)&&(+)''))'.'&'*)**+**(('((),&&&()'+)(&($$%%%%#%'''#*&$''''''&&'(*&%&#""%%%%&&##"##%''%'''% +' ))+())++4BL^jvОІЊћ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыыъъъъщщщщщщщщщшшшчччччччцццххххххфффуууууутттттссрррррппоооонннммммллллкййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТССРРПОООННМЛТЫ†°ТМГxkmptjhhmxyАДДФЬљѕъ€€€€€€€€€€ююфня–Њ§ИАuШv}ГБЦКШ•µЅЌЌѕўёѕ÷“„‘ўў№ўяЁЎЉѓИiБЩІѓћ№џЁяаббабагяаЁж№№Џ„÷––ѕћ«¬ЇљЇЇіЄі≥Ї≥љЇƒљ≈ћ№мюў”√÷џзлмжозпиййейџаалтцю€€м€€€ю÷Ёі¶В§≥≤ґ∞≥≥љїЊљњњјЅјЉјњњєїљјƒƒљј√ƒ√ ≈«≈»  …Ћ  »  ѕЋЋЋ–     ЋЋЋ Ћ  ∆»»»∆ƒјјЅњЈЃЭЪЫРЧЫ•≠ЇЅЈЈЈЇїЅЉїїЉїЇїЄЄґЈґј–ћ“Ј’»ї≥ѓ±£§Х™†ЬХС≠™≠Щ≠©Ю†ФХИАtncc^\PPRADDA@@@>9::>9A6:778883988365566=5555488556666A43365:333324540024344522212/../20;110.*++1+)./////**,/./-.....(..4-/,.,3,,+(*,*+**)*)(*,+.+5(''*(+*.+*&'(''&'(()''%%&'&('&)+''&(((((()&&&$&&'($''(&'&#&+''&&''&&'&&&))'*)))/''&''1'))''.)))((/''**''%%#'')'''(%%()(/(('(('&''''/'#'())()**'(&(&((%$$$'&')(((&&%%''"#&'# '&%'%'%&%&&''+'#$!!!"%"%"%%%%'#'%'#%##!&&'''''+-///./8>CKU`h}†Ї«”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыыъъъъъщщщщщщщщшшшшччччччццццххххххффуууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»««∆∆≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПОООННМЛУЫЫХД{rg]_]mOORSSRP]fq}™÷ф€€€€€€€€€€юшйвЏ≈ѓЩ~jVЕQZ`r|ИЮЯ≠ЄЊ√ЌЌ–‘‘÷““ќ•rmjДР©єѕЁџЁЁаабаааааЏаёааабяЁЁЁ№Џ„“ќ «≈јљ≤©ґЬі°≥Ч•ЂѕгЏќ’∞ —’ўЏябдззззджвагЏўЋ≈ѓЅ—к€€€аюљЌѕ»„Ѕ∞¶©©љ≥ЈґЈїњјњїЉЉЉЈєїјƒјЈњј√Ѕƒƒ≈ƒ≈…»» »»ƒ  Ћ ЋЋЋ»»«»«»»Ћ«»»»√∆∆∆√√љЉЉђ§ХБЪЦЫЮ§ђ≥јЇЇЇЉЉЇЉљљљљЉЉЇЇЈЇЈЈґљ©≠ђљїїњє…ќ“ј≤ЃЩЗsЫxДСХ†ШђЯґЃ¶ЪСЖ}uqk\O@DEDEGEB7:7=/=,978=9<9><><<:44452221444444552212152834353242.223343413/012../1+1.0.+&.*..*.///..())-+-+.-.-- .,.(.+,+,+++(*-(**)'''(),++**''&'&(()*)#&&'$''('('('$%%!'&'))'&%&&&&()(%%%%%(%'#$$'%&&&#&&'$$&'$'''''''#))(&)&('(''#''&"'%&&&&)''))''##"%''&'''%%((%()('(&'#&#&"&'&&&(&&)))&&#&$&&&&$ '"''$&&$''%%%""#&"#&##'#%"%###&$&&$#!# # " ""%&% %#% #  %%%&##$''('&$$!# $&'*8DU`qУ±ƒ–‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььььыыыыыыыыыыъъъъщщщщщщщщшшшшчччччччцццххххххффуууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆≈≈≈ƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПОООННМЛФЫЫЩУДxj[cfgeqnomz~КС£≠Ћвф€€€€€€€€€€€шЁЅЧЦУ|cc_[QНhДЦЬ£≠Ѕћ‘‘ЏЎяҐ{{cПЫђєѕЏ„№ЁЁяаааабаяёаааабавбббеёё№№ў„÷–ѕћ…≈ЅЅЊ≥Ј≥ЅЈпа“г¶є¬»…ћ”’ЏёвддддбаибюќмЅЖФС±ЋЁвЏ—‘ић€€€чкаЉђЫЮЮ≥ЅјЉЇЉїїЈЈљј≈Ѕњњјƒƒ«≈»»≈…Ћ ЋЋЋЋЋЋћЋЋЋ  ЋЋЌ…»»ћ»»»Ћ»∆∆√√њїјђЭЮИЫЭ°§©ђѓЄЉЊљљЇЇљЉјјЅЅЅЅјљЉљљљЉњњњЉљЉіїґЉјљ√ї„—ѕ≥І§ЬИsЮ}ЬЩЯ¶ЧЦТ•†ЦЫЮЖyunhc^WROICEDCC@>=;;89899<@=A6/65655+4447455631222457565;4442475379744=201:111101110..4...-///..-,-,0+,-....0.1.2--++((((*(+4+(*+('*)+-,+*(()'))*)%*+*))*(&(('()*'%%''*(*'''&&&'&&&)(%&(().(&%&&&%&'''''((''''*'***'&'('&&)'('))&'))+))'&'''+))))'''###')'))''%''%''''''''(''%#''')'&''))'''(&$((((&.'''##%('%'''#%&#&#"%*'%%*'#%'&##!%#%####% ""%&'%'%##%!!!!##%"$!''&&&% #('+*+/+'$)'>XgtТ≠¬ќ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююээээээээььььььььььььыыыыыыыыыыъъъъъщщщщщщщщшшшчччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФФУТТСРРРПООНННМЛФЭЮСЛmkfbTZ\nUUW]ghgvБЦ©„у€€€€€€€€€€ф№√ФУЛЕАskcUОhxЗТЯҐ£~OГ{qШ®—ƒ‘÷ўЏЁЁЁяяааябяёаввввбггггбабяяяяЁ№№ў„„„“–ћ≈≈«“оЎ–÷Лі≠ЄЂ≤єЉ¬…Ќ–—”ЎўўЎаЎƒ©qЗwЩР——а„”∆вўуцю€ц€€€юуб„≈•ЫЙ°ђЇЈЈЈЅ”ј©љјƒ√≈«»…»«…»ЋЋЋЋЋ» »    Ќ Ћ…Ћ»Ћ«»ЋЋ »Ћ√њє≤•ЕЬЩЫҐ¶™ѓ≤≤ґЉњјЉЉЉљјјјЅЅƒƒƒЅ√√√јјљњј√љЊљЇЉЇєЉ≤ЉЃ¬њ√љґƒЅЉ≤Ѓ°†РyШ|ФРШЪЩ†£≤ѓђ§ЩКБrh_OUPNMJIDA?676989597<96:9C99898442115222556541268455757555934251012.1///13110'.././20//0///+,'),--.-...+.*+(*'*****+-++++(*.+,+)))(*)')***)*-.-++)**'''*'&''''(*('))*')''())&$&,((*)(%'&%('&''((()((''('**(')'('&%&%&())''''*)'''%&&(((((('''%'')'')))''('''%#&&&&(&(''''&'&''')+)'&($%&(&(!(''+$%#&("'')*'&&"##"#'%##'''''#! !&&&&$%#% " ""%%&'%## !#!&%#%%!!$&%#%%%%'#'&&(''()+%)(-,DWoЖ§є»”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююээээээээьььььььььььььыыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццххххххффуууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгвввббаааяяёёёЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌћћЋЋ ……»»««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛХШШТИ}vonc]\\ibhkqxxГ°Љ„жъ€€€€€€€€€€щк№Ћђ¶ЩН†~uoeТДШXcА|АЕ¬–ѕ‘–џвяЁўЁЁЁЁяяяёяббввбгбгбгбббббаяяяяёёЁяўўЎЎЁйлЎѕЋ≥љµµ≥∞µ±ЄЄљЊ√≈«Ћ–”ћЅІ|{РН•≠Џ“оёиЏвбимлсйюююю€€кюцкўќ≈ѓЃ§ЂЄ Ѕ≥єј»√≈≈«≈«≈««Ћ«»««»Ћ Ћ   ’   —ЋЋ» …»«√∆ћє≠•ППЮ°¶≠ґµјєєєњ√ƒјљЊ√јјЅЅƒƒƒƒЅ√√јЅ√ј√ЅЋјјЊљљЉЉљЇљєњЉЉљЇљјљљ≤ЅЂ≥ІІХЩНБЩЙЫЮ¶™§ЬШ∞С†xxh\fsb[WQRNKKD>@A:6:;:7:9>=:;;F68425635566744/1463<7=4333464922100,01//0/2119...0//0////0/0..)+-+.2./.-+-+4+0+-,,++*%+-++((*(++)(''()'))*)*+++-++++)''('(''&''()*'*).)3)'(/(%#%''(*((%,& &'&'''')("(((.''''')((''%%%%'')'&''7'%'0'(((('&&&''(((('''''')')'''%%''+&&(*('''''''')))((&*%&(,(($(&&((#&/%%''''&&#%# #'%""%''&$! !$&$&%#"%"" ""%%&'&&(!#!!#%%%$##"$##%%%%'&&""&''()1(.)++6=B@=ZpБЪµ≈—‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююююээээээээьььььььььььььыыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццххххххффуууууутттттссррррпппооооннммммллллккййййиззззжжееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЧЬЬТИwphb^]]o[ldijtЗЫЉў№лч€€€€€€€€€€юоя»∞ШАЛ{wk}}iВmУЭЃґЉ…–—““÷„„ўЏЏЏЏ№ёаабббббббббббааяаяяяяябяяяажрхЎј««≈ЅЊЊїїі≠±≥≥•≥ђѓ±ЂППД{ЗШЮѓ…÷÷ибиввгдибдбвкбймчбююююньрлЏ—ЌЌЉ°•®≈ЈЅ√√√√√√≈≈√≈≈≈« «»«»«ќ«««Ћ»»ƒ»≈√¬єЈѓНЮШЦЧҐ™≤ґЉЉ√єїґњ√√њњЉјј√јЅ√ЅЅЅЅЅјјњ√ј√ј∆љЊјјљљљјЊЊљљЈЉЇЇЄЄЈЄђЅ≥Љґ≤≤™ЂЩ£ХЩСЕЩ{СН£СЪЕЕtt~КЕ~xmhc^WKGCC?=A?=;8:2:2:6B99959666876612+/2226582//1233511000/51-000///6..../.....././//--+--/-.-**.,1+/+-/-*+)'++**(((')*()'(('&'')")**)**+(*'''(%&%&$&'(')')'+)/''#*%$#$$%'''($)&!###&&&%%$!&&(,''&&'(''&& &'%'(,'%&&.#$&-''((&&%&((&((((&&&&&%'''#''%%%&*$$&(''%'&'%'%''(&&'(!%'*&&%($%'&!!(+%##& ###"#" "'##""&##"#!### #"""#%! !!"!%%#&'!!! #####$"""##"#%##" ##&&*$*()+,-/++6=>BMZbЛ≠јЌ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююююээээээээььььььььььььыыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццххххххффууууууттттсссррррпппооооннммммллллккйййииззззжжееедддггвввббаааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»««∆∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєЄЈЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМНФЦЦЕ|pkfq[h[VV\_baclБЫЅџню€€€€€€€€€€€ы嬆ГПХЙsВklqwЩУЪ°±єњ Ќ——‘„Ў„„ўёёбяяябябббббааяаяббаяаабагзэх„ЈЊћ„ќЌћ «√ґЄґ≥ЮђЬЪХВww|ЙМЩ£≤»––÷№баёвжждгдЏж’ў’ЏџжпуьпююююощузЋƒїЋЈєґЈЇњ√ј√ƒј≈ƒ≈≈Ћ≈«≈»≈≈√≈∆≈«∆¬»њєґЃ•ЖБЬЫҐҐ≠µњЊњњјєєЈј√≈јљЊњјјјјЅ√Ѕ√√√Ѕ√√√√√јЅјјјЅјјјЅЅЅЊјЇЉЉЉЇЇєїђЇЈґґґЇ≤ЇѓЂ≠£§СЪ|ТКИС|ЕПЗФПФЧ†ССИВ}of_YUMGJJHD?A6=6>9=:993<777:>9612/1111/1101/1111101211262/111////...../-,++...///./-.--+-+'*1,+*++-..+**+++**(((()))*)'')'*')")**''')))('$''&%%%&',')''')'*'&!&&&$%%&&'&($&&""!"&&&%*$$&&(('$$&('&''' &'&&(,'%%%%#$%'%(''%%%&((&(((&'&&&'&'''#''''%&&$$&&''%'%%#%#%&(&%'%'''%&&'#%'%"%((###' ##""#"""%%%#"##"#"&### ""#"%%! !! "%#&#!! !!#"#'#"""#"!#"$" #"""$#")%((+%,++)),03BP\qЖЯЈ»”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггддеееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююююээээээээьььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццххххххффууууутттттсссррррппоооооннммммллллккйййииззззжеееедддггвввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§££ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМОЦЩЪСДwwmojlgbZbrnwsyЙЮЇЏф€€€€€€€€€€чкЏЋ¬іҐРАzrЩ~zzДЙК§Ѓєљ√»ћЌѕ”ЎЏа№ё№яёяяяябаяяяяббббяаггглюб–Єї“дўЎЎ„’“ѕ»∆љґ≠ЧК~{ИЗНХЩЭ£±±≈√√…÷”‘ЏбааЁаЁгажвзеёзяджипцюи€€€ющцаз÷–≈≈∆ƒє≥ЇЉ«јƒƒЋ««ƒ≈≈≈ƒƒ√√√√¬≈Ј±ЮҐЫБЦ†®ђ≤єЊ ¬¬ј√Њєљ√√…Ѕњјј¬√¬Ѕƒ√√Ѕ√√√ƒ√ƒƒƒ√√∆√√≈ƒƒƒ√√√Ѕ√Ѕ√јЅњњїљїљЉЇЇЇЄі±±≠їЂјґ©©ЫЫТЪАХ§®≠ДСРІФІ£ЯҐХФЛЕym\_]VQNLFDCB=@>:4199788C997864414-001412./132444526333310./..000...-+-...//1//./-.-/+(/3***+*+,/.,+-+*++**+*)*-,**)**.)*)*)*'))*)***('')&&&'(0''('''')'$$((('%(&'((+&%'& &'''(-%%(((('&'$'(&(()&'''''*'&%&'&&'(')'(%'((((((&(((''')')''))'''''&&&&''''%##%%%%'('&(%#((((''(%%%%'(''&&'+&&'##%###'''$$$"##($$#!$"$$""! " !""###% ! !!%'#""#"###&&#"#$$$$###+''(('(*+++.00,/3ENQXd{Щ≥ƒ—‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежззззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщщъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююююээээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммллллкййййиизззжжеееедддгввввбаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММПХШФДvkfbaUhQhOQOVX_buЗіёы€€€€€€€€€€фсжя—√≤ЬГylbUdtАИУ©ЃЉ¬ЋЌ”‘÷„ўЏ№№ё№Џаёяяяяаяббяаббдтд„≈≤Ќ„аЁяяя№ёЎ‘’ЌњЬКvaЗНХЭ°£ІІђҐ≥¶ЂѓЈїƒ∆…Ќѕ”’÷ўЏёбввадгжжЁк„Ў÷жтфшю€х€€€юкжЋє®Ѓ≥»ЈјЅЅ≈«√≈√≈√ƒ√√√√Љ≥™Щ}ЪТЬЮ™≥єЊј¬√√ƒј√ЉЉЉјƒ«јњњ√√√√ƒƒƒ√√√√√ƒƒƒƒƒƒ≈»∆≈≈√∆ƒƒƒ∆√ƒ√√√ЅјјњјјјјњњЉїЇ∞іЂ±Ѓ≤∞Ѓљ™ЈѓЂ≥ƒƒ≈¬fЗЛРХХЭЫђЯ±±∞§ТФЖ}ng^[LPMI:EB?3>;=7748778::99655121120*113222455655555///....1.0.1-/0101//////,--1,111(,++***//,+/*+.+*+.+*+..-.*--*'*))')'**,'*)*')'*(((('*''''(('((&$'(*(**)((&)((() #''')')$(),))'(('&(#'))''&'&(*('&')(())(*')'())*&))%'&(')))''))+)')))*('('''''%"#%'%('''&($#'())(''#%'''')'''))''''&%"#"%'%$$""""$#$$!##!"""& ! "$ #%%%&" !#%'""""""$#%&$!#$$$$'$#$$'&&''$&')')')()*+..+/38@RftЛІЅќ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююююээээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгвввббаааяяёёёЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌћћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТТСРРПОООННММРЦЧФОДvofgeb]nfktyqГЛҐђЁн€€€€€€€€€€€умё„ ЅЉІО}jieЧxЖО§ЂЈ√ЋЌ„ёёа№„„№ўЏ№ЁЁЁёяёяёёяаитќЃ«”ўзааяйёе’ё№в≠ДДg~ХЮђ≥ЄЇЇЈ∞ґґґ≥ґґііЄљЊљ¬≈∆…ЌўЁяЏёгзвкдрзлмпрпаЈ÷ксчю€о€€ющуб’√≠ђ§Ї»««√ƒј√√«ј≈ЉѓШcОУЯ¶≠≥їƒ¬Ћ√√√ √«ЊЇљјƒ÷јґЊј√√√«ƒƒƒƒ≈«≈«ƒ≈ƒƒƒƒƒ∆∆∆≈∆∆»∆»ƒƒƒƒƒƒƒ√ƒƒƒƒј√¬јњ√ЇЇ≤≠ђѓ™•••©ѓѓјЈ÷¬’РНХyСxСЛХЩЯҐЂЇШ≈Хђ§ҐЦИ{qhb^NTNNKJEB=:9718:9:685;564.4455320/113954141<39221125000=05071101.,-/-/06/615..,,*++2//,2+.+)'+,.*(+5.2-+*()*(''')--0*,),*+*/*)()'$((''''(+($'((+**((''')'))5&&'')-))(++7))).*((/'))('((('(**(&&&%%')).*5(().('/'((.')'&&'')))'%'%()).'-%'%%%%'.'+&$&(((&((+&&$($$((&''''''''''-''#%#%#%&##"$"#!#!!!!!#"$2"" '$#%##" ##'%+# ""### #"""%&($$$'$#&-&$&-')'''&'')-./136>=:::4766)73463768502/1120200..-0/421+122.0-0+.'0-.*.(*,.,-//-/*/',,,*+(,++*.*,-+)'$*'''-)-)*((*(''')''&*))")*('*''')$$&$$$$$$(&&#(')&()'$&$&!&&)#&''%('(((')$%()(('('(&'&'*(!(*(&&$$"#'))*')'(('$%($$$)'''%$&#&&&#%%')(''% $%'''&'#&#$$(((#(&(!####$&$#&&'#&&&#& ("%"# "#" "" !!  !$$$!!$$" $"  #!'""" "   "$(%$#!###!&##&'&&&&&'#&'''&)#+)0,/./-;;48::7)7474363445221..&+(.111.21110.0--+..0-0-../-///..,/,..,,7+*+,.:.-..+'(9*(*+(*(((*))''+0++)+*-)+)!(*)$)*''&#$$($''('')()''''&'&+#&''&&''''((('()%%)((((''*'(''()')('&&%%#&'+)'')#'($(('(%&&()))'&+&#$$&''())'%"%#&&)))''&&$&&&(&&+(&#$& #&&#&&''&&$$$$#&%'%'#$%#"!#""""# !!$$#""''$$" !! ! !"%"#" "" !!!"%('$$#$$&#%###% #&''&&#&&&#&+'*'+*++&)+3@A=XgtМІїћ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссррррпппооооннммммллллккйййииззззжеееедддггвввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПООНННМЛУШЧТДxtlg]a[\_^madjtАЦµЌЁлтюс€€€€ы€€€юн„≈≥ЧГХwurqУjФxКЭ≤ґЇњ¬ћ”÷—“”÷÷‘—„ЏЏ№Џџ„—…∆ЯСzrДФІє—Ў÷ўўўўёџџџџў÷“–Ќћ…≈ЅЇЇЇіѓ∞Ђ°ЂІ∞£µЈЊµЊ¬ѕЁшхиЃЄ„вбйзлизлилазкжллпаььээлэъчмв“ƒЃѓ•ТЃ≤јЉљјјЅ√√≈ƒ√√јњљіњƒ…њњїњЅЅ√ƒƒ≈ƒ«≈≈ƒ≈ƒ≈ƒƒ∆  »√ƒ∆«ƒ∆∆ƒ∆ƒ∆∆ƒ∆∆≈ƒ≈ƒƒ√ƒ√¬¬њµ≥†®ЬЧ§§®ЃѓґЇїїїїЈє≤≤≤≠®§Ґ†ЬЩШТРСЙНАxЙ{САНЛХФ©І£ІЦ£ШФД|oga[VLIDB<<>>:1776667077764510,.*.01..1...0110..0/1/20000110/././..//.5,+,,.6..-.-),4(,)+(+*((+*,++/0,,+.-/.-)$(**(*-*((&$((''(++))(('%&'&''(%'('''''*(*()(')(')((('(())+(((())&&(('(&'')''''(()')))($(((((('')'&&&')')*)&&'&&'*''''''((('&&&&*((&('""&'&''''&&&$%%&&%'''$&&&$#$#!%%%##!#$#&#"""%"'%%" ""$! !# """# %###""" #$$'($!&$$!&%%%$###%%'''&&''$##*''%''**(+(*..*598AJS]yЭµ»”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввгдддееежжзззиийййкклллммммннооооппррррссттттуууууффхххххцццчччччшшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффуууууттттсссррррппоооооннммммллллкййййиизззжжеееедддгввввбаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФФУТТСРРРПООНННМЛУШУЕ{ooge]fWURUY]gluБУЄ…ёх€€ь€€€€€€ў€чб»≤°П~ЩhЗhms|УДТ°ѓЄ≈¬ Ќ”„ЏЏў„№а№Ё’ќµЛ{orМЭ≠љћёяЏЁЏ№№яЁяЁё№№ЏяЏЎ””ѕ—»∆ЅјЊї©≥Ђ∞°∞±∞Ђ±іЊ—поя®Є–ўадзйллммилиоаеЏёЁзлпузэ€€€€€йрјЉ•≥≥≥ЈЈЅЉјјјћ«√ЅЋњЉ≥ј≈ћјїїњЅ≈√ƒƒ≈≈≈≈«≈≈ƒƒƒƒ∆ Ћ √∆∆Ћƒ∆∆∆∆»»»ƒ∆∆Ћ≈≈ƒƒ√ƒ¬√ї≤ђЮЫ¶°°ђґѓЈЈЉїЉњњЉїЉїїїµґѓ≤ђЂ©•ҐЮЪЩЦСГО|Мx{Й{РСЫШІЩ±±≠£ЦЦБД|tf`YWNIIEGBA?;=;>37777674361..21..+00.01100.2/4/41000111//511////./,,-1/1//.1-.-.).++)++/(+)0++./,,+/.2.-*((*+++.*(('$((+()-0))((&%&+'''''((*)1')+++-()())((((&','))+)((').&')))*(-')''''(()+)%((%(((''''''''(''*(,(&$&'&''*''''''((''(&'%)(('''#"&'''''&&&&$#%&$%('%$$&+$$$$!('####&&&&#"""" "%%%"& ""& " """##"##&%#&""" ##&''&!#&'!&#%%%$##%%(''$$&&$##'&& &&'(('&&&&'))%*05>88673321200125/4.--*+---+++--.+-..---1*'.5++-.-..0.,.2...0,,-/,-,%*++*+/+,,//3++,..+*+*+.6(((,+)*0&*(+*(**(*)*(*('('',)*'))',2,.*((*+++-**)***(((*(*(((,*('($'(*('%%''')'.'''"')++)++2'().))''%'(-&"&-'((.'(('''# "$(*''&%&-&&$###$&$&$''#%&$$$!!!$$##"##$*$&#$&%%&##&&-))''$&$$#&# #$&$####$$###$&$&+%%&''%####%#%-''&'#'#*''%&'+!!(&&''#&&'#%'&')''#'(*'(*+*-25APW`iВҐЈ…”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооопрррррссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххффууууууттттсссррррппоооооннммммлллккййййиизззжжеееддддгвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛУЪЫМЕwk_ZVTOQQcY]ahj{Й•ЄЏм€€€€€€€€€€юцủХСБk~mlЛiУwЖС™ґєЉ¬√∆»Ќѕ÷”‘‘÷„„ў№ЎЏЏЁЎЎЎЏЏ№№ё№аЏёЁгжчющЇ√ “÷№Ў„““ѕЋ ƒњЇ≥≠†ЫЙШЩУХЬЩ™™¬∆ћћќ”’ЏЏЏяўб№я№№ўЎЎ“÷÷’ёЋгѕйЁяЎќ№ √ґЉґ©ґЭґ™ЈґЉЇјЉјј√√ƒƒƒЅƒ√√√ƒƒ»√¬їјЈЃЩЮЮЫ°ЂЃµЇ¬¬јњЉЉљј«јњљјЉ¬√√√√¬√√√√√√√√√јЅњЅјЅњƒњњЉњЉњЉЉЉїЇЇЇЇЈґ≤≠≠ђЂІ¶£ЮЩЬХФАЛЗГЗpРjРЦЯҐАtФЬПФПЗ|thgaXOIE;=<=:777640214-2/-,++,/-+**+++*)+.-,+.+).2+.+-+--.+..0..+0..//--.',**)(/((),*1()+-**(***.2++'+('(/'*(+((('')'*'((('''+()')''*.),))(+*+**))()(((**+*+((#*'%$'"%''%'&%#''''+%'%#&(%))))0('&.(*''%%'*&"&)"&&)'''&#&# #&&(&&#$")$&&###&$&$###" #"""$!!"""" """(&&#"&#%##!##)%'%%%%&#!$ ""##!!####"!#!$&&*&%#'%%#%#%#!#(%&#&!#!(&&##&( !#####!""#"#&('(&&###&&&'**(**.213467I\vЫ≤¬—‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттссрррррппооооннммммллллккййййиизззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЯЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРППООНННМЛФШЦЗxljaWS]NKIHDGQXbqГЪЈ л€€€€€€€€€Џщ‘≥©™£Н{ПkСedenЦИ†Щ£∞ієЅЌѕЌ“÷‘”‘Џ„Џ÷ў÷Ў÷Ў„№№№№№№ЁЁжжээз≥њќаўџџёЎџ÷÷— ≈Ћђ®П~{ФЫ°°¶Ґ≠∞іґґљјƒ≈ ћќ––””÷÷÷÷÷÷’’џ’џЋ№“яўяё б№“ѕ≈ЌЉЅ§їЂ≠Ђ≠Ѓ≤ЇЉљЅјЅЅЅјЅЅƒƒƒ√ƒњј≤ђ§ТП§ҐЂЂ±ґЊЊ¬√√њЉЉњј≈√њњ¬њј¬√√√¬√¬¬¬ј√√√√јЅЅ√√√ЅƒЅЅњњњњњ√њјїїљЅњЉїґґ≥≤∞≠ђ™§©ҐЯЯСОЗРpЗeН°њї£~zШРҐ†Я£ЙХББ{maZNOLHGA@@<;5652/21(.+,,..+)(*.++)).-+*-,,./+.-.+--.,2.../.02//0--.,,*)**1*,+++,**,+(*****+++.(((*(+(,(!((((''')(('((''(')'*'').')')*/*+)().''(*(**+*.*(#'%$&'#'''%'''%'''%''''(&'&.)$')('#)()%%%%''$ $*"$$%%%%#"###$&&&#"#$"!"&&#!#&$&$#""#"$"""$"&!!""" ""&&&# "%#%##!!!##%%%%%'" # ""#""!#!$#####&!#&&&'&&%%%%#&%'%#!##%##!!!(&&&$&& !!!$!! #"""#&('(%&$'#####''('&$&!$"!!,6?<;3533,001/11110......*+/..//...0.../1//12///1-.--+..,'.12+11.,,///...*,.,./+/+++.,++*((*+*++,,++((+(((()..-))'''+**((&((*(+(.'(((#++*''%--***'*))&(*(&(('&**'&'',))***(&'&&&'#'(''"%('''%'''%&'&'&((&&'%&&&&&'%##&&(*)''&&%'%"$$&$$&%#" " "" # #%%#&&# %#'##%%%$"##'''#&#&&&!%((&''&&&'(''*'##&'('''!#'''%&$!$&'(&((##$!! %$!#"#&##!#%"$ ##%%#!''''''''#'**+**))*.'*-:DNUczЫі≈“‘‘’’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшччччччцццххххххфффууууутттттссррррппоооооннммммллллкййййииззззжеееедддггвввбааааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦХХФФУТТСРРРПООНННМЛЧҐІ¶°ФeNW_VNbO[\ddzЙФТІґЋй€€€€€€к€€эрб„Ќј≥®ЫП|wpФUrСЭ§≤Љ¬¬”бЏ‘”„„——”‘‘„ЁвшўЋ≈—÷ёЏЁЁгяз„дЏќЃИЧН§∞Љў№я—Ў“Ў‘ѕ«ƒ√љЉЉЇЈґ≠≥іЈЈіґЈЉјЅ≈ЋќЌѕ„ёдф€иџƒ““и÷Ё÷ЎЎ„÷—÷я÷о—мзб…ЊґђЈ†Ї≤љЉЇґіzЧ°°™∞јЉ∆√Ћ≈∆∆ћ∆ƒј√Љ√√—√Їј√ƒ»√»∆ ∆ »Ћ∆»»»ƒ«««≈«ƒƒ≈ ≈«≈ƒƒƒƒЅЅƒƒƒƒƒƒƒЅјјјњїґµ≤≤±њ©§°°§ІІђ≠∞≠∞µЄ£ЬСМЗЕtTАlГU}ЛОЩ†§Р≤Н∞ЫМСХ|ofXXUOKGC@;9;66301111.,./,/,,..---.+*..../7../1//./..-.-.//,./9/6/1././.-.1..,*,..9...<.,++*$***++,,/,(*,**(*+6..,+''),*()+((***9.2+((('(**((*@-*(+)/)*(*(*(((''(*''((0+***('''&#&.'*'''&&'''%'(''')')'&&$(4'%#'''%#%''''.)''$'%''#"%%%%%)%#"!!$%#'&&&%&&&(&(&1%$""#""##)&&&*!#$%$'(.(&'#!!$%#%''$!#$&'''##%%%&$ $&$ $'#$$$ !($!##%## !$$"" #!#&+&#&&&'&&6**(*(('*+..2322*6@WcqУ±Ѕ–‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббвввгдддееежжзззиййййкллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххффууууууттттсссррррппоооооннммммлллккййййиизззжжеееедддгввввбаааяяёёёЁЁ№№џџџЏЏўўўЎ„„„÷’’’‘‘‘”““——––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§££ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛЯЂҐХПБi`WNCFI[DD?;9FQZaxИ°≤Џды€€€щ€€€ючяЋЇЯЧЛsig_ЙWbmДЪ™Ѓ≤ЄЊЅ≈« ћѕ—‘÷Ў—ќЌ”„ў÷ўўў„’ќƒ¶ФxФЫІ≥ЊЌ’Ў№÷ў„Ў÷’“—ѕЋ«≈≈јЉЈЃі±±¶ЃЮ≠ЯІђЂђіЄљЅ№цфᄧ»Ќ÷”ЎЎўџ„Ў’’Ў…№∆ў”—ќ… ≈јїЊЊЅЅїїЈЂЫ†ЩЂґЇљј√∆√√√∆ј√ЉЉµљј«љЉЉјј√√ƒƒ∆√ƒ√∆љƒƒ∆√ƒ√≈ƒ≈≈«≈«ƒ≈ƒƒƒƒЅЅЅЅјЅјƒјЅјјљљєєґµ±≠ђ™Ф£Ъ••Ђђ∞≠∞ѓ∞ѓѓ®§†ЬШХРЖЙА{qn}UГlЛwЙЖСЦС£ФЮЩЧЗxnf]OLGA470:93,1./.,,&./,..,***''*-*-,-**-...+--**-+/.,(--0%.,.+-//././..**')).**'.*,,,*(++(*(,++,+(*++*+++*-++&)*((((((+*-*.++('&(%'&(('%-(''(''&''&&'&'&&&&(('''+(((('&!&&&"('('((&'&#$'%%'(*)'()#&$$&(##%#%#''''% ' '''''''##%%%# %#" "##%%#&&''&%%"%%&"&$$!"#  &""#$!$""$'(&''! !!!!!#!!&#$##%!####$$! #$ $$"$"" # $''''$  " ! !# !####!!!'#&###%#''(!(*(*(+*-.+..A\Б°ґ»”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРППООННММНЦЩЪРГwrebUMNNORWX]Ublu{Шђ…ўмн€€€€€€к€фё…µ•ЦМТ}}sqПiyАЛУ§єїє∆ћѕ—“”ЋЌѕЁ÷÷”ў’ў„„ЉЯЩКЬ™Єƒ–„ЏўЏ№№ЏўЎ„„Ў÷”“—ќЌ…«ЅЅљЉііђѓђ©ѓђѓ≥ґЇљћшыџ–Ѓњ«“——÷Ў‘’÷Ё’я“№“÷—ЌЌ …ƒЅЅћ÷≈д бгж≥СЬ®±±ґґЉ∆√√њ∆јƒЉЉєЉ√”ј≥љјЅ√√ƒƒƒƒƒ∆∆√»∆∆ƒ√ƒ√ƒ≈«≈≈ƒ≈«ƒƒƒƒƒƒƒƒЅƒЅ ЅЅЅЅјјїєґґ≠£І††©®ђ≠±∞ЇµµіЄ≥µ±∞≠™Ђ•Ґ†ЫЦРЛЖЖyЛАЛВiАaЖАНЛЩІІЯЖСТР|tiaWULNKD<7::2853/02/0/-,+0+*-.+,,&**+.-.-++(,2-0..-../(.,..//000////-+*+*++*,/,,,*((,8***,,*.2**,,.4*'-*-+-*(((())2.,+,*++*'+'((***'+(((+((('' '('(('''*0( (*(((('',(+((''((*(($$&'%'(*4*#'2((&&(&$%"'%%%*'-''#'#'''(''%#%&&#"#&%#"#%%%%%'''&%%&#"&*%%%(""#" &""$$ ## "$&%'&&#!##%!!$*&&'&# %7%##%%#$$###.##")$"$!"$#&&&&'%! !!!!!+ ! !####!!!#&##%#%%&!%%&'(&'((++.20CVd{Ш≤¬“‘‘’’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННМЛРЪ†ҐЦИzsmf\VXVMJ\LYV[`jwЛЬљ—лш€л€€юхўмдЁ—…≤°МНkiijhm{}КЩ§ђЄЊƒ¬∆ ‘—““„’ЋЅЃ~УФУ†Ѓ¬«ѕ÷№№Џ№№ёё№№Џў№ЏЏЎў÷÷÷“–ЌЋ«≈ЅњЉїґґіѓіЂЈѓЋсх‘…§µї¬ƒƒ≈Ћ Ќѕ÷‘џ’ў÷÷’ѕ“…ЋљШ¶ѓƒЊЁ—бжзЌ≠∞Ѓђ≠Щ≠Ы©ѓґґЉЉњїєєїј—ƒЇљЊј√ƒ≈√≈≈≈≈≈≈»ƒ∆»≈≈≈ƒƒ≈≈ƒ≈≈≈≈ƒƒ≈ƒƒƒƒЅƒƒ ƒƒƒƒјљєґѓЃІ§••Ђ≠≠≤іЈґЊЇїЇїєїЄєґµµ±ѓЃѓ©§ЯЬЩЩЩШФР{ЖlwvtАm}БКЖСХЧХМШГМДztm_XMIKBC@<7763030/+2/.0.*,-'*+,-%++***.0.10.1...*+...2/000/////--.....//--,+&(,3(+*-*,,1-,...2-"'))++++*(**,+/++++*+++(*((++(*(+*)+,)+**(%())*,***+0,&*+((&((!(,(+)(((((+((&&((((**1'%'0(("'((''&'('#)'*&&$&$&%&%#%#"#%%#"%%#%%&&#"#&&&'&$$% %*)"%%&"$$####&"#'''&&"#&$&'%%#!%'((&(*''&'%!%1%""##%#%%#"*##$&""$!"$%('$$"%'###"###%(!#! !!!!$$###&'(!#'#%%% #%%%%#&***'#-5=A?JT_Ж§їЌ‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббвввгдддееежжзззиййййкллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦХХФФУТТССРРПООНННМЛТЩЬЪПznjd\S\IUHGDHNNN]mДЧђЅ‘йииЁъю€юып«Ў¬≥ЦЖ}tkefluvНИ°°Ѓіљ¬Ћ–“ўћ±ЯtjФШ¶∞∆–÷”÷ЏЏЏЏ№Џ№ё№№ўЁ№Џ№№№ЏЏ„÷””“–ќ «≈ƒЅƒЇЉ≤јЈ—лнѕњЯѓ∞≥ґґґљњЅ≈∆ћ––—“—’ў÷«ƒ≤ЗПЯѓЇ…–“÷“‘ ¬ї±∞Ы≠ХЭІ°≠©±≠≤≤≤ґ√“≈ЇЇЉљЅ√ƒ√«≈≈≈≈ƒ∆√≈«≈ƒ»ƒ«ƒ≈ƒ≈≈≈≈ƒƒ«≈ƒƒƒƒ≈≈∆ƒƒƒ»јЇґ≠ЂЂ•®©≥ѓѓ≤ЄЈЄЇїЉјЊЊїЊЉњљїєїєїїµ±∞ЃЂЂ©І£ЬШФНДДxАjnooБxЛКРМЯПЬЩТЭЕНБtgcXUOKGD>;787606221,+-.*+...%*,**,-.-,-,120.**...20710/4///2-.....//----(,,.*3,.+1---2....--'''-*'+2***3+**++**++.,+*)++(+),(*,,)++,+*)))*,,+,,.,*(+(/'*(,+(((((((((*(((((**(**-'''.('"(((''&')-%''*&&&,$&$$%#%%"##%##%##&&&&"#&&%&&$$(#%,'#&%("#$#$(%&"#$&'&'&$&&*'#%%!&&(((("''&*'&%(#""$#%#%##"#"$'#""'"#$%(($$"%'%%##$#%%#%#! '! ##$$&&'('#*%%&&# $"$$$"#!&&''%'*-*'*28DL]iЕ°Є«”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооппррррсссттттуууууффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшччччччцццххххххфффууууутттттссррррпппооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛФЪЭ†УКxmaaZTTXNMNW^[_jqyГО®√ялшы€№€ьшиƒЋ¬≥°ТД~pКjМ~ЙЬРЫЂЄ≈≈ҐОГhАХ£∞ї”ќб””„„„ЏўўўЏўЏўёўўўЏўў„ў„÷‘‘’“”–ќќ–“Ћ«…ћ“ЎтрЌЈ®ѓѓ≠©Ѓђ≥∞ґііЉЅ≈ƒ∆ƒћ’«Є™™ФФѓЈЊ∆ќѕ“ѕѕЋ∆√їЉґі∞ѓ≠Ч™Э§°†І†ІЈћЊ≥≥ЈЈљљЅЅƒ√ƒ√√ƒƒƒƒƒ≈Ѕ»ƒ»≈≈ƒ≈ƒ≈≈≈≈»ƒƒƒƒƒƒƒƒ√ƒњ∆Јѓђ•®®©ђѓљґµ≤їЄЇЇЉїƒљљЉњЉњЉљЇЉєїїїїїєґ≤≥±ЃЂІ•°†ЪХСРКИsДmЕ|{Г}Ж}РБ¶Й§ЬРМxtg_WPIE@;=;:6630///,//.3.,/,,....++(&1,,***++/.:1..8.0.3.....0...-..,/...80.,5-++5....-.&'*.*'*6***6)'++**+../,,,,..+++,+(*+(+,,+,++**,,+,*,(('((4(*(.((&((''***''(***(('((-('*0))''&&&(&('/(''.&&&-$&"$&$&&%%%%###&#$$%$ ##%&&&$$+#%''''%+#"$$#)&'#"#"##$'&''-) %'!$$$$&&&(&,''&*#"#%&'%# #"#"#(#!#'%$%&$%!##''%##%&%'%"$($ !'  &&$!$#$#&#*$&&("$&"$$""!#''%#%'''*--.004T>?>KU]dВЩ≠Љ’и€€€€€€€шж љі®ЬЛ~К^b_Ц}ЙЧҐѓЄ√њ≈∆ћќ–––””‘‘÷‘÷‘‘‘„‘‘Ў÷„„ў÷„„‘„÷ўўЁиыэяґ»ЋЋќЋ «ƒјЉєєµЃЂ§ЭЧЧОЪЭЫ°§§™ЃЈЈЉј√¬««ЋЋЌ…ћЋћЋ«∆ƒ»ƒЉїґ≥≥≤ѓђ™•§ЩО°И°КУ†©ђ±µЈЈЇЉљљљјƒ√√√ЅЅЅЅ≈ЅЅЅјњњ√јґ∞Яђ¶®ђђѓ≥≤ґґїњј∆√µЉЉљљЉЉјЅ√јƒƒЅЅјњ√њЅЅЅњЅјјњњњњЉњњЊЉјЉЉЇЇґґ±±ЃЂ©І§°ЭЮЬСРЗДxgД`Жj|АСМСЦ°≥ЕГНС}pg_XVH5>B?;763,/*00000,-/,,..((*(++++.--.1/111/12//1.../,....0-////1110000..//..+../.,//,.*).,+.00.11/+-.//./-**,++-,..,,/,**/++,,*)(&&((**-*)!&&**-++'((+*--,))(**((+((*'+.,,(%()&''%'&%'#$$$###%&&'()')%&&%%%%%%%&%##&'%&(()%'&&%&&&#&&&''&#%#%#&%''(**(*''%#% $$'(&(('&'&)-'&&$&())(((&(''''((+(('#"$$ %%%%((($%'%"#$$#%'%%#!%%'##!#!$&&&$%&&%##%#!#%%#%''''##!%%'($)),//2898L^sФ≠¬“‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛХЯ§§ШРЖxl^[UOSONLJRRRR`p~ЛҐЇ’т€€€€€€€эчн–ѓ°СМОНЫРВФzЭПҐ™Ѓ±Є¬≈∆Ќ“‘„‘‘–÷”””‘‘‘‘‘‘÷÷÷÷÷‘„„ЏЏёйюхЁ¬ћќќ–ѕѕѕ »∆’¬ƒ∞їТЦЧСЩҐ•≠®•§І≠ђѓ∞≥ґЄљљЊЅ≈¬»ЌЌЋ∆∆ћ…—√Ћ√…√∆»ЌљґЃђ®™ҐІЫХ†У§Ы©©≠§≤јјљњЉ√√љјјƒЅƒЅјјЅїњґ∞≠Ъ§®™ѓ∞іЈ√ЇЇЇЉјƒ∆«їЉЇЉЉЉљ≈Ѕ√ЅƒЅЅЅЅ√≈Ѕ√√√√√Ѕ√ЅЅЅЅњЅјјј«њњљњљЉєЇґґ≤≤ЃЃ™™©®§ЬЫШИМЙ{kЕsСХЩЊ•ЛЛЬР¶Е°УЕuh]]YUL:CH<97:64441/0----++2+.**+*)#+3...-./111>;4033-(.2(**/+(()))('****-..6)/-/..+,,.-...-,)(-.-.---.//./..*.+/-.-/,.,0.../.1..-+****,-,1*++.,0(,,/)-0/++,/)(*(')))'())()+)(((,(&)))))('(''''''%%()!+("%&''&&%&#)"%%(''&'&$%&&'&&''&'&'$&%&%"%#"#%$&&# $$'&"''$'$(!!!! # &''''&&$&&( '+%''''%%%#%$$$%%'&(')&'&(&&&&"$&'''')&&(&&&&&%%&*&#"#""%#"%%%#" "$%%% %&$!#%%### !! #"""%%'%'%%#%$%''%##%$$&%*'&*,+09IYU|ФЂЅ“‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссррррпппооооннммммллллккййййиззззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННМЛСЭҐ•ІЧРД{rgaZSNJXQOX^jlxy|Щ®Є≈“„ёљ“ЈЇ∞•®†††ЭЭЦОЩОЫМФЯЩ£Ґ®Ѓєљ¬∆∆…………ћѕѕ–—””÷Џвќљ…Ћћ–——ѕѕЋћ≈њЪЧЪЗШ•≥ј≈√√≈ƒ√¬њЊЉєЈґ≥∞©Ѓ≠Ђ¶©™™™ђѓђ∞іЄЄЅњ≈≈ѕз€оЋ≠љЉ»ј јљЉјЈґґЈ≤≠≠Ѓ≠ђ™®®Ъ©©™≠≠ЈЃњ±©ЭТЯ•ђ≤≥ґњЉЉљљЉЉЇЇЉј≈љЈЇЇЉЇљЊЅј≈Ѕ√Ѕ√√√√Ѕ¬√√√√ј√√ј√√√√ƒЅ√√ЅЅ√Ѕњј√њЅјјљЉЇЇєїњїЇїЃ®•°•®•ІІ©©Ђ™§ЯШСА~zН~Й|А}ЯЬ£ЗЮЕШШРМx}uj_ZTKE?;;;7(3:/..6/.-)))*&(()'(*+8*/-../-,+...00/-)&./.00.-./102..-0.0.../.../-.20.2222..-----,3.--///,,-0,--0.++1**,*+--+'(**()+)('*.($*)++**)*(((((('#'((.)!'&&&&'&'&-&%''&'%''&&''&%&&''''*&'%%'%'%##''%&$#"$'(( '(&&#(#!$$$#%#&'''%&'''&.%'.&&&''"%"!&%%&''&''(+(&&(&&&'&%'''+**'&&%%%&%%&&+(%"""!"""%'%##$%&'%'''&& !#%%!#! ! "$"""##)##!#!####%#"$&%%!#%&&"*,.,369.CJN^fО®љѕ‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббввггдддееежжзззиййййкллллмммннооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууууттттсссррррпппооооннммммллллккййййиззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦХХФФУТТССРРПОООННМЛХ§™™©ЫИwofaTQJZWZBFDD=ISdl}ТЮ≠ѓЈґєЂєЃЃѓ≠Ѓ¶ЂҐ§°ЬОЪ~ХЕИКЦЮІ≠±µєЇЊ√∆……ћћћќ––« Ћћќ–ѕ—ѕЋ…Ј≠СnЧШҐ®Јњ∆—ЋћЌЌ  …«≈¬¬¬њїЈі∞∞Ѓ™≠™™®©£І™∞І≥ЄљЈ…нюеЉЫЉљ¬ј√ƒƒ√√√√ј√їїєЄЈ≥≤∞ѓ≠≠™§≠°±°≥ЃІСЩТЬ•ЃµЇЊљљЅљљЉљЇЇљƒћЅ≥ЇєЇљЊЊјјјјЅЅ√ј√√√¬√¬√¬¬√√Ѕ√ƒ√√√√√ƒ√ј√√√ј≈њƒј√њњЇљЉЉњЉє≤ђђ•™≠≤Ѓіііµґµ±≠™§°ЭЩШТНЙuЖbЖ\oАМПЛЧП©СІЮУЗrm\TQNGGD@9>28263611/+..++(''''*$.+-/--*+,0..///,--./201-.1..0.0-..0.11111..-.41*233360..--**.0...--+,,-,,,-,++-*.-.+.++)****)++)*,.*.*++,))'.**(****((''*.(((%%$'&'&'%&&'%&%&&&'''&"%$''))(%&%()''#'%'%$'&$$$$()())$$#$!$''(&#$%)'''''(((#(''((&&%'%%%"&&'''*''''((((&%'&''''''**'&%&%$&&&&&(+(%""!!!! #&#"$#%&&#%''%%"##%%#!! "$""'"#!#!  ""#$""%## #$&%%)+)')('))-)35=D_mЗ§ЇЋ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттсссррррппоооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»««∆∆≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛЪ©∞ЃІЮПzk_a\][ZXZJ\NG=8>3+02//.++((-)-+-,++,(),-.+./.7.-.111....0200.-/6.1...1.--.00.2122E2...+**..0...+(),2,++++*+.-20;..--+++.**+,,+-2/@,)),**,=,))**,(**&'***(.(''''''''&&('''&&%%&''%'&&'('.((&/&'%##%#%'''&'&'(()-%'&'&''''#&$'5'%'%'.(+'/((((%%%'&#%'&''.'''*'*(*((&&&&((&&'''.'&&%%%,%%$%&/&%%&%"%%%&%%$%%'%##'%%%%"%%###!! $0"$5%'%#! !#$&$$!#$""&%%#%&&&'6'%%!##(0+'28:5>EQ]kАЮґ≈”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФУУТТСРРРПООНННМНЭ™≤ЃІЫРГve\SQONFD@T479EOOK_mБТЭЯЃЄƒ«љ≤І°ЬЪЧФУСЛЖТyПuФ~МПЫЯђ∞ЈїЊЊ¬ƒ»»ƒњЇѓЦn{У°≠≥њ√…Ћћ…ЋћћЌЌћћ Ћ   Ћ…«∆∆≈ƒ√јїєЈµ∞ѓ∞ѓІЃШЂЧƒиюєІЬ∞ђ∞ѓііііііЇЇјїљљљЅњ√Љљґѓ≠ФЂѓЈїљј гє•†|Ъ}МХ°ђЃ≤≤іі≥≥ґЉЉЉђЈЈЉЉЉЇЉЉЉЉљЉЉЉјњњјј¬√√√√√Ѕ√ЅЅњњ√√Њ√√√њ√јƒњ√√√√љїґ≥≤ѓі°ђ≠ѓЃ≤µїєЉЉњЊњЊЊњЉїЈЈґіі±ЃЂІ¶£ЬЩФРНЖzАbБfБtКДНРПХГЦРПГ{hWUKGA>:83666+3+.0.)-$-*))(((&((,,+.+'-.-'-+.'////0..+++0+-..(.--+-..*.,.+5..0-'*+../...+'(),)+),++*+*.*-'++**+*,++--)*+/-.))')')+.))')''''*''*((&(''''''''''''&(('&%"%%%"&"%&''(&&#&####''%&&''$$"$&&'(&'&&&&#((&(&&'%'%%"'$&&(&&&%!%%%%#%#&&(!%''#'''&&$%%&(&#%%%"'&''"%%"%! "&#%%%%&&&(%""!%&%#""%"%%"""#"!!!! #"'!#%#!!#%%&$"! "!!"!%$&&&&"%'"!## #%&&**))(*..)45FUoР©љќ‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээюююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооооннммммллллккйййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљЉЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУТТТСРРППООННММСЮ™Ѓѓ°ЪЙБsg^XTYMJF@PENOXaccs~НХЮ¶ђ≥ЃҐЃ∞ЧЮЫЂЮЭТЪНЦНРПЗХСЩЯІЂ≥іЄЅƒ∆ї™Шq}Р©ђґњќ«—ЋЋћ“ЌЌЌЌЌћЋ ЋћЋЋЋЋ……»«∆Ћƒ¬ј√ЉїЇііЄ≥ЈїЋЏшљЯІђ™™™ЃЂЂЂЃЃѓ≥ґЈЈЈєїєЉљјњЂЩЬІЃ≥ґЇј√ЌњЃЂЩ†СРХЙЮЦ°§®™ђЃґƒ√ЅѓЈґЈЇЉЉљЉјјЉЉЉњ√јњ¬¬√√√ЅЅЅЅЅЅ√јј√√¬√ƒƒј√√јј√ЅјњЉЈ≤ѓ•Ѓ≥≠≥ґґґєїљњјј√њјјЅјЅјњљїЉЉЉљЇєґ≤±Ѓ©£ЯЬФСЕЛБИАyДkИДИ~МЮМ§ДЦИ|rl_YWTPKF<<>705522-0.--*)(('((++-(((-+'.+.*...180(...5.4./+.....09+'.0-5.).-**+...--.+(*,-+++2--+-+-+++1-*+-+/-,.-))+0*)**(**++'*)*/))'#)')**.'(()''')))'''''((''&%%%%"&%%'('5'%#&!%%%%''&'&'&&$&&&&&&.& $#%)(&''''&+'%%%$&&&''(%"%%%%"&'&&'(%%&&&'')'&"$%&(%%%%$$%''%&+&&%% "%&%&%%%((%&%%"#%%%"#'##%" """##$! "##%!!#%! #%#%$"""" "$"%%&&)%"% #(!!#%'('('$&)-*007?GHL]gАҐїЋ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооонннммммлллккййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”““——––ѕќќќЌЌћћЋЋ ……»»««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљЉїїЇєєЄЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММУ°≠≥≤®ЮПЖ~tg[OTNUOJUFO?[JNOctААВТЫТЮ•ґґ•љ®ЊЂЯЫЧМУККЛЛ†И§Т©≤ѓЪШnuКРЮ≠ґљ√Ћ«ќ ……ѕћћћћћћћЋћЋЋћЋћ»Ћ…Ћ ќ…»∆…ƒ≈ƒјј¬≈∆ЋащлЄІѓЃ™™Э©°І¶©£¶™Ѓ™Ѓѓ≥≥ґ≥≥≤ѓЫЩҐІЂ±µЈЊњњњґ≥Ѓ™•ЭЮСЫУСЧКЫО†Э≥ґ≥°ѓ≥≥їЇїЉЉљљљЅЉЉЅњњјЅј¬њЅЅњЉњњЅј√√√√√√ƒ√ƒƒƒ√√√њїіЃѓѓ™≤ґЈїЉЉЉљњЅЅ√√√√≈њ√√ƒƒƒјјњјјƒЅњњЉїєµ≤±≠®§ҐЯЬШФЙНyЙАp~oМvПГХСМУЕХЕ~|ug^PONF=8=87663//.+*$(((*)*,+)(((-(+(+--06/+.//3.2-1.01..0.6+*.0*3.+...++..+'++-*,,++-/1-.-..-++..-+++,..//.)))-&&)*())++'+**.,**'))')'*''''&'')(*'*(((*&''(&%$$ ''&')(.'%%'%''%%'*''#''''&'$$'&$+&!$%&(('()'''*'%%&#%%%((((&&%&$%&'('''''#"#&&(&'#"%&'&&&&%%"')(%')&)''%%&'&'%%#&'&&&(&&%%%% %'#%&#"##%%%%$"""#%## !!#"""#"###%##"&%$$$%%&$ ""%(%%%"&((''&'&'++--/1414999DU^nЩѓ¬”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввггдддееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщъъъъыыыыыыыыьььььььььььээээээюююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦХХФФУТТССРРПОООННМЛЧ¶ѓµґ®ЧЙДurj\OWJS>P<=9BNOV\douБУЯЂ£ј∞ћЊ±Ђ§ҐШЫЪЫТ°З§РЪҐЪЙПnЖСЦЮѓїњ√ƒ≈…ƒЋ« »   ЋћћѕЋЋЋЋћћ…Ћ…Ћ ћЋЋЋ…»…»«∆»Ћ“—ыюа≥™≥≥ЃЃҐЂ°¶І¶°£•®°¶®ђЂѓ™§§ЮЧ†°¶™Ѓ≤Їїƒњ¬єїґ≤ѓЃ©•°ЭХЩИХЖЪРЪ§ХЧЩ§™≤≤ґЈЄЉЉЅЅљЉЅљњЅЅњ√њЅЅ√Љњњ√њƒ√ƒƒƒƒ»√ƒƒƒ√јљє≤∞™ђѓ≤ґљљЅјЅјЅј√√ƒ√√ƒ њƒ√∆ƒ∆√√Ѕ√√∆ƒ√Ѕƒ¬јЉЊїґ±є∞Ѓ≠™•§°ЯШП{ИuИvwДЛЗХМЯЦННИКvВsh[SJJEAAA<9651/*,,,,.,..++**'''((,,.-,,+,./.4.22320...0.20.*0.2.1..+...&++.,,,)-///.1....,,.-.2++,....3*)*)')))()*.+,.+*,,,,.*''*''&)&'%&'))*(1(*(,%'((&%$%#*'''''('''*'%'%%').'''&''&+$#&&$&&&%%&((((.'''''%%&$'%()(()(&%*%&&'((''''"""&&,'(&&&''&''&%%(((&%''&'''%%&'&'%&"%&+''((&%%%%%%&%%&'#%%%%#%%$###%'#""*"""" ##%%%##%#$)$$$&!!!"!%&&(')',(''&'''((*'(*/*+**(.189FR\rТЃњѕ‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббввггдддееежззззиййййкллллмммннооооппррррссттттуууууффххххххццччччччшшшщщщщщщщъъъыыыыыыыыыььььььььььэээээээююююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№џџџЏЏўўўЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПОООННМЛЧҐЃЈґ™ЮИ{sskb]XUQHLGLGIOI[Xfp{ГУ†™І™І¶Э≠µЉїѓЇ≤Єђѓ®§ЪУСИХТ®ѓЈµґЉЅЊ≈¬≈ƒ««…» »ѕ»»»…»Ћ»Ћ«Ћ« …Ћ……«…………ЋЋ”÷ююўґђєєі≥≥±ЂЂЂЂ¶¶••††°§•®ЭЩ†ЮЮ†Ю§®™Ѓґ≥√їјєњЈїЈє≥≤≤ђ™•°††††ЩЮИЧЙФЪХ°§¶¶∞ЈЉЇЈЇњЉїљњљ√љњљƒњЅјјњЅјјј√√«√Њјњєґ∞ѓЃђ≠Ђ∞іЉ√√≈љЅјЅЅ√ƒ≈ƒ√≈ѕ≈ƒЅ ««≈∆ƒƒ√ƒ√ƒ√ƒ√ƒ√¬¬ЊЉ≈ЇїЇЈ≥≤≥≥Ђ¶ҐЮЪФП~КxЙАД}НБЙАЧВ†ФЖ{qib\RPOKED?<9535325.1,,,+*)*))')))(())),,.3.0.4.0....0510,1163300.0..'.+1..,)/1021211.,,*,,.6.,++-*+5**+**,*,**)/'++.,.+/-2)&&+&&'*')&()))+*5')'*%&&(&%"%',$&'&"'''','%'%%&&2&''&&&&-&"###$&'$#&&%((.''%'%$&&&)()('''''%,''%&&'!#%&%%%%'.**(''))'))'&&,(&%%&&&%&&&&('#&'&%%%,!#%'%'&%&%%%""%'%%" #%"" #$*%# !/"" "###%"""""-"!&!""!""'','.&$$$&('''('&&+'''(*..10046?FPYoЯђїќ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнноооппррррсстттттууууфффхххххцццчччччшшшщщщщщщщъъъъыыыыыыыыььььььььььэээээээююююююююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛЪ®ѓ±±¶Ц~uiaUOJID@8I)I-3552BP^iu{ЕПЭ®Ј≈Ј–ј””“ќЋ≥ЭХqОБКОЦ†Ґ£Ђ∞≥µєїЊЊЅЅЅƒ≈ƒ…∆«≈∆∆«∆Ћ≈««………«…∆……Ќ∆“бюю„ґљјЊЊЉїЇіі≥∞¶™•®ЦЫЭЧЪЫР†Ґ†ЭЫЧЮ†°•™ђЃѓѓ≥≥ґґґєґєЊґЇЃђђ™™ђ®£ЮХФНТ{ХРЩОФҐ£І™≤≥ґґЈїЉљЇїґљљњЉњЈњњњњј√ƒњїЇ≤°ҐЮђ≠Ѓѓ≤ґЇљЅ«ЅЈјјјјЅЅƒЅ√√∆≈√Љ∆∆∆ƒƒ√√√ƒ√√√ƒ√ƒ≈ƒ√√јЅјјјљїїїЇµі≤≠©¶Я†ЩФНЕxЖgЕtБpБЖЖСОЦЛВБvphh`WNJDC<764301../-.*+*-+)+'''),+)-/160/..1<1/1111131311.1...0./.000///1. ./.9.......*,..///+-*-+.,,+.-4.,,/.5-'')*9+*'*'+'''*)*))'%&&'''''''%%&'&%&''''''''')'(%%&().'''&&&&'&''''''&'''''*'((*(+(&''&%&'(*((&$&&$$(('''%('(+)")+)++))+('('&''%'%' '&'''.&$%'&$!!#%%%$$'%''%''''%%"$%&%%""&%"%%%%""#%$#%''%$$$$$)$" " !!$! !&$&#&&#"'&&'))**''$('$#&&%''))),0/35152J\j|ЪЇ ”‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежззззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщщъъъыыыыыыыыыьььььььььььэээээээюююююююююююююююююююююююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффуууууутттттссррррпппооооннммммллллккййййиззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”““——––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМНЮ≠ЈљЄ®ЫО{gii[MHF?=>>D+E=;7AHUXiyП†©ЈЂЮЪ§ЩҐЪЧЦУТНУЕУЙШЖУШ£¶ђ≠ѓ≥ЈЄЇЉЊљ¬¬ƒƒ∆≈∆««≈……««…«ЌбаЌƒЈЅƒ≈∆ƒƒ≈ƒЅњњї≤™•СЧХЩ°•§ЂІ©©§§£ЭЭЭ†Ю†Ъ°°§•®®ђ•Ѓ±≤ѓ≤≤ЇїЅ»Ќ€гњ©Ь©©Ђ©•†ЪЪЩЪТИЩСЫИЧЮђђѓґЈЇЇЅЉїљњјњЉє≥О•Ч©ЃЃ≤ЈЈЇљњњ√≈»“«√ƒЅƒƒ√≈≈≈««…»………«…« ««∆ »»∆……»≈∆≈»»……∆≈«∆≈ƒƒ√њљљЉЇЉЉ√ґ±≤ѓ≠≠І§ЪЦТТНЙФЪЮіҐrГБКПН°МЮУН}qg]VDDCEB?7965*3/2).'-+)+''''))+,//00/,,.5/.././551331..1/...../31*///.*..+.*.....0.'-./0.+*.-,//0 000,,-.+0++).-0&+'*'''''))+*+*)))*+')''''''''&'*'''#'&''))(%&(**)')''')&&&''''*'()'''**'**(&()('())))*-#*(&''')+*'('(,+$))''))''''*(*)*++(('(*'(())')&$%'('%(('%&'''&'''**%&'&(&('&%"&'%%&'''&&'&'''''$$$%"%%%$%"%$!$$! %&*%##&&$#&'%)**)('('''&(%)&$&&(,++++--+-+**(.2G_}ФЃЅќ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъъыыыыыыыыььььььььььььээээээээюююююююююююююююююююююююююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттсссррррпппооооннммммллллккйййииззззжжееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»««∆∆≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМОЭ©≤є±¶ЫКvnf^VMC:GED@?E9LLU_io~ДЛ†≠∞іѓѓФІУЧТТТЧРУФШШЫЯ§•™ђЃ≤≥Љ∆љЉЊƒ∆«¬≈≈…∆«≈«∆Ќ“—∆¬Њ¬¬≈ƒƒ¬ƒЅњњƒљґҐРЧЪЭ®©≠Ѓµ∞∞≠≠™®•§§§£•†°ЮЩЮ°§§§®®™™ѓѓ≤ЈЅј№€юЉ≤•ЃЃЇЃ≠™™§°§°Щ†ЬЪТШЪЮҐЮЂЂ≠ѓґґЈЇЅ»њЇѓУУЭЯі∞≥Јїї√Ѕ¬јЅ√ѕѕ≈ЅЅЅЅ√Ѕƒ≈≈≈«…………ќ…Ћ  »»»   »Ћ…Ћ«ћ»…∆∆«««…««≈≈≈јјјЉј¬≈√њїЇЄ≤Ѓ≠™•Ґ†††Ъ†°†Ђ†ИБЕlЕvНМСУЮ§БЬwРtc\WUONGB::884511. -+)+*++*++,,/,+,-5.--4..33/111/./4.000..0.-012.*..--+.......(.,,/,,,,.-//=)200.+-1*+.2-.-6).*+*()-**+2+.*)'')+**))(-''''(*+**'&'''&))-'')*)"'0))).''&'')).(*('''*((+*(((()(+++))+/(7+"))))'&'/'*,2'))*()).'"(*(*)+*(((''(*('(,'&&$%%''!#'(&&&&&&'.''''%%%%&%&)&%%'&%&&&&&&&'&&''''$$%+$''*&&#&%%%%$&"""%)&%##&%*&''*))'&'.###%&%()&)'(*((('))))&'**-.594?G^qК•ЊЌ”‘‘’’’÷„„ЎЎўўЏџџџ№№№Ёёёёяааабвввгдддеееежзззиийййкклллммммннооооппррррссттттуууууффхххххцццчччччшшшшщщщщщщъъъъыыыыыыыыыььььььььььььээээээээээююююююююююююююююююююююююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццххххххффууууутттттсссррррппоооооннммммллллккйййииззззжеееедддггвввббаааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆≈≈≈ƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООННММРЮ©±ЇіІЫРАtdUZZOGFD:>C>H9MCDDN]rwЙТЦП°Ш°£Ш®ЫЩЦФУНТЙЦИЧЗЮЦЪ†™™ђ∞µЄїєљј¬¬јЉЅ¬≈≈∆¬ЅЊЅЅ¬¬ЅјјњЉЇґЬЬНУЫ†І±±±µєЄµ±≤ѓђЂЂ©©І©§£†ЪЧЫ†††°†°°®®ђ•Јѓа€ыљѓЫѓѓЈ∞≤µЃ≥ЂђЂІІ°°ЭЪЬЮЮЫ°°Ы•Ґђ°ѓ≥ґґѓЫТЮЯ¶≥іЈїњњ√њјњјє ћƒЈљјјЅЅЅ√ƒƒƒ……»…ћ Ћ»»∆…∆…»…∆…« »ћƒ«≈≈«««»≈»≈ƒ∆ƒњјљјјƒƒњЉљє≥∞ђЃ©©©Ђ©®ІІ•ІҐЫСОzЖ{sЕoЗxВnШГЦРИИqДyrg]UCHHD=><75+10....-+,++)))))*.*)).++./..01/..2.20.&--.-.00,+..+.-....+,.*,(,,+***-,.+7-0//,**.'-/1---2*-+.*)(-**).)-)'%&'***+)),''''*****'&''&"'&+'''('$&.))'-&&$''')-((''&'(((**'"&&*++))(((,'3*#((('!$%*'*-&(&(!()."$((')')'''&&&'('&'*''(&''''$%%&%&&&&&'+'''&"$%$$$$&$""&'#'%#%###&%%##%% "$) $%*'&&$$$%&&"" "&&##"#")#&&'''$$#)""#"$$&"&&((%%($&&&&$&*)**-*&*.2:=CQgrЧ≤»—‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежззззиййййкллллмммннооооппррррссттттуууууффхххххцццччччччшшшщщщщщщщъъъъыыыыыыыыыьььььььььььььээээээээээээююююююююююююююююююююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммллллккйййииззззжеееедддггвввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§££ҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММСЯ™ѓѓ®ЬИГ|pb\VNFF=C5F7222>EIMalryГПШФ©°§§°ЫКУЕЦЕУВЧССОТЪЩЯҐ•™Ѓѓ≥ЈЄЈ≥њЉЉЉјЊ¬љЅЅ¬ЅјЉјї≤ѓЧЗНМ°Ґ®Ѓ≤ґґєїєЈґЈЈґ≥≤ЃЃЃ±ЂІ§§Ы°§°Ґ††ЮЮ°Ґ§†±≥бю缥ة™ЂѓЃµѓґ±±µЃ≥®©§°Ґ°†Э°†Щ°Ъ§Ъ™©®ђЂ°ЃЦЬІ∞ґЇЈњњ√ЉњЉљє ЋƒґЇљљјЅјƒƒ√√»»Ќ…Ћ  »…∆…«…  ≈«  »«ƒ««««««»»ћ∆∆∆∆њ√љјњƒƒ√ЉїЈ®∞∞∞≤∞≤≤≤≤≥ЃЃђђ™ҐЫЩСН~ЛsЕnnqЗЗtМЖР{ФСГНt|jjcYPLNGEB>:654=2000,+)(((('(''))(++-,/0.....2/-'-.4.0..-,02-.-.+).,,.,1+0,+,,,0-,++,//5,'*+'0//,,*-++,.*+*++*)+')''&''+**+)))'('(**))*'&''+"('''''''*')('')&$&''')*'(''''(*'*)'"((.+*))(('''*)))('& %%&&)(&(&(!&')"'('%(&'&&' #&%)'&&&'&(#(,''&)&#"&&&&&'(''&%%$%$!$! !&''%"#####%%!!#" "%& $%&&$%%!$$$"""%'#%#"!"### '$$'#& ##%$$"$"$&%%%%#$$&$$$)&&&&'''*'''+.25=Ka{Ш≤¬ѕ”‘‘’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяяааббвввгдддееежжзззиийййкклллммммнооооппррррсстттттууууфффхххххццччччччшшшщщщщщщщъъъъъыыыыыыыыыыььььььььььььььээээээээээээээююююююююююююююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооонннммммлллккййййиизззжжеееедддгввввбаааяяёёёЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—––ѕѕќќЌЌћћЋЋ ……»»««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇєєЄЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТССРРПОООННММТЯ™±±≠ҐФЙyoaZTUULEG=KH@9FOIMPWbpzЛТЪЬЧКУУ§¶Ъ•ЪЮЪЪТЦСТЦХЩЫ°°•™ђ≠Ј≥і≥ЇЄƒїЊЊЅљЉїЉЃ°УЗФЧ°®ђЃ≥ґЉїЉљЉЇЇїєїєєґµµє≤Ѓ±≠Ђ™©™™ІІ†°§°°•≥Ѕзг÷ґЬЫ••¶®®ђђЃЃѓє±ї≠Ѓђ™Ѓ™≠•≠І§•°••Ђђђѓ±їјМЧЭ™ђ≥≤єЈјљЉЉљ¬ Ћ≈ЉЄЉјЅƒЅƒƒ√≈  ѕЋЋ  …»«ћ »ЋЋ  ЋЋ »» Ћ…Ћ…»«Ћћ…«∆«ƒ∆Ѕ√ƒƒƒњЇЇЈҐ≤іґЄґЉЈЇЇјЈЈЇєґЃ≠ЂІ§ҐЮЫЦСНПССfДДГ{zР}ЯШЩСЗyulog]XPLEAK[how}С•ЉЪЈҐ∞•°ЪУЦЗРВСПЦПСЧЪЧЯ¶Ђ©Ѓ∞≤іЄЄЄЈіЈЯОЖ{ШЫ°®ѓ≤ґєїњњїЉЉЉЉљїЉїЉїЈЈєµµґµґµ±±ѓ±±≠™Ђ§≠°Ј«фм °ҐФҐ°§••§••™™ЃЃѓѓѓѓѓЇіґєµ±©§†®©ђѓЃ≤≥√їИЩКТОЭ§§ђѓЇґєїњƒ—»ґљЇЅ√√Ѕ√ƒ≈≈    ЋЋЋ Ћ»   ћЋ ЋћЌ»»»Ћ…ЋќЋ   Ћ»»«∆√ƒ√ƒƒ√»Ї∞ЈґЈЈљЇЉЉљїњЅЅљљ√њЉњЇЄЄЄ≤Ѓ≠≠••££ЬЦКНИЗeДquyГЙЙЬЙШЪШР|vigXPAKAEBA;:963303/,+)(()))+***)))*-.0-.101112*2040224+.02./1///.11..2,.1111///.-.--*++++.--*+*.**((**('**-***'&('''*(&***))*))'**())(')+)(*('&'),)))'')**'))*((**((******(+)-'()*,+$+,,)'%*&&('')*,,*&))*)''(((%'((*$&&%)&()&%&&*'''&&((%&(%%%&))')(&%&(($$""%&#''&&'&&%$%%%!#%%'&%&%$"""$'&(&%!"###%%"%'#$''''('$'&))(&&&'&(&&''%#((##&&$%&(&'&&)'))''**)-),&,/.&+,//Uq~Эі∆“‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежззззийййккллллмммннооооппррррссттттуууууффхххххцццччччччшшшшщщщщщщщщъъъъыыыыыыыыыыыыьььььььььььььььььььээээээээээюююююююююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиззззжжееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋ  ……»««∆≈≈≈ƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПОООННМЛХ§∞±ђ§ЩТК~lTZ\UQJJFEEEE+I=EGLK`lzАФ™∞љµЂТ¶УЦХТЧЧЦЛТЙТКЦШЪЭ†•ЂђЃЃђ≥ЬzЖzРЭҐІЃЈґљєїЉљЉЉЉЉЉƒЉЉЉЉїєїїєЈЈєЈЈЈЈґґµ≥≤Ј≤≥≠ЈЎэи∆Ґ£§§Ґ°°°°†°•§®®•¶©ЂЂѓѓ≤√Ѓ≈§Ь§™™Ѓѓѓ≤≥≤є•°ЬЩЧОЩЕЪЭҐ®™ђ≤¬ћ”ґЄЇ≈ј√√≈ƒ«∆∆«»ЋЋ…Ћ ћ   ћЋћ Ћћ“ћЋЋѕћћЋћЋЋ ѕ «»»∆∆ƒ√јљЉ™ЈґЇљљ√њјњњј√√√Ѕ√Ѕјј»јЉњЋЇµЄЉµЉ≤≥≠≤І°ЮЫЧРМtsrВSДВЗЧ•ѓДШ|ЬКymdb]TRNKEA@><8151)',+,(''(*('''(('((*0+0-0/024.002-.....,1.,+..+*.,/,,+..0..+....1*1.1..*+,*+,((*),,*''#))**'((((''()))(((&&&%###'&'')*,,,'''''))*%''''''''(&(&('(''**&&'''''('',*(,*,-)#)((((%&(***('''"'*' ##'%)&))(&&&*&& &&&((%(*''&#'')'&%%#%! %"$### &&#! %$%%'# " $!$$!!!"$"""#"#" $($$'''$#$#&''%%""#!&"$&'#%'''&&'#%'%#' % "%%&&&&$$&%(%%(,*-*+/2..+.&:QpК£ї ”‘‘’’’÷„„ЎЎўўЏџџџ№№ЁЁёёёяааабвввгдддееежжзззиийййкклллммммннооооппррррссттттуууууффххххххцццчччччччшшшщщщщщщщщщъъъъъыыыыыыыыыыыыыыьььььььььььььььэээээээююююююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссррррпппооооннммммллллккйййииззззжеееедддггвввбаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—––ѕѕќќЌЌћћЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФФУТТСРРРПООНННМЛШ•≠≤ђЯЧРАskgaZMEII?D>;1/B9H:IP^hvАЛТЫШ™ѓ≠¶Т§ПЪНУСЦППУЧ§ЉЖЕ~ДПФЫ°Ѓґ≥∞∞≥≤≥≥≥≥ЈЈЈЈЇЇЇїЇїїЄЉЇЈєїЇґЈЉЈЈґЈЉї≤ ююЎЊЂ±•ђ®•§°††Ю°Ю°Ю°ЮШЮ°°Ђ•°Ґ°Я°°••™Ѓѓ∞±ѓѓѓї©©®¶§ІЭЩСЩНМУЫЯКЧ°ҐҐ™ѓ≤ґљƒјЊј≈≈≈ƒ««»»Ћ«ќ…… ЋЋЋЋЋЋЋ»»Ћћ………ћ Ќ«∆√њЉЇЄљјљљЅјЅЅјЅƒЅ√ƒƒ√√ƒ√јЅЅ√√ЅјЅњјјјјјњњЉЇЉњґµ≤є∞≠•§†ЬЦУМН}Иx_ГpЖtЙИИК}Ф{РДxoi`]U?DFA@@>7633.,,*-***(*((('*+*5+-.000.000/.0..(/31/......+..,./....+.+./8/218..,.,*,,*(,*-,)'''()**(((1*''((**(*)'''(&&'**))++,+*)().)%*<*))'''**'(('(((+****'''(''(*'"*,*,+-+-*-+)*,(()+++*%'&#"))&&&*'(())(&'&'''&''&).&!())'&)''''&#%%#"%&&-&&&''&#""""&&& &'&"""!$!%%$$"$%!%%#&$$$$'##&''$ $'$&&)%&%%%(%&$''+&'(&'&'%%'' %'#&%%&%&&&&$""&''&#$-)*(****++1)'9?EE\qАЬ≥ƒ—‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежззззийййккллллмммннооооппррррссттттуууууфффххххххцццчччччччшшшшщщщщщщщщщъъъъъъыыыыыыыыыыыыыььььььььььььэээээээюююююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууууттттсссррррппоооооннммммллллкййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”““——––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЩІ±Їµ®ЫПДtia]TSKKF<<8>7=A7L9DORTd{НСТОЮЪ†ЬЫҐЮ¶Ьѓє»»јЦuВИООЦШ•І•ІЂЂЂЃ≠≠∞≥≥≥ЈЈЄЈЄЄЄіЄґЈЇЇЇЈЈЉЈЇЇЉјЉЉ÷€ю„≥©іЃѓЃђ™™™®••§°Я°ЮЪЮЯ°¶°§§ҐҐ°†Ґ°•©≠≠ѓЃѓѓє≤≤≥≤ѓ≤≠™™••††°°СЫЫУХРЮТЩ°≠ѓіЄЊЊјƒ∆∆««……Ћ«…   …………Ћ……ЋЌЌћ…Ћ««ЅЅЈЉјЉЇЅ≈ЅјЅЅƒƒЅƒƒƒƒƒ∆ј≈«∆√∆ƒ≈ƒƒƒƒƒЅЅЅЅ√ЅЅњЉњјЊЉєњєґ≥≥±Ѓ≠™•£ЭЩС|Н~Е{ГА_А}КАРСЙХАВxq]]WOKJJDB?:63220//.'-+*(())(.()*,..-..0000.-*/3/1120.1.-...././.+*.*./5/216..,..,,,+).,0.-*)*'*+*((',+('('*)**(%,*+))*,,++,*,,+*)-.)&-7.--)'''*''*((+,,++*+**.+***,)%)+)++-*-+.+--/-,*+***'&&'#***')*)))**'#&&)'**)'')-&"()*)))''*''%%&$$$'&-(('((((&%&&'''&'&&%#"%!$%%!&%"$%%%##&&&'&&&'#"'''$#(('&&&"%%&&)))'*'+!'('&&('%''#''%)'&''''%$$$&&)'$"")&(#))&)++0+'1//.6:6DM\hК©јќ”‘‘’’÷„„„ЎўўўЏџџџ№№Ёёёёяяааббвввгдддееежжзззиййййкллллммммнооооппррррсстттттуууууфффххххххцццччччччччшшшшщщщщщщщщщщъъъъъъыыыыыыыыыыыььььььььььэээээээююююююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттсссррррппоооонннммммлллккййййиизззжжеееддддгвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєЄЈЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЭ™Ѓ≤∞•ФЛ{wlh]UMMGFDC7E++896@JX^ct~ЙЛХЬІ•ЃђњЋ„Ў«™z}ГГАЗИТУЧШЩЬЬҐ•§ђЃ≤ѓ≤≤≥≥ііљ≤љЈґЈЈЄЄЈЉЈЇЄЊјЈјй€ю–ђ©µѓ≤≤ѓЃѓЃ±™®••°•ЮЫЮТЮ®Ю®§§°†ЯЯЯ†•І•©©™™Ѓ≤≤≥ґµµ≥ґ≥ґ∞≤≤≤ѓ≤І†ХШНЩЙСТЪ°ҐѓѓіЇљњЅƒƒ…»∆∆»……»…………ћ…Ћћ–ћ— √√ґљљіЉљЅњ Ќћƒ√ƒƒƒƒƒƒ≈≈≈≈Ѕ∆»«ƒ∆ƒƒƒƒ√≈ƒƒƒƒ√√Ѕ√ЅјњњњњљњљљЉњЉєґ≥ѓ±Ѓ≤Ђ§ЮЩФУПМb}tsАrДzЧЙР§ЬТxqkqi_ZUPID=@B:966.2..*+,,)))))+,*,+.....-+/00.002/..0-1//./.2-++2*.../21/,,,../,0,-....4**'*++*(%*,.)-(+*)*'%/,,))*-,-+1+,,+**.0))--..-.'''*'*+*(+,,+,+/++..*,*.)'))'++-*++++-.--,*+**)"&&''**-))*))***)#)).)**)')*'&&))**).'&+'*'&-%%$'')(('(((**&'''''&'&#%##%""$%$$&$"$&&&&%''''&'*'&#'''$''$&%&&!$%&%&*.*+((!'('&%'*%(((((%)'&'()'%$$&&&&&$""$%)"&&&&))*''++((,(!+.6=JT[sК©Ї ”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёёяааабвввгдддееежжзззиийййкклллммммннооооппррррсстттттуууууфффхххххххцццччччччччшшшшщщщщщщщщщщъъъъъыыыыыыыыыььььььььььэээээээюююююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшшччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиззззжжееедддггвввббаааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМНЬ®≤µµ®ЮРА}udUTPPNG8CDC==D=AJQVWd{ГНУЭ©Ј¬–≥≤С}ЕААЖДЖВИЖМТХЧ°Ґ®®І®ЂЂѓЃєѓљіі±±іЈґЉґґЈљЅ±≈ыюшЅЂ≠≥ѓ≥≥≥≤≥ѓЈѓ™®§†§ХЪЪКЮ™Ґ™°°†ЭЭЪЪЪЮ††°°°°§™™™ѓЃ≤≤ЇґљЈљј∆ў“ј©§§°°°††Ґ§Ч•†§Ѓ©∞≠ґ≥јњњј√ƒ∆≈≈«…ЋЋЋЋѕ–»ѕ√љЈђЈЉЉЊњ√√–ѕ”≈ƒ≈∆≈≈≈∆≈≈ƒ≈≈∆≈»∆∆ƒ√ƒ≈ƒ≈ƒƒ√ƒЅ√√√Ѕƒ√јњјјЅЅјјƒјљљїЈЇЈЅє∞ђЂІ®§ЯШПДwЖgАmwЖМњЈЂКГЙФФГoog^PUWJCBA>963./00'),,)-*)'(++&'))(+.-+-----00.2./...3...7+++,./.,**+,,--4,+,+++5))&)*++*(,,2+1+))')&'-(*&%&))**4++**(**1*)))--*.'''***(+''***,+2+**,(++/*(*))+-+('***+**(***)(' '''''')))*)))*)*),,3**)'')*$'$((')).'$'&)&'/%%&'$&&'''''','&'&''#&$ "#%%#"#%#####%''''()%%%%'-''&((('(# "!%%$!"""$'.(,()'''%$#%+%(%(%%(''&'(''%%$$"$"$$"$&%,%&$&&)''%%&(&&'+(+,//955CHSW\Й°Ј≈“‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежззззийййккллллмммннооооппррррссстттттууууууфффххххххццццчччччччшшшшшщщщщщщщщщъъъъыыыыыыыыьььььььььэээээээюююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккйййииззззжеееедддггвввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§££ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМО†©Ѓ≤ЃЯЗ}snb^TPJEA=5@0<-/.,&/9GXhvВНТ≠°ЧЛЙЖВvА~~p}p~}ИЖМСОТХЩЮ§§Ґ•ІЃ≠≠≠ѓЃ±≤ґ≥≥≥єЉЂ—ю€йѓЂЃ±Ѓ≤≥≥≥≥ѓ≤≤ђ®°ЪЦИЫЫЮЮ§°£†Ю††ЮЫЪЪЪЪХЭЪ††§§°Ъ§•Ђђ∞≥ЈЄј∆—юу“≤©±Ѓѓђ™®™®•Ґ§У•С•Й•ТЮђ≥іЈјњ√√ƒ…»Ћ…ћ’≈ЉіђґѓЄЇљњјЅ√љ –Ћƒ«≈≈ƒƒƒ≈ƒ¬≈ƒƒ≈ƒ«««√ƒ√ƒ√ƒƒƒ√ƒ√ƒ√√ЅƒјјјјЅЅЅјњЅљњјњЉњјјњїґµ≤ґ≤Ѓ≠©≠†ХСКБtДМ≠±†Ф|ЖЕШЖЫДУМwuig[UMMGEB92965$-00',*,!))(''%%(*(%*++++..,,.0..*.-.--*++-,/+*))),++.-)),*((''&'$)**+(*+($*+**''''%'#%#$%&#''+*+'('((*)&''*')'%''''''('''''*'*''(*&))*((++)++-''()((''$(**)))'*('&#&''&)*'**)**.*,)(''&((''$'##&&'&((''&%&$&%%""%(''&&&&&&&&&&" " "#%%##%##"###'')'(($$$$$'''&'((''  !"$$$ ##('+')('&#%##%#%####%%%$&'&'#""""$&&"%%'$$&%%!!!%%%%((&&''+')&&-4CXsЦЃЅќ”‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяяааббвввгдддееежжзззиййййкллллммммноооооппррррссстттттууууууфффхххххххцццччччччччшшшшщщщщщщщщъъъыыыыыыыььььььььььэээээююююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккйййиизззжжеееедддгввввбаааяяёёёЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌћћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММПЮЂ≥±ђ°УДoi]aaWSMC=8<:A0B499L[dhnoxМЬ°ЮЪ}УГАГГВ}ВГЕГЕ}ВЙОРТЦЦЧ†Ђ£••ѓ™Ѓђґѓ≤±їЈҐё€юЎЯЮі±≥µґЈµ≤±±Ѓѓ§ЮЪЖЮ†•≠®©©©І§•§§°††††††°††°†ЦЭ†§¶•™Ѓ≥іЊЈ÷ю€“√ѓЈґљ≥ї≥і∞∞≤∞∞ѓЃѓ©©ђ•Ѓ≠∞Я≥µґЉјƒ«ћ∆÷Ћђ°ЛґЇЇљј√√√≈≈≈»ЋЋ…√««≈ƒƒƒ≈≈≈∆∆≈∆   »∆≈≈∆«∆…»≈≈«ƒ≈ƒ»ƒ√√ЅЅЅЅ√√√Ѕјњњњј√ѕƒјЉЇЇњєµ≥µ≠•£ЯЭЯЩИЪЭ§¶ШWАvДsДАЛҐ}Ш}ЪЪЧsgb_\UOKGACF@:71110/-,(+' %'(&((*+*(*.*(+022...-,*,,.//6.+*+,3,+,,,.+*+*-)*+*-+**$*/(**++++*+)-))'''&''*+++(++**+' *'' '''+*'''(*('(***++*++)'+))'(*+))+5**+/,+*('*)))+* *+(&&$'')))),*..8..*)))'&(''$&#'))&')(&)'(((3&!"&0'''"#"&('(''$"!#&''& &(&'&"""&&'$%(%$%%'$(*&&&'&'#""%%!%&$$$((('('('%&"""&'&&((%(%%%$&$'('#$"$&$&&$&&%%&0&&&''(%##%#%(%(((*''*------14&8IOLevР™√ѕ”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззиийййкклллммммнноооопппрррррссттттттуууууфффхххххххццццчччччччшшшщщщщщщщъъъыыыыыыыььььььььээээээююююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссррррппоооооннммммлллккййййиизззжжеееддддгвввббаааяяёёёЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”““——––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТТСРРПОООННММУҐЃµЉµ£ШЖmfdYRTNIHCB==>>D=706;GM]ituЗХЧЯИПИИЙЕГА~o}~АyЗКМЙТФЧЪЭ°ҐҐ¶™Ѓ≠µљЂф€ц“О£∞±≥ґґµ≤±ЃЂ•ЯСЭЮ†Ѓ®™ђ≠ѓЃЃ≠ЃЃ±Ѓђђ©®•§•°•†££Я†°§•°•™ђ•ѓ≤’€€Ўє©≤≥ЈЈЇЉЉЅљјЇЈЈґі∞≤≤≤≤≤±Ђ©Ѓ®±ҐѓѓЉЊƒљ≤Ы¶ґЇљ√√≈»«»∆∆ ЋЋЋ»∆∆≈ƒƒ≈√≈∆∆»»  » »»≈∆»»… ……њ∆∆≈√ƒ∆∆≈ƒ≈ЅЅ∆≈√ЅЅјњљЅЅ»∆ƒјњљљЇЈµ≤∞∞±±±≠Ђ™Ђ™ІІЭО}ИЖ{x\АhЕЗЙЧПЫДЫПВsnb[UIMHEB>871421*..*'**('((*(((('(*.0.---*,,--.///.-*..1..,,,..../..---+*+-**,,'/.+-+-**)----+++*+*)*+++(+)*')1+*')*+*+*+*(,++*+*++.---+(*,*$)+,'*+.-+.1///+**)''**(++('(**)'))&*)),,.-*))))&(++('&'**)'))')*'&&%)&" ')'''&##&)'''&&#'''(*('&''&&&""#&''$'''$'(*(*($#"#&&&((&&&&&&&((((%%&"#$$$&&& (((%%#% #'''**'&&&))&&&$&$$%)''''+*((%%!#(('*+*''--))&&)***),)3)*-12PvЭі∆“‘‘‘’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежзззиийййккллллммммнноооооппрррррссстттттууууууфффххххххццццччччччшшшщщщщщъъъыыыыыыыььььььььэээээюююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххффууууууттттсссррррппооооннммммллллккййййиизззжжееедддггвввббаааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТССРРПОООННММФ£ѓЇєЂЮФЖtsc[PURKCCA>9;==3AAA@QafpxРЧЬЬЧУАКy~~~ГЕВГЖИЖПТУФФЧЫЮҐ£±Єю€ё«Е¶Ѓ≤ѓµ≤ґЃЂ™§ЮПЦЮ§¶Ѓђ≠ѓѓ±±ЃЃ±±є±ЃѓЃЃ±™ђ™±І•£••І•¶§•™ђ©Ґ≤÷€ю“ѓ™ђЃѓ≤ґґґїњњјї«ЇЅЇЇЇЇЈЉЈ≤Ѓ±≠±™≠Ѓ≥Єљ¬”ђ°ґƒ≈«ћћƒ≈««≈«Ћў Ѕ≈≈ƒ≈ƒ≈≈«∆ ∆Ћ ћ Ћ»»∆»»»    ≈»∆∆≈»∆»≈∆≈≈≈ ∆≈√ √јј√√–«ЅјљїїЈЈґ≥≥µµµµµ≥≥≤±∞ґђІЬЯЫЧНИz~}{ЖrЙ~ЛЖУЧДДyЙКИkfc_UAJHCA?<8641////-/,,)(**('(+++)*((,/++...1.+-..:./+*+.060111..-+*---+,+(.,,.+-***-.+,-.5.5+++,(,++)()1.++,)(*(+,+,,6,++,***++0.,*,,/&)*5)-**-,.0/2.*)))))++5,+(('(*'&))))))*********')*.)'')*0*&)''')&&,&(&$$#&''&'''&'2&'&#&'),()((&&&'&#&"#&'*&#$$#'(((('#'#&"&&'&')/&)&&''''&#$&$$%$%&&&"%(%%(%' $$$''''&)&)&&&-&-&$&'''''('%',#$(('***''+5**&&&&&0&&&-&*-02@L[_YyЦѓ√–‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббвввгдддееежжзззиййййккллллммммнноооооппрррррссстттттууууууфффххххххцццчччччшшщщщщщъъъыыыыыыыььььььььээээююю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттссрррррппооооннммммллллккййййиззззжжееедддггвввббаааяёёёЁЁ№№џџџЏЏўўЎЎ„„„÷’’’‘‘”“““—–––ѕќќЌЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТССРРПОООННМЛХ§Ѓіі∞ЮСА{paUNNLJKH?7=;746C8<<334413/-,))+(('(''$''''*$'0+,.,++--2'+++'-.4-.+0-.+*',++*+((*(*+*+(*'+.**,,2.2,,,+!+++(($,**,,+)&(,,&,-3+*(+('())-**(**,"&(/)*)'*,*..0')')*-*+,2+**(%''$&'')&')*(((('(**'''-''')).-''&&')&&*%&%'(&$'&&'()(&-%&%%)(*&''% "#&#&'&&'')# # $'''&#"'"$"####%),''&))'&&$"&&$#$##%&####%#% $"$#%'%&&&&&$&-&*$""$&&&$%'%#'*#$&(''''&&'.&&&&&$$)$$&&&)*-0422.6CACO^ЙҐЉћ”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввгдддееежжзззииййййккллллммммнноооооппрррррссстттттуууууфффхххххцццччччшшщщщщщъъъыыыыыыььььььььээээюю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццхххххфффууууутттттссрррррппооооннммммллллккйййииззззжеееедддггвввбаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПОООННМЛЦ§ђ±ѓЮУЖxlgg^PLLEA<33=/*-027GGJL]o{rИИКЖКРЛДyЛДЙАГxzЕБЖ}Бѓю€љЧ}ТЬ†£І™ЭЦ}ЗЬЫЬҐ§І©Ѓ≤ѓ±ѓ≤≤≤≥≤≤µ≤≤≤≤≤µ≤≥≤≤Ѓ±Ѓ≠≠≠ЂЂЂ®ЂЃ•®їжцбњ•†™••£І™Ѓ™ѓѓ≥≤і≥≥љЇљљј√ј љґ≥≥≥≥≤≤≥Јƒ ј®ПСШЭ•£ѓѓ≤≥ЄЉЋ÷«јјƒ√≈≈«ƒ«∆≈√ƒ≈ »»««»…≈««Ћ««««≈√ј≈∆ƒ√≈≈≈≈∆≈≈√√√√√√√ћ∆≈√ЈїЄіЇЄЄљЉєЉЊЊЇЊЉњЉїєµґµ≤≤±∞ђЂ£ЮЪХУЛ{ЗlДrsА{ЖxИЬЫЧФ}ГmpigURPICA@@8:893000,,)'''$$%$$$!%.)+,,.**)+%))2)-.-+-).-.+,(,,+(*())*++***.'+.*(*+-,,,,,+!)++*('***--++((,.(+-**#'*(()*)4**(*)("((*(('',0,,,.'*')*1+++,)),)%($#%&&(&'*)'&(('(**&&')')')))-)'&&')'(&%%&-('''$'$'((&&&&%%((&$*'$ ""##&''&''&##"$# $'''# "($" #"""$''&%&)'&&&"&1"$$#!#%)" #%'! $#-##%'&&$&$&&'''%&"$&&$&%'%#''$$&'''''&&&'"&$&&$"$"#%&$&&')+'%.1*'*/9AWjЖ•є…“‘‘’’’÷„„„ЎўўЏЏџџ№№№Ёёёёяааабвввггдддееежжзззииййййккллллммммнноооооппрррррсстттттуууууфффххххццччччшшщщщщщъъъыыыыыыьььььььээээю€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссррррпппооооннммммллллкййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПООНННМЛЧ§ђ≤©ҐЬЛxyuh[J=IJF9AA?;D3--@IGN\novАРЛГБФППНЛН{Н~ЛwО© м•ГvЗСЩЭ°РОСnХЯЪ†Ґ•©©ѓ≤ѓЃѓѓ∞≤≥≥≥ґ≤≥≤µµґµµµµµґі≤іµ±≤ѓѓ≤≥ЃЃѕлуЎЉ§•ІІ®§•І™™™ЃѓЃ∞ѓ©≤≥ЈїљљјѕЉєЇµЈЈґґїґњƒњ≠™Ь§Ю§ЫЮЮЮ•Я™ґќјЈЈЅј√√≈ƒƒ≈ƒ√ƒ««≈≈»Ћ…Ћ«»»Ћ…Ћ……«≈≈∆«≈«∆«≈∆ ««∆≈≈∆≈≈≈ќј√јµЄїїљїљЉљЉЊњњЊ√ј¬њњљЉЇїґЉґґµµЃђ©©®¶°ЫШУЛ{РЛsДxsККУyХ}КМЙ|xtid^WQIFDKA:97240(,*(($&&$$')(++),'&&''(+8-------.+...+.,**+*,,--++++.(**(+,,,++,.,,+,+,,,+,++)+--,,...*))*!****,.-<-,,-*(%(*-)))*.3.,.0,.)),3**+,)*,,()(%"%&)*)*)($+*)**+&')*)*))''*)'&)*''*(&&(0)')'&&'$&')(&*(&&(&%'-(('&#&#&''&)'&#''(%$''$'#&+'#"&#%%%''%'&'&&&&"&>'&&"#$&-"$#%''##%'%5'%%*&%%'&''''''* $''&&&&&$&'&"$&$&')'&'&%$&$$"$$$%%&&$&&'')'&*+++*1.2/@EJXcqС≥ƒ–‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяаааббвввгдддеееежззззииййййккллллммммнноооопппррррсстттттуууууффххххцччччшшщщщщщъъыыыыыыьььььььээээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшччччччцццххххххфффуууууттттсссррррппоооооннммммлллккййййиизззжжееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФФУТТСРРРПООНННМЛЪ®ѓµ±¶ЩНuphbYPLKEEE?47::')*2:IU[cjvВСЛСС°Х†ЧХУН†ЂҐМКiСЙХЬЪАЛООХХЧЭ†§§•ђЃђђЃѓ±≤≥≥≤≥≤≥≥≥≤ґґЈЈЈєєґєєЉґґµµґЇЂЇ÷ншЁґ≤†ђІ®І™І®®™®™¶©Ђ≠Ѓ±≤їЇљјЉєєЉєєєЇЊ¬ƒЉ√Љєґ≤ѓЃ©£ОЬЙЬ~ЮЫЫЭ©≠∞ЈЈЉј√ЅЅ≈ƒЅ≈≈≈≈«…»……Ћ………«……»≈≈≈«»≈«ƒ≈»»«……«∆ «ј√√≥јЊљїљїљїїљјљњ√јЊ¬ј√јјњ√њљЉњїљЈЈґ≥≤µ≤±∞∞∞®ҐҐЮЬЧРЖЖWАglЖДУАЧЬЬХЖЕyka^QNOJGC7=8823/,&((*)))),)%'$$#&(()------.-.'./.,.,,,,*-,-.,,,,*'()+.,,,),,.,+,/,,.2+*+*'-/---...,))++,.--..-00-),))!,,-*-)-.0..0,.0*),,*)+0'+,.*)*&!%)+-*)+)+-++++*#(*+())''*))((*(((,*(((**(*(&&'&&'+*(()&%&(($''(')&#"&'&')'#()(('('#$$#')''#&&&'''*%&)&&)&&"$')&')$""&&$&%'''#%('&)&&%'%%''%''#%'+(&)'&&&&$$&&$$$$$&)'&'&&%&&&$$$&$$&&&&&&&''$&)))*++++.'&+22CYoО®√Ќ”‘‘’’’÷„„ЎўўўЏџџџ№№ЁЁёёяяааабвввггдддеееежжзззииййййккллллммммннооооппррррссттттууууффхххццччччшшщщщщъъъыыыыыьььььььэээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххффууууутттттсссррррппооооннммммллллккййййиззззжжееедддггвввббаааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЪ•Ѓ≠ђ†ЕjP]if_XRK9CDA=<'<1;@AATccdpНШ•¶Ђ•ЯУ££ІЭЦЩЬЬЧ£ЯЃƒУННКОТЧ°Э†°Ѓ¶¶¶ђђЃѓґ≤Ј≤≥≥µµЉµЈµґґєєїЉјїЇЈЈЇњЈЅж€па±Јѓ±ђђЃЃЃђђѓЃЂ®Ґ™ѓѓ≥і√ЇЇЇґЄЉЈЊєЇЇЊЉ–¬–њ«љЅЇЄґїЃЂІ§°°®Ю•РҐМЮ¶≠≤ґЈ≈ќ јЅ√ƒ…≈≈«««ќ«………«Ћ»≈ƒ««ћ«≈≈ƒ«««»»ћ«”ЅіјЊјјЊјЊЊЊљљјјјњљњј√√ƒ√јј√«јљљјј≈ЉЈґїЇїЇЊєґµ±≠≠Ђє§ЮЫШФРИxwjДsZАКСШЕҐВСЗЖ|smc]WQLKYB@>95541-,,',))%$$$$(.(('))()3..+..../....-.-,,,,*,)''*9..,--/..,+.8,,.C,%)--..++*+...,),+,3..---00-,-,-,+.4.+++.+*,-%-?*)-,*..@+)****''&')..-,+),)(),++*.+*)*''*9-),*(&%&*((*(&****(&')&&).'&%&&()0'''))1&&#&'##&(('(%%(%(*'$'&')'.&''('''1'''$$0&)&&'*)*)'$$$&-%''%#!#%%'''%'%%''''# !%%#!%$&&$$" $&&$&$"&%'&%# %'&&&$&$&&&%&&&&%%&-&$&&&&'''''*)+.26:70=DdqЛЂ√Ќ”‘‘’’’÷„„„ЎўўЏЏџџ№№№Ёёёёяаааббвввггдддеееежззззиийййккллллммммннооооппрррссттттуууффхххццчччшшщщщщщъъыыыыыьььььььээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттссрррррппооооннммммллллккйййииззззжеееедддггвввбааааяёёёЁЁ№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶••§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМНЯЂѓ≥≠ЯСЗmlh[NIFCG?>50:,:1,',199M]nyАГПЯ°ЮЪ¶Ґ™®≤®™©ТИp~АБ~ИЛППЧЦЫЭҐҐ£•¶®≠ђЃѓ≥≤і±≥≥≤µґµЈЈїЈЇ≥ЇЉјѓјьюжЎ™і§≤≥≥≥µ≥ѓѓѓЃЃЂђЃѓѓ≤іЇґЇЄі≥≥®µѓ≤≤ґ≤ЈЇљїјЅЅњљљљЈµ≤µµ≤≤Ѓђ£ЯЪИЬМЮЖНФҐ™∞іЈЉјјЅ√√ƒ…≈≈«≈ƒ«≈ƒЅƒ√«ƒƒ√≈«»»≈≈√ЇЅ≤ЇљЅјјЇјЅјЅјњњј√љљљњјјј√јјј√јљљљїјЉЇЇЉїїЈїЇЄґµ≤∞Ѓ≤≠™ђ¶І££ШФМКЖАpezkБlААИЙЙЬЖ©Р}n]_ZVBGGC9<:7)10-0--)%$$$%($$###$%(((*((+./1/.//00.,,**,)&&).**'+,,+,),./+++0)*%*-0-+)*(+)-,,+++.+-)----*)-*----.++++***++**0%).,*--/(''*'(''%'+,*++*(''(((***+()#''),/,,)(&%"%''(&'((((*)')'#%")'&&'),-'&&)''"%"'-###$$"%%)+('*('###&#&##%% ##)$$&"&&&'%''')&'$ $&%'#''%###%##%'#%#%%'(%! #!#!! ##" ""$&$ % %%%&&'%%% #''%&'&)&&'$&&*&&&$"$&&&$#$$&'))---)2+)-59O]ЭЈ«–‘‘‘’’÷„„„ЎўўўЏџџ№№№Ёёёёяяаааббвввггдддееежжззззиййййкллллммммнооооппрррсстттуууффхххцччччшшщщщщъъыыыыыььььььээ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццхххххфффууууутттттссрррррппооооннммммллллккйййиизззжжеееедддгввввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМОЫ£®®•ЫФДtmif]ULIJCF?:2+899/E/BQ_fuЛЛКЫЂ≠Ѓѓђђ™Тv|wzrz}БwЗКММТЧЮЮЫЮ†Ґ•®©ЃЃѓѓ±ѓѓ≤ґµµґєЈЇЈЉљЅґ≈щ€Ё”≠їѓґєЉєєєµ≥≤ѓ≤ѓѓѓ≤≤∞іґЄљґ≥≥ѓ©ѓѓ≠±≥±ѓ≥≥ґґЇїЉЇЉїїЇЉњЅ√≈ўƒЄі≠Ґ•ЫЮШШЫЧ†ШЂ≠∞іґЈЄїј…Ѕ≈≈≈≈≈ƒ≈√ƒƒ«≈≈≈»»’ √ј≤ЇљЄјЅ«ƒјјЅЅјЅјјј√√јњјњј√√≈√ј√√јјЊїїЈљљЉњЉЉїЉїµєґµґіґµ≤≤Ѓ≤ґ≠•§ЮЭЪХОБxЗs`АjДНЖУНЖА{Еruff`\UPMJBC=38941,"))))'$### $'&$(''**..,..,../,,*(*(&")*)''*+++,*-..,--/+/**-2--+)*++--.,),**-+2.'-*-.-.......+****+---<)+-*+.-.*(@+*(+**,++(*+)&)+*)*(++*)&))*,,,/)!&%%%'''&(*(')**)**')')))&*),,,) '0'%#&%)) #"$#$%(,)(((('&#&&%## ###$&$"$$$&&& %'&(%'&#&'&'%%%%##%'%#%.%%%''%('$$##$ # $&$""""$$$$%%%#&%%%&''&#''##'*&%&&'&'-'&)-&&&$$&&&$"$$$&'''+)+).+)+04<.4;255@:pЗТХХХЪЮ†Ц}ЛААwzzzu}rАГМРТРЦЧЪЫЮЮ••®™ђ™ђѓ≤≥≥ґґґЄЇЇЉјЈЋуф“»≥љЈєЉњљЉЊїЈґ≥≤ѓѓ•≤≤≥ЇЇЇЉ≥≤ђђЂЃ≠≠ЃѓЃЂЃ±ѓ±іЈµґґЈЄЇЅƒ……брсƒ√љЈ≥ђ™©¶•ЯЯЫҐ•¶©Ы©Ю≠ѓЄЈїЊј¬ƒƒƒ≈≈≈»«»Ћ»∆ЋЇљЉ≥ЉљјЅ√…Ћƒ√√√Ѕ√јј√√√√ј√√√√ƒ≈≈ј√јЅ√јјјЇ√ЅјјјњњњњєЉїїїєїєЈЈґЈЉЈ≤±Ѓђ©®§ЭХЩЬСНxДxlАwЕКК®ЛБЗХАЩuАtmc\VOF?B=870310,,*(''#''$$$$$'&((''*(++,.+**,*'&+)'')+,+..*...//0/+.(+-1-+++--++-..,/+)+-0.).-...0/11/1.++***...-5++-+)---+",6,+,/,/.,.+,.+)-.+*,+**++**+**))-)$(&&'****+,((*+))**)**))*-*)*,,*&)-)&&&((&#&#'''''+(((('&)&&''%%#''% '&$$$&$&&&'"'$$%#''&''''%#!##%%''%#+%% '('&&$$""&$$"$))&)'''(''''''&'&%&&&$%''%%%'%&&&)')*'&&*&$$&&((&$$&&&&&&")'))-+++.22205<>GO]cЕ®¬Ќ”‘‘’’’÷„„ЎЎўўЏЏџџ№№№ЁЁёёёяяааабвввггдддееежжзззийййкклллмммннооопрррстттууффхххцчччшшщщщщъъыыыыыьььььь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшччччччцццххххххффууууууттттсссррррппооооннммммллллккййййиизззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММСЮ¶Ђђ≠ЯР{vk^VUUQMED@=:("!Ujvj]cl}ВДyЛУНМyЖyЕ{zm{|АБzЗКМНПРЦЪЭ†Ґ•§™®ђђЃ∞∞∞і≥ґЈЉЇ…аѕ ЅЄљЇљљњњњњїЇЉµ≤Ѓ•¶ґґЄЇЉЇЈ≥≤ѓ±≤±Ѓ≠ЂђЂЃЃѓЃЃѓЃѓ≥≥ііЈЊљ«ќп€ю—їЅєЄЈЈ≥≥≤ѓ•©©ЂІ®ЦЫУ££•≠Ђі≥ЇЉњј√≈ƒ»∆ѕ √ЉѓЃЇЇЉљјј√ƒ ѕƒ√√√√√јј√Ѕ√√јƒ«√ƒƒ≈≈≈≈ЅЅ√њјјЅƒ√ЅјЅјјњјЉњњЉЉїїїєЈЇЉЉЉЈґµ≤≤±≤≠≠™І§ЯШФУИxЖuАКЖ©xЖЕШЙ†ЖФСГБqxsq[UOJEDC>956=10..*,(($$$$#&' $''(((***,.***+*'')+-+..+..///1/+,(..3+++*-/++-0../+*+-3..0..-.//2/...+,***.1...----)-+--*,*,./1.21.,'.....++*,/,+-0***+**(,)&))))*++,.,((*+))**))*)))-*)*,,**))&&&&((&,'((/("'*(((-&'&&'&'%''*'''&$&&'&$&*'&'##%%+'&''''%#!##%%''%%'%% (('& "$"$&&$$$)**-*)''#'&','$'&%&&&$$''%$%'%&&&)))&&&&(&$$&&((&#%&&&$&&"'')')+))++++).-'+0009OixЗ©ЊЋ“‘‘‘’’÷„„„ЎўўўЏџџџ№№№ЁЁёёёяаааббвввгдддееежзззиийййклллмммнооопрррсттуууфхххцччччшщщщщъъыыыыыььььь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххффууууутттттссрррррппооооннммммллллккййййиззззжжееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТТСРРПОООННММТ°®∞±™УЙ|xqg[RPKH=31-=>>>*29ENVc_csЕУЯЧР{}~ИwxВГЕxДИМДРЧЧЧЭ†°ђ™ЂЂ≠ђ±±ґіЈЇЇґґѓѓђСђ∞≤ЈЈЉЇљњјјјј…јЉЉљљљєєґєґµµµ≥±ѓѓ±∞∞∞Ј∞µѕю€ЏЄ≥ђ≠ђђ∞≥≥ЈЇЈєєЉЈЇїЉЈЉЈ±Ѓ±ђђ™™§§ҐЧ™ђґЇљѕІђІѓі∆ЇљЉјјЋѕ ¬њњљњ√ј√√Ѕјјƒ√√ј√ƒ√ј√≈√√√≈√√√ƒ√њј¬¬√√јјјјњјјјљјјњ√јЉїїЉїїƒЈѓ≥∞±ЃЃ±Ѓ≠≠ЈЂІ°ЭХХТОКИЕИ{eДaАZДАВИЗМГШЖЬЦЛwngaYKMHFD@9<9522//,,((('%''(%$('''(('())+,+3+&+++..,,*,,,,++,#+.-6.+-..+*&((+/,/+*+.+../..//./.2./.,+"-.06-&,,.++-.+)')+)(,..*,,,.,,,)+..+./+&+.+.,6++*,((((*,*0'%&(' '**,+*&%(('&)5**)*'()))''%%(*('')&)&)&$$$&***'''%%&''')'&"%%-&&'''''($##!#%%%%!!##%&&$&&&$$"&&&&&-''##%+''' &+%%&&'&&"$&'&'''&%&""&5'&&-&$&&%%%&%&&&&&&$$''%&&%$,/--*+-)"),+"+.025 2CXfqtС©ƒ”“”‘‘’’’÷÷„„ЎўўўЏџџџ№№ЁЁёёяааабввггддеежжззиййккллммноопррсттуууфххццчччшщщщщъыыыыыььь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшччччччцццххххххфффуууууттттсссррррппоооооннммммлллккййййиизззжжеееедддггвввбаааяяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПОООННМЛШІ±≥≠§ЫПВsdb]VOOEEC@<668+:00,/0BTbkqt}ЛТФАРГИЙОГВ~ЕКНГМОПТЧШЪЮ°Э©≠ѓЃ≥љ≥∞™М™©ЂґґіЈЈЇїњњјјјј√јњјјјљљљЉљЉЉЉєЈЈґµµµ≥ґЇґєЎюю∆Є≠≤ЂђІ≠Ѓ≠≠≥≥µґµґЇњњњЉЊєєЄЄЄњі≠ђђђ≠ѓ≤µЌ≈Ѓ§ТЯ¶Ђѓ≤ґЈљ«„ƒјњјњјјјљјј√ј√ƒƒƒƒ∆≈√ƒ≈√≈≈≈≈≈≈≈ƒ√√¬¬¬¬¬ј¬√√јјјјњј√√Ѕ√√њљїЉЇЄґґґґііµ≤≤≥ґ≥≤ѓђЂ™Ѓ®°°ЭЬШФФИЕz}eDzc}tЕКПЪС®ЗЩРДzrgbXEIHA5??9621.$,*(%')'$")%$&(###&'(+*.+*.,,,/./.1/1/,/.++.,0/-,..*(*+.+,+.+./.'//2/22/.2////.//-.1130++./.,-/--+,,**...,,..,,..++.*../.,..',*0-++,)(****(*$()*'(*,**-*((,*)*..(*)*)&)*(((('&))''('&&&))&&&&)*+''%(*+('''&""!&#$$&#)*'$$'%%(((%'$!'&.'''&&&%"$&&&&&&&*'%'%#''''&''#''&&)*'#%''''%&&'+'%"'+&&&&&&(&%%%&%&&&&)&&&)&&)44>77630--%&'))&'**++'-254129?A^xЯљЋ“””‘‘’’’÷„„ЎЎўўЏџџџ№№Ёёёяяаабввгдддеежззиййкллммноопррсттуууфххццччшшщщщъъыыыыььь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘‘”““——––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФФУТТСРРРПООНННМЛЧҐ®≠∞ҐЭУwnhb[LC:CD:79;617?C1?PNG`qw~МРТРШЫВКИШНХКИЙxИМОПЦЧЧЭ§ЂЂµ≤™ІЗУ©Ђ±±ііЇЈЇїЉЉЅјјјјњљњƒјјњјљјњƒјјј√ЉєєЇЈїљ≥«быоЅѓЈ±Ѓ™©≠ЂЂ®ЂЂѓ∞∞≥ЈЈµґґїЉЉњЉ∆љµ≤≤≤µ≤≤≤≤њљѓЬЬПЯУ£•¶Ѓ≥ЈЅљљЈљЉљљЉЉјЅ√јј∆ƒƒƒƒƒЅ√ƒ√≈∆√ƒ≈≈…ƒ∆√њј√√√¬√¬√¬јјњњ√ƒƒƒћ√√љЉЇЈЄЇЄљЇЄЈЈ≥ЈґЈЈ≥≥≥ѓ≤≥≤ѓѓ≠™•£†ЬШХХКxЕzАphЗПЗСДПФЗСР{Шje`VSPJFC?95558.,+))'%&'" #'',))()),*++,)(,,./.6/--5-/0.,..**..5..,5....+..//22//6/....1..07/11.-//.....-..***.3/..2-+..+),/,//1./1.*.,0-+-*))+,,)+*(****/+,*(+))*++*(++***,**)*&&&,'')'''''')&)&&&&&&).'''((++&*.&"!&#&%&&)&*)(&'&#$'((%'&'''+*(''&&%%$&&&)&''''%%%''''''%%'''''''%''&''&)'))&""''&&')&$&%%,%(%%&-&)&&$&&&&"0;?]GM>715'&&&&((1)'')+..0.1455:ELcoНІїЋ““”‘‘‘’’÷„„ЎЎўўЏџџ№№Ёёёёяаабввгддеежззиййкллммнопррсттуууфххццччшшщщщъъыыыыьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЩ¶≤≥±•ЯСЕo]URRLEID;7>?:/4;+3797AMWaq~З{КМХОТОКН|ЗЗГЗГО|ХК†ҐђІҐЯЙЩ••ЂЂЃѓЈґЈґЇЇјЉљЉЉЉЉЉјЉљјјљЉњ√ј√√√њљљљїЊ¬Ј”хюбіѓєіђ≠ЃЃЂ®¶¶¶ЂЂЂЂЃѓѓ±±ієЇЊљ√єЄґґґґµµґґЈЈ≤••ЬЮТЧЬФЬФЬ•ҐЫҐ™ѓ≥ЈЈЇЇљњ√√√Ѕ√Ѕ√јј√ƒƒƒ√Ѕ√√≈≈ƒ√јњЊ¬√√¬¬њ¬јјїњјƒ»≈≈…јјЇЄЈЄЄЄЄїґЄЈґґЈЈЈґ≥≥ґ≥Јґ≥≥≥≥≥Ѓ≠≠©І££†ЬХФСЗ}ЛА}ДtrДxЗБПЖЬШДС}}ure]WQJ;=;@4+520)/,))$$!###&$$!$%)&('($$((*+,5/-+1--.-*.-+...2,,*3,.,,,,,.,//..3.+,,.....3&//.-..-,.,,+..,,,,/---0++--)*,/.///../.,,).+*-*))*--),*&****/**(((''((*'*(+(+++**)'%%$)''''&&'(''(&&&&&&&'*%%%'$(+&(,%#"&$&$&&'&'''$''$$&%(#%&'&''('''%%%%%%'''%#%'& %$#%''%''%%%'%###'%''&'')+''&% !#&#&&'&&%%#)%%!%%)&&$$"$$&$$*47SSVL>42'%%$$&(-&&&')+*.%.011/322@GICUdМ≠√ќ“”‘‘‘’’÷„„ЎўўЏџџ№№Ёёёяааабввддеежззиййклммноопрсттуууфххцчччшщщщщъыыыыьь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЫ¶≠∞©ЩФГumg_NLOLKC?93)5*"&*03?HPU]dvБВИУЪЩОЙИВТЕМzСЖЬЮІ©ЇЯЩЩЩЩЬЯ¶©≥і≥≤≥≥ЇЈЇЇЇЇЉЇЉЇљљљљњњјј√√√њњњЅљЅ¬¬Ё€юЁ≠≥Єіѓ≤ѓѓђђЂ≠®ЂЂЂ®Ђ®ЂЃ±іЇєїїµЈєґґґґµїґїєЉґ±∞≠¶•Э†ЧЬПМЧФНЧЫЪ•ђЃ±≥ЈЉљњЉЉЅЉљљј√√ƒƒƒЅ√Ѕ√Ѕј√ЅЉњњ√¬јјњ¬ј√љ√Ѕ…«≈≈јљїЄЄЈЄЄЄЄЈЈґЈЈЈЇЈЇЈЇґЈЈЈЈґ≥іі≥≥≤±ЃѓЃЂЂ©§††ЭЪХСЖЛwАpxsj}vДЖПЙЧЙЛОЙКvqtqTPNMDEC?=;:62/))'%'&$!$'""%$$"$"!$'(**,,,+.-)-.*.-....1*+,3,'+,,++,+..../.+,+,.----&-/-,*.-+.,*+--++,,'--+-++-.**.5.///...,*,)+)+-+))+--&**&1,)(*)+()(*'"'))+(*'+++),))&%%&&&'(('**((&&$&&*'&''# #% '+(('%##&#"$&&'&&&&$''$$&&'##&''(('''' %%''%''%##$'&$%$#%'*%#'%%%&%" #%''')&'*+''%%!!##&&&''&%&#%%)!&%&&&$""""$&&&&04KQR]=5*$&&$%&&&&&''&)0"****+..&42-")+8J\yТЂїЋ—”‘‘’’÷„„ЎўўЏџџ№№ЁёёяаабввгдеежззийкллмноопрстсЎЧ•зххцчччшщщщъъыыыыь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччццххххххфффууууутттттссррррпппооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМНЬІѓѓ±°Рw}}tgZSI@E@;/<<84?568:=GRV`tММЗЕКМЯТТТЪЬ††ђ≤…ЯШППМПЧЬЮІђ™Ђ≠∞≥≥ґґґґЇЈЇЉЉЉљЉјј√√ј√√јјЅ¬Ѕ¬ƒЋж€щЏЃіїЈіµЈЈµ≥≥≥≥Ѓ∞ѓЃЃђЃ≤іґЉЈєЇ≥ЈЈ≥ґ≥і≤їґЉєјєґґґ≥≤±Ђ©ђ•†¶¶•°ЩСЩЮЬҐ°•™ѓ≤≤≥ЉЄЈЉљјЅ√ƒƒ√√Ѕ√ј√√√јњњЅњјњƒ∆≈ƒ≈≈ЅЋ≈ЅјљїЇЄЇЇЄЈЇЇЇЇЇЈЇЉЉЇєєљїїєЉЈЈЈґґґЈЈ≥≤≥≥≤≤ѓђ™ђ™®•ЯЬЬФРКАbxh{wА{ВВФИЭЗИШШД{|tk]UVfTOE:7332./,('),)')%"!"!!$$$''''(**+&-0-000...2,,.6/$..,*++-0.+.......1.0-/,.2.+(.---.,./.++-0%++-+++-/,,/6//.0-,+('*))+--+''+-+"*,,4,***))*()-' ')*++*)*)*(*++'&%&*('-**(*,)*(&&*+-(+'% '%$'(*('&%%'% &&''&&&$"&&'''))%%(((++(&'' '''''''&%$&'&%'''%'+' '%%"%$""''&)**)&'*'&&&&#''((')+)(&%&&,&(&&&%%%$"$&&)&,)4GBuMC?(%)%&&&))(&)"(/&()))**,,--0044.11@MU]xНЫєћ””‘‘’’÷„ЎўўЏџџ№№Ёёяаабввддеежзиййллмноопм≈ЛMPяхххцччшшщщщъыыыыь€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшччччччцццххххххффууууууттттсссррррппоооооннммммллллккйййииззззжеееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§££ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМР†™∞≥≠ЮПvsii`WUOJF6=?:8806)'"&)===7-<.A>GGT_qВТ†ѓјЄ≠¶ҐШОНЛЗoЗМЗДИКНЦШЪ°†•™≤Љі≤іЉґґЈЉЇЉЉЇЉљЉЇљЅЊƒ√–ж€ЏќЊјљљїЉљЉєЉЉїЄЈЈі≥Ј≤±≤іЈєЈњЄґ≤¶™¶¶™ЃЄЃЃЃѓ≤±≥µµґґЈґЅ∆Ќап∆ґ≤≠Ђ©°†ЬЪЩОЩЖШИЮЩҐ™ѓ≤Їљ√ƒЅЉЉљљјј√√ƒƒ»ƒ√ƒ„ јЉ≥ЇЇЇљјјЇљЈЈЉЅЉЇЇƒЉЈЇЉЉЇЇїїїљїїїЇЉЉљЉљЇЈЇґґЈґґ≥≥≥≥±ѓ≤ѓѓѓЃ©®µҐЬЧУРРИЖ{lslsДДУђЬРМГМСС€ГВubb^UNJCA=;9863-,")')'""""$%$&$$''+)++-,,-=../:351/-.-/09..,#,+.0.-0/-,++,,,..--....///..--+-././/6/,,&,)+3,---+**,.700+')++-+-,%---.-6+**,,')2+++1+)*())*1,,*((&'+,,,*./,.**,..---,,,('')E.,((&&'+)*('''$&""&-)'))%%('(&''%&)7&&''*+/()('''''%'%'''''%'&-&$&&&&(%&))&'''6''(+++-+'((##&(&%&)%&(-&&&)&&&$&(,/37Gu[Ь;)&$0%%%(%(&&)()&&),)%()(')++'--.2377>>BD@sЗЦ©≈”÷’÷„„ЎўЏџџ№Ёёёаабвгдееззййк÷†jA '3) #ќуфххцчччшщщщъыыыы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццхххххфффууууутттттссрррррппоооонннммммлллккййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТТСРРПОООННММУ£ѓµіЂҐЧЙ}naWTKEA;0:700-,,,,)& %%'"%%%&&&-'%'&*.,,,,.2/.-.//0100.0.8/3-,++/.01.//1/-.5./.,*,.//..,,+.,,),-*--,.&,/,)-.-+)2+-+--..,-.--,.,.//.+)&%&'%-.0-*)++,-*+')****,*,.,(**))+))),+*(*,*,)'&.))'&''''(/$&&-&(&&!('''&'$$$%(&&&&'''('**&&&&*%%''''%##%&$&&&&&$($"&&)**('&%&)))''''&&"&&&&&&-$)-))&&$$&$"&&(#&-0-Z.' !%&(((&$&)&%(%%%%))&'''*&&&"&)*-''/*+.6AJIdtРЯЈ«”ЎўЏџ№№Ёёяабвд„ЭR'%$" …туфххццччшщщщъыыы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПОООННМЛЦ§≤µЈ™ЯШК{ofZFHNGCDC>3=<983C:<9KXlv~yЙЛЦЮПЩИНЙК~ГЖБЛЛЛГТОШФЬЮЯ£¶®ђѓЈґґЈЈЉЉЇґµґЇљјЉљљљљњїЈґ•≤ѓ®ґЄЄїЇїЇїЈ≤ЇЈЈµµ≥≥∞Ѓ¶≥Ѓђ¶ЂЂђ≠≠≤≤≤ї№€ю—Ї™≥ѓђђµ∞±ііі≤≤ѓѓЃђ•¶•ҐЩЮЧЮЫТЯФ££≤≥љњ≈ЅЈјђ≤≥ґЈЇїњ√≈√єљїЅјЉЉљљљљљјљЉјљЊЊљљљљњљїєїљљљїєєєЈЇєєЉєґЈґ≥≥ЈЇЉґґ≥≤≤≤≤∞±ђђђ®®§ҐЬШЫЧУПНССТ§Хy`zn}|АЖФРШУХУЕУНЕ}xkd]UOBFC<778740+('*)' &'& &$)$ #%(****.0////104431-11503...//11202252015.1/121/1100,.,0//.1/-////+.1-++..--2)..../.,,.,,,/./120..))))'.....----,--+++***))*+,*(&')+'))*.../...+)).-+&')+'),/&(&,((&&%'!(***&'(*,***#(*)*'(&&&&)&&)''&%%#$&&&*)&&%%%#&))+-**'&%'''&&&'%&"$$&$&&*$")*&)&&$$&&"&''#**)(6T1' ##%&&)&&&&))(((*--)''')&&&%)***)&-**-28969?>K[]fАЮЅ”Џџ№Ёёяя«ПG4' # $√тууфххцччшшщщъъыы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПООНННМЛЦ•ђ≤≥¶ЮУГwvf]ZVOJG?>&6D@AKMPhn{ЖЛРШГЧЛЛХНООТТРНМДОМКПРХПЮҐҐ°•™≠≠≤≥ЄЈґЇЈґє≠≥ѓ•≥ґґЊЈЇЇЉњЉєЉЉЉєєЇљљґЇЇЇЄЄґЈЄґ≥≥≤≥≤≤ЄќплвЉЂ¶™¶§Ґ©™™©≠≠±ѓ±±Їґµ≤Јµ≤±≤±±≤ЂҐЧҐ£•°ђ≥Є№≤ђЭ°ЃЉѓµЈјЉјєЈєїЇЈЈЉЈєєљљЉЉЊљљїїљЉљљљїїјЇїєєЇїЇЉЇЉЉЇЈЈЈґґґєєЇґґ≥≥ґµґµ≤≤≤≠≠©§§£§ІІ®•І••°ЭЪХМИ}izky_{|wzt~ДТТСНЂФЬФЙАzzsgc]WPHEG>;:6442/,,*(%&''%#''##'**+)')'.511110.01.0/616121211.@1.***/12251/.,+/011200.004*+.:0.-0,++5-4.,.//../..-50)-.+*,-+-++--.....-+)(*++(*((,.,,**''')(''),,,1,,++-++..6))+-+')*(&$&%$&*+)')'(*/&(&(&&*))+)'&&((&"&&'&&''&&%&&&-&$$"$&&&&&&)&4'&&'&'''))''%$%,&&$&$$(&$&&-&&)-&&%''%'''&&&&& &$&&&"%'0++(%&&)-)#'&%)()))&&&&&*&))'))+.+)044551ZЯ≤∆КL4  %Юзµ$∞сттуфххцччшшщщъыы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууууттттсссррррпппооооннммммллллккййййиззззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕѕќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЪІ≠≤≠§ФААwph]HLLHD>/<(81'&+'4@P]eozЗЙЮТХХХЧЧУМОЛЙ{}ЖmzКЖ|УЩЭ†•ђѓѓ±Ј≠≠•Цѓђ≥ґґґЈЈЄЈЉЉЉЈїїЉґєЇљјЉљЉљЉЉЉЉЇЈґґґЈЇЃЉ“ьшўҐЂ°¶§Ґ†Ґ•ІЯ££©©Ђђ≤ѓ≥≤ґґґЄґЈЉ√≥ЃІ≠Ђ•¶Ґѓ≥ѓЂ°yБЖШ°§ђ≤ЈЈґґіЈЈЈЈЈЈЈЈїЉїЈЉїїЄїљљљљљїїїЇЉЇєљЉЉЉЇЇЇЈґґґґґґЈЈЉЈЈґґЈ≤Їґ≤≤ђђ©£•££§®©Ђ™™ђђ™І•†ЬЪЦХЛКЖБ}|kuOragq}ЗЛЩШЫРПЛУУАД}tfbTJGHIFB?:942/-&***((&'! &&$&$%''*,.010..//./.1.1/000/0 /--))%-.222/.....//+.0..--,%(,00.+.))$+),,,,./../--)..-+-((*+)+))+,,,,.,+)'%(()&&'',,**('((''''&)+*****))++)+-*&()+)&')&%$#%%*-+''&&(%%&!%$%''')(% )('% &'#&&%%%&%&*'&%%"""&&&$&#%'&&$&%'))(('&%%(((&"&""&$$$$$&))&&%''#'%'&&$""&)))%%&&&&&&&%'%(((&&$$"$%%'&$&))&&))&..2'(.    ^лпэFѓрстууфххцччшщщъъы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттсссррррпппооооннммммллллккййййиззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРППООНННМНЫ•ђ≤∞ЯФ}vqmdYNTOGC5%9;:'A)))FWbqzЙПЧЫЭ£™ЧЯЧТНvККЖxЖqГЙНССМ°®ђђ®Щ°КҐЄѓЄґґґЈЈЄЈЉЉњїїЉ√ЉЉЉјЉїЉљљЉљјљљЉґЄЄЇјЈЇбюр–Ђ±ЃЃЂ™¶Ю¶••©Ђ•Ђ¶™ЃЃЃЃ≤≥≤ґЉљ“їЇі∞≥≥ѓѓ≤≤≤±Ѓ•†ЪШtЩСЬЯ£¶Іђ≠ѓ∞≥≥ЈЈЈЈЈєїїєїљїЇљЊЊЊјїљјљљЇЇЉљЉЉЉЇЇґЈЈЈЈЈєїЇљњљѓЉјЇњ≥≤≠°©ІІЂЂ©Ђ≠ѓ±±±±±±±ЂІ¶§§§ЮЪЩХХРНЖАrm[{[{gjrАЖЖИКЫЛУКЯШН|wtri_YUMIC>?<86512..,''$&&'#%%&'*....+.+.////./.11181310-,-,.111//1.////000.00//,*.00.010.,-**.,.21,-.0-..,-,-,,,----+-,.,/4-)(&(,,-'''(**,,*!,,,))+)+++-+)+)'++-,,(((*+)')***%%%()**+)'*((&*(*(&))+-+&& ')')'')'%&&&%&&*1,&((%&$(&&&(&&'*))&(&'*(*('&%%(%%%&&$$&&$"$%()-&$&'&"%#&&$$$*" "$&'))))%&&&)&%%''%(%()%#%%%&$&&)&)&))+8..+$  Юс€чЕ®ррттууххцччшщщщъы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМО†ЃЈґ≤ђЯЖГzra]SJHHE@D>;;:B,31@MU]o}Й•©ЃЩ≠Ч°ЮЦРОЖИИАКmРЩ†ї®ТЮЬЬ£©©≠ѓѓ≥≥ґґґґєЉїєїњњЉњњЉЉљјЉјЅЅљјјЉљљјƒ≥ƒъюиЋЂєЈ≥±ѓЃЂЃЂҐЂ™Ђ™ђ¶¶¶¶™≤≤µЇЈљƒЄїЄЈїіµґµµ±µµѓ≠©ҐЩЫЧЩЧЖЩТЬУЬҐ£І≠∞≥ґґЈЇєїєЉЇЉљЊљјјљјјљЉїљљјљљљЉЉЉїєєїљїљњ√√«ј ЉґЈ≤≤™©©Ђ©≠±ѓ≤≤±≤±µґ≤±≤±ЃЃ≠≤≠ЂІ≠ІІ£ЯЫШФФЗИБАwlaUsZxДДЛСЫІХЬСШЫЭЙ}yne[TKKJFAA<962/,,*(++)%'''&'(*+./+++.//.//01250100/-00-0011351001221.001000.021/25111/..01001,*03220,,*..+),//.1..//12..-*,.,.*+-,.,./,,11/-,+'++-..++'+..--,-**,+++++++&((((&%&'),**(*(*,-+-++.0+-'(*&*,'-*&**((((((,-((($&%(&&&)))+**-*(&'+.,++&%&'(%%%&$$$&(&)%((%)%&&&&""#'&&&$%&&"$&  "&&&(())(),())&&%')))),)%()%))((**-),*-**-**&   %≥€ьэ]£ррсттуфххцччшщщъы€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§££ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООННММРЯђ∞µ±™ЫМ~iddZUQRMFFG=::8CAKCLSlxЗЛ†І±іЂ£Т•СШССМШЭШЈўљ™ЙШШЧШЫЯҐ©Ј≥Ѓѓѓ≥Ѕµµєјїїї√їєєЉљјљ√љјљјј«ЅЅµќю€ёƒіЄЄЈµ±≤±±±Ѓ±ѓ≥ЂЂ™¶ђ•Ѓ≥≤ЈЇ≥ЇЉЇљЄґ∞≤ѓ≤µµ±Їґґ≤µѓѓ™¶¶•°°ЮЮШТЩИЬ°•¶™ІѓґЇЅј√ЈєЇЉїљљїљЉЉЉЉљЉљЉЉЉљљљљєљїјЉњјЅ»√ЊЅЈґґ≥≤≠Ђђ≥ђ±≤±≤≤≤≥≥Їµ≤≥µ≤±≤≤≤±ѓІ≠Ђ™™®І££ЭШФФОЛЖАw{os{iwnА{ЛЙСШФЭЩҐПЩЕИ{xqngb[UKGEC@;84/2/.-++(((((*),*)!*..+++.+/1/.03.)08.0010337111521///101.-1@1/270001//1=0.0--81710-/*/.*,/00.4/.../4.0,(+,,1,,+,,*,1../1/.-,*0--.5-2*,..+,+7+++-++--,*(*((*(%')++++1*!(++-.-*+----+,((*,***8*$(((&&&*&(/&&&,&'(+)&)++4,*'*-.-((%%%)3'%'(&&&&%((%%%%(%&&3&"$$$$$)$$$$""&) )%(%&')&)*-,)&&&)****))(((((-(+)),())*))*)1"  ћф€ЎE Ъоррстууфхцччшщщщъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооооннммммллллккйййииззззжеееедддггвввббаааяёёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММС†ђ≥µ∞®ЫПАrmk^WTPIE?@@B88=9M@LUipЛНУНЭЩЫ≠Ъ®ЮҐҐЇ÷’©zЖzГ{ДГМТЮЬЫЭЮ•ѓ™≠±µ±ііїµµґЈЇЉЉљЇЉЉљљƒЅЅЉ’€ю÷љЄєЄЄЈµґµµµ≥µ≥µЃѓЂ™Ѓђ≥µµЈЇґЈЇіЈЃЃ•©ђЃЂђђґ≤≥ґЈґґґґЈЉ«Ї≥Ѓ°ЧЫОПЦУЩБЧЮЮЬ™≤≥∞≥≥ЈЈЇЇЈЇЇЇЇЇЉЇЉЈЇЉїЉїЉЇљјЅј≈ЊЉјЇЄЈ≤≠≤ѓѓѓ≠ђ≤ђ±±ѓ±≥≥≥≥Јѓ≥±≤ѓЃѓ±ѓ±±™ѓЂЂЂ™™®®І£ЬЭЭЬЫШУНЙБtulml^whБВПНЫХЬЧХФРЬЫЧЙ~m_][UOFB=5985531/.+**#%((%!'('''(('(***-0,)15...0.00301011/////00*-/9+./4,//1..08.-0-.5.4..*-)-**,///.1/..,.1.-,()+)/**-+*),/*,./,--+).++-0+0***,)*&0)))+)*+++)'(&(*($'')))+0)"''%**,((**'+++(&&(%(*3*%&((&(''&&-&&')"'))'''))0*++-.-)''%!&)0''%'%%&$%%%%%%%%%&%-&$$"$" "$$)$%%%#" '"&)+(&&&%(()))((%%&&%)%'"%&&&&&&"&"'   ∞тгШ0Оопрсттуфххцччшщщъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооонннммммллллкййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТССРРПОООННММУҐ™±µ™ҐЩЛ|lgYQHFKE@884B2049?HX_v{ЗТ™Щ®•¶Ђ≤Є≈ђБus|tqwn}zЕЗИЗУЧЫЮ°Ґ§©≠ЃЃ±≥≤ііЈЄЄЇЇЉЉјЅ√√Џьп–іїїЄЄЄЄЈґЈµµµ≥≥ѓЃЃЂЃѓґѓ≥ЈЇЈЈґ≤ѓђҐЮ¶§®®¶¶≠Ѓђѓ≥≥ґЄїј≈ак≈ЄђІ£ЯТЯТШ}СУОМЙЪТҐ•¶≠∞≤≥ґґЇЈЈЈЇєЉЇЇїЈљЉљЉј≈Њљ≈ґЄ≥ґі≥≠ђѓѓ≤≤ѓѓѓЃ≠±±ѓ≥ґ±≥іѓґ≤іѓЃЃѓѓ≠≤±ѓ≠ѓ≠ЂЂЂЂЂ®••®®І§†ЬШЦФЛЖГvy_u_e}uЕВМДРРУФ¶®¶†ХДuwqnf\VQFDFFB>:9531/'$*(( %'##'$$$$$'*+)*0.*'--,..000../'///.00*./1*/04,/./-.01.-0)..-.--***,,,,///-.//,--.-,,*++(&**--+),1**..+,,*)+)++)))(((*&(%))&(*(**++''&&(*($'')'&++'&))%*(*('((&)+(((&&$(*,*&&(*-*(')&'&&&""')'''')'+)')+-+'''%#%))''$%%&&%%%%'%'%###%%%%$"" "$$&$" !#%#! )"&''%%&&%(%)(%%(%%%%%%%% "%%%!&&" Y«ЯUКнопрстууххцччшщщъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТССРРПОООННМЛХ£ђ≥Ј™†М|mkm\UMELLI;C=D6<@@=6,3//#+)'''$#$""#((((**)"**.-01110./"..--.0.011/03730/.*-.01.0'-.1./../.-,,*-01//11-*-.0-/-,,+%*--0.-/5/.12/..+..,))()')(***(*)+%****+))''&''))&')))%)+)'+,*,,,**,)+)+(**)%%))))'')+0,,+-))''' &''&'))*))'%''+)))'$''%%''%'*)'&(&')')(%%%#%&&&(&&$&$&$&&"!%%%%#&-&&&'%%((%%%%%%%(%###&%(($!%%%&)""   !3I) Нмопрсттуфххччшщщъ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПОООННМЛШ®≥ієЃ®РПЕxjf`XGJDC@E^hr}ЗЦЫЬУУОЛЛГГ~~}|vrr}j{ДЗЖПТЩЭ†°•£®Ѓ∞ґґЄ≥ЄЇљ√»”«√јЉљЉЇљЉЇЇЇЄЈЈµµѓЃђ¶™≠ѓѓґґ≤≥≤≥ѓ≠ђ©ђ©¶¶§££І©•Ь©ѓ∞≥Ј≥ €€зЇЇЈіЃ≠Ѓ≠Ѓ≠≠≠©§°ЩЧОЦЕУВНТЧЯ°ђ≠≤іґЈїЉЉ√ƒ∆”ј≈Є≥Ј≥≤≥≥≥≥≥±≥≥≥µґµµµµ≥µµ±ґ≥ґґґґЈ≥іі≥≥≥≥±±±±≥≥≥≥∞ѓ±≥±±ѓѓ≤≤≤≤±Ђ≠≠©•Ґ°•†ЬЩШЪОИБqxcu]~tМ†±„§ЙСЫЧЫ£§ЫФНБ}upe^GPPKEC>=:96/,,*(''' "#'''(*'''*.*--...//1./.,*/0/011/10333/++*.1331../622211//*,)/041121+**.0/0/,,,,--,10..11/22110*80--,*','+*,,*,+.+.,,,,++)++'&))''')++))')+,*(..,,..-'-,*++)%''''+')*,*,-,**()))''))')***)&&&'))+)'%,%$$%%%)-+))*(()')+(,&'%%&&(+*-&$$$$(%&(%#%%%%%%(%%%,%%'*%%)(%%#%#(%(%%%%(()(%##%%#&)"    Чмнопрстууххцччшщщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПООНННМЛЩ©ЃіЈ™ЫИИАp[RKI>IG:,EEH=A9I[iНШ§ЯЬ°ҐЖЫЖЪИБАi}}|fyyy`ВЕНОСФШЬ•ЂЃ≥ґѓ≥≥ґЉљЉЇЇЇЄ√ЄЈЇљЉЉЇЉЇљµЃ™Я©ЩЃ≤≥ґґґЈЈЈЈ≥≤ѓЃѓЃЃЃђ®І©©І••©≠∞ІЂќ€€÷ЄЈі≠≠І™Ѓѓѓ≥ѓѓЃђ¶¶ҐҐ°ЩЧЖЧВФvЫЫ°§••ѓЈґѕ√ЌїіЂШ∞≥ґЄЈЈґµ≥≥µЈµЈµ≥µ≥≥±≥≥µљЈЈґЈґґґґґііі≥≥±≥±≥≥∞≥∞∞∞∞≥≤Ѓѓ≥≥≥≥≥∞≤ѓЃ™І©ї©•ҐЮЮЬЩ§ФСМЖЖyБ_ЩµЈљaГЛСУЫЬЬССОХЩХСРtpk`XQCIGEA963//.+"'*'%$'''&$&'&&''&(*.+*,.)(-///06/..112/+++.113101,//11/,..-.,51<0.16-,,*.,/--,-/,,.C0+..../1/.*.5.0..,5,.../,*-*,,.,,,.,..6+")+++'))0))'&'))")0)'+A- '1(*+0'+)'+3)%&(*--.**((+0'')2-*,***&&'+)++))()+'%$%')''''&&')()*(('%'&)'''))&&-"##/&%%&&&((%((0%((7(()3(%(,%%(%%6()%(%(%%(%%#%(&#&-"&  b®ммопрстууфхцччшщщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЪ¶±Їґ≠ҐУДdhh`QNIC6658(>/3+;GWbt}}БНЮЛ°ЦМЕВ~|{rauaxo}suxЙОРУШЬЯ•ЂЃѓ∞∞≥≥≤Ј≤іґЄЄЄЄЄїіѓІЮ¶™™≤≥≥ЈЈЇЇЇЈєЈЈµ≥≥≤≤≤≤Ѓђ©≠І£¶І©∞∞І“€чѕ®£Ѓ¶•ЯҐ•©©ЃЃЃѓ±ѓѓ≠™©•ҐЯЮЩШСТТАСxУЛ°Ђ≤≥іђЂФ§≠ѓ∞ЈљЈЈЈґµµµµ≥і≥≥≥≥≥∞±≥ґ≥µµґґґґґіґ≥≤ѓ≥ѓѓѓ≤≤∞≤ѓ≠≠≠ѓ≤ѓѓ±≥≥±±ЃѓЃЂ™ІІѓЂЂ©І•§°¶†Э†ЬЬХТМТШШІ?o`u^tДЗОТФЮШЬШ®СЮТЕ|pg`ZUMAC==:961..*''&'&%" " #$''')(&(),,--0%-0-+/++./.111/01/.....-*,,,,001*./1+..***------#**1++++*/..+++),/-----.'.0.-)&&%'(*(*(.(+,/(')+')''$*&(&%%')'&+&&&.'&'(%&%)%)+)'+'&%&')(*'(&&'+&'$,-,,)))%%%)+-++((&(('$%$$$%%%$'#'(('($%$%)'')&&($$#!!%%%%%###%#'%)%%%)%%%(%%,)&)&%%%(%%%%' %(%%%%# %2_Ъљкмнопрттуфххччшщщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффуууууутттттссррррпппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘‘”““——––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЪІѓµ≠™ҐП|qnk\RI?67:>:@D1LVШЄћџаеезийлмнопрттуфхцччшщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММС†ђµє±ЂТХЛxchcVDKMH9?:65?PNVZhq{ТђБХК§ЛЖСЙОЕБ~|txjot|~ТЪ™ґ™ОЯЯЫµЯЯ£™≠ѓ≤±≥єЈљєЈєєЈЇЇЉЇЈєЇљЄЇїЇЄЄЄЄљљЈйюр”∞£®©©ІІ•¶¶•§¶®¶¶§†°§°°©ђ±µєјЉƒЈЃµљѓЂ®©©•¶†ЮФТОТУСХУХУЯҐ£¶Є≠∞ѓ∞≥Јµіґµ≥µµЈіі≥∞≥≥≥≥ЈЈіЈЈЈіЈ≥∞≥≤ѓ±≥µЈєєґґµЇ≤ѓі©©™®•®ђђђ™™®ђ™ЂђЃЃЂ™™™¶••§£§ЬЬЫШШТРЛЗtЕtЕtwxtМБВИЛСОС†ФФФХШЫЙ|wpg\YVPMID>=663).,,*#$'"#"!"%'-'&''*++**//01.1....6.00........433/+.-.500,,*/.----.-0.-.00..---*',4////---/--,,)**/-6.-**-*)*,-*),,*-.0)'&+(,,-&),3)*()&)*(')*(,')-)-+)+))*(*(&&(**))'"&'++)+)')))4---+&&&%%&')))%%$$'**,)+')''''$%$'  0!#%(%%&&)2+)).)'&((%&&&%#(%,)((%''((%%$   +?НЂљ“џёавгежзйклмопрстуфххччшщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТССРРПОООННМЛУ§Ђ≤µ≠§СБpph_RJ95/.'(&($###&# $'$'*''(,.0...+.+.)020.....*.453/.+/-0..****.+)+*-*.---00....,,,,/---//---,,))()&+++++*)*)&)**))*.**-*#'))()),!,,,()&(!&)&(),***'*'))+)'*(&(&%%&*)))(%&'))')''+)'+)'+)&%&&%%))''#$$%',,,&'$%%%$$#%$# " %#%%%%&)+)''++'&%%%"#!!%%),)&&&%%(%%"  $kЪ»жбЁџ№ёябвдезийлмнорстууххцчшщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооонннммммллллкййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПОООННМЛХҐЂ±µ≠Ы{Д~xjg]J-:H@9D2I6:8NZeu}З°ѓ¶ЯМУЙЖu}}ХЩ©∆ЉЎСv{vЖКОСУЩЭ§§¶®ђЃ±≥≥µ≥ЈЈЈЈЈєЈЄЈїЄЇїљїЈЄю€яѕЊљ∞≥ѓЃѓѓѓ±ѓЃђ®©¶•§••®®≤≈ЈґєЈЄЄіі≤ѓђђ©ђ¶©¶•¶©•©¶¶™™ЮМЗЖОlННПrГПТЙЩ†••ђЃЃЈѓ≥≥∞∞≥≥±±±≥≥≥±≥≥іЈ≥∞µґ≥µЈЂњЌјЅЇґ≤°®®®®™®™™ђђђ≠™™ЂЂЃЃѓ≠≠ѓѓµ≠ЂЃЂ≠≠™•§§¶¶§§°††£Ю†ШППРАaa`{H{f}ВЙЛПЛЛТТЮТЦКМЙЗМУxcfc]VJ9>=655855.**&'$$$'#!%#$#''+-***++..00022...$044545192000......*+...+...113330,,./---///-//,,----,/,*--,+..*...++.700.*)'),,,,--//.+,,-,---,,,--.,,)',,*')-,**))'(&()''())+,)++++-))'&$%%$$&(&%%'''),**()% ')''%'%$*$ *$%%&&)))&&)'''((($%%#%%&&))&%##%(%%"  3e№ва„’„ўџЁёавдежийлмнопрттуфхцчшщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннмммммлллккййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЯЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПООНННМЛШ™≥Їј±®ЧМАpkfUMHJHD8=5D,5AHPhs}АРХП¶НСТЭ°≠±Њ«}eq_q\pz~oЗОХЪЮ†Ґ®ЃЃѓѓ±µµµµЈЈЈЈїїїїЊ¬Єќ€эЏ¬Єї±≥µ≥≥µµµµ≥±ѓѓЃЃђЃЃє±ґєґєєЈґ≥•Ѓ©¶§§°§°§®•ђЃђЃіЈј№ш”≠•ЫСТПКЕВЕВВЕПЖУЩЮҐ•І™≠ЃЈ≥ґ≥±µµ≥µµ≥≥≥µµµєїЈЉњЉЌ≈ЇґСѓ≠ђђђ≠ђ≠™ђ™™Ђ≠≠ЃЃ±ѓ±±≥ѓ≠≠≠ѓѓѓ±≠≠ЃЃ≠™Ђђђђђ≤ЂЂЃђ™§ҐЯШХРНТС|p]zrzh~БИПТЬХШЫіЫ§ЫТЦ•ЙzmbXMODGGDC><52.&*'&'($&$$$&$'$$&&'*-0.-.20.22.222211122120.2..1.&./20.11.455442.'085316((((& &$$$(#'*+-+-..-5.100001...1....>...1,1122.15014;100.)030080(-5/0/,,,,,,0)--,-+//../1/-.500..,..-,,)&--/.,//++'-/.,,-++,H)+,.*)--,..,**+-***--//-,)),)++-,**(&%$$$&&%%&&&''&&,(*(***(''.'%''&&') -''')+'%%'&&))&&&()()()%%%%##$3!!  Ґнѕ–“‘÷ЎЏџЁяавдезийлмоорстуфхцччш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРППООНННМНЭ™µїљ≤ЭХЙxunfWCL>DCIA1K?EEO_s~ЗОЪЮ°УКОВ{xwirhmhgndvs{wyИМУЪЮ°£•Ѓ™©Ѓѓѓ∞іїЄћ‘‘¬ієЈ≥≥≥ЈєєЇЇєµ≥±ѓЃЃђ¶©•Ђѓ≥±ґ≤ѓЃђ©¶ҐҐ°Ґ†°Ю†°Ґ°Ґ¶••Ј∆ьюЏ™ђ•Ґ°°°ЬІЧЧТТСРИСОСККРЕТСЧЫ°§™ЃЃ≤≤≤ѓ≥ЇЉїЋјї≈≤ЈЈ≥≤≤≠ѓЃ≠™™ЃѓѓЃ±Ѓ±ѓѓѓЃѓ±±ѓѓѓѓѓѓѓ≠≠ѓ≠≠Ђ≠Ѓ≠ЂЃ±≠≠ЂЃЃЃ≥±±ЃіЂ®•ђ•І°ЯЮЬХТЩНЖ~Вw{iex`БЗХ†Э”ЬНІФСХПСФФЕЗ|pbe]NUMC@>:?5//.'&'' $' #&%'''''',*.+-..5+++.+++.6.-+..2331112--04--.-*---.4-(,1*04-,,,))-,---../..,..+**.,,*,,,,,)*)&(,,+)-,)-&()(('(('(:((+,))***,,*))**)))-*,,-'&%)&'',,,(&&%$%%&&&'&%"$%%%*&(&(((&%%'$%%')(*-&"  "%'))'&-'%&&&&&&(()((%##%%#")    Sё÷ѕ—”’„ўџ№ёавдежийлмнорстууххччш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООННММОЯ®іЉ∞™†ШМ|ndVNMH2I54.1@JVR]kАГАЛРСС|ДuwvskmbpiridnvxhГИМРТЦЬЬҐҐ£¶ђ∞іїƒїЈііі≤≥≥ЈєєЇљє≥≥≤Ѓђ®°§°§≠ѓґѓѓЃѓЃђђ®¶¶§ҐҐ°†ҐҐ°Ю°¶Ђ¶ЈЌююѕЂђ©ҐҐ†°ҐѓЮЮЫЮЫЩЮЩЦУТНСБМЗЗНТЩЩ°°¶¶™Ѓ≤√њ«Ќ≤≥ђ¶≥≥і≤≤≤≤ѓѓЃЃѓѓ±ѓ≤ѓ±ѓѓѓЃѓ±ѓѓѓ≠ѓѓѓѓ≠ѓѓѓ≠™≠ЃЃ≠±≤≤ѓЂЃЃЃ±±ѓЃ±Ѓ®•®®®§§•§Ґ†¶ЬЪЩЬПЛ}rbББАЬЪѕКДМПХСФФШТЦЩЗЙЕ|gcaXTTKDDA:511/.(+((!!&&&%$$$$$&'('+**1***.++*+..-+1.222..10*)-1--00----.0--*.)12(---&(-,,--../..,+**+***,*.,,,))**))))&(***/*()((''(+(,(%+,*)*-,.,*))*)''*,)%)-))'''''+,((&(%%&%'&&)''&""$$%&&,(*(&&$! )%'))+*)+%    ''))'-'%%&&&&%&()((%%#%%#!!!   1±џќ–“‘÷ЎЏ№ёабгджзйкмнопртууххччш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффуууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘‘”““——––ѕѕќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶••§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММС†≠ґњє±°У~rgbbUME?OFI6:DN\P[kАЗХxО~ЕЖ}ЗxАxxxyltonMtvvxx{ЗПРЦЭ†£¶≠ѓѓ∞ЃЃ∞ѓ±µЈєєЇјґ∞ѓЃ¶••Ь•§≠±≥Ї≤≤±≤±ѓѓ≠≠ђ®¶®¶¶®¶¶¶•ђ±Ѓґ„юрЌ•ІҐҐ°ЮЫЮҐЮ††§§°™°ЮЯЬЬЪШСТНСМТНОССЦТҐђ√ї«љЫђЫђ≤≥ґµґ≤≤±≤ѓ±ѓѓѓѓ∞∞∞ѓ∞≤ѓѓ±ѓ±ѓѓѓ±±±±≤≤±ѓЂЂЃ≤Ѓ≤ііѓѓѓЃѓ≥≥±ѓ±ѓђ®®ђ©¶®ђђ©©©•ЂІІ°ЯЪЪЦТРРuТХНxuouА|ЕxЗНСТ°ФЫЫЫФЗЗywm\]WOJDB<:9830,),,+('&$!!$$&%'%%((('+**)++...201...+..-)-40011.....0.+*,*..$,,,%)*--.-00.--+-)----....*-,,,,.,,,-')*+----,,,,+,.,,)%,.,--/.0.,,*,***..*"*.,,*)**,,,())&&))''&),*(&&%&&&&(/,,,*($)$'(+%++.**! %'++)))&&)*(((&()))(%%%%%#!#  (Аћѕѕ“‘’„ўџЁяавдезйклмопрттуфхцчш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууууттттсссррррпппооооннммммллллккййййиззззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§££ҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТССРРПОООННМЛХ§∞ЄњµЂЧФЗ{eg`UFKIK3I$1>GJ_dkrДХА°КЦКККЖywnkmmdg`a`quyВВМТЧЬЮ°•£•ђЃѓ≥≥ЈЈЇЈ≥≠ІІ†§®Ђ≠≠±±≥ґґµіґЈµµ≥±≠ђѓ≠≠™≠©ђђЃЃ≥ЃЄжхё≈Ґ™Ю°°ЭЩЭЮ†°°••••®®®••§§§†ЩФФСРЛДЛqОЮҐЃЃ≥≤Ь£™ђ≤ґµµ±≤≤≤ЃѓЃЃ∞≤≤≤ѓ≤∞і∞∞≥±≥±±±≥±≤≥≥≥ѓѓ≠Ѓѓ±±≤≤≤ѓ±≥ѓѓµµ≥ѓѓѓЃЂ≠ЃђђђЃѓ≤ѓЃЃґ∞∞≠ђ™ѓ¶£ЬЬЩХХНАl{cxctUmВЖНРФЧ£Ы≠Ф°ЭХХШМ|wod[ULJECB>78:62/,+&&$$$ """$&&&'''*.+...0..,+++.02001-114..100..+'*(+.,...++....----..--,-/00000,(,,0..00../.++..//0-....//-/),.-,//1/0....00,.40,,,,,*,,..1,,(()((,))'&))/())(*(&((,,--,*% #%*)))+,*((*"'++)')'),,)))(&())%((%#%#%   (Q†џќ—”’„ўџ№ёавдезийлмопрстуфхцчш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттсссррррпппооооннммммллллккййййиззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПОООННМЛЦҐЃµїµЂЮКirwoh\WJ9M:QONBRX_frМОЦ°ҐБББМ}}zzubk]hhmdm]v|ВИМТЭЪЮҐ•ђђ≤∞∞ѓ™¶¶••®≠ЃЃ≤≤≤ґµґґґЈЈЈЈЈ≥±±є±≥±≤ѓ≤ѓ≥≥Ї∞іхь–Ј≥ѓҐ†ЮЪЪЮЮЮ°Ґ°°°°§°§•Ґ§§±§ЯЮЯЯЮЧСРЛЛНТБ°ЂЄќУПЫЮ£Єґ±ђѓЃѓЃЃЃЃ∞≥≥ґ≥≤≥Є≥∞∞Ѓ∞≥∞Ѓ≤ѓ≤≥≤≤≤≤ѓ±ѓЃ±≥ѓѓѓЈ±ѓѓµµ≥±ѓѓ±ЃЃ±Ѓ±ѓ≤≤ѓѓ≤≤≤≤±±ђђЂђІҐҐҐЯІЫҐСМЗДАmX|]}h}ЕЛЩУСЪ§ОСС•ОСПА}vrlbUWWOIGGB;:5/,,))'%$$ " #####'''*'+..3-+++.-00000425110-.1...+*'**+..0....0100-0---*--------*..50202.-//.+./..-,,0--,,.?0.***1010.+.,,.0,*-..0..*)*1,**)*(),)((&))(()4,-,(**&((&*,*,(&!$!((-%,)')(*3&!&))')+),,0)(()&%),))((%##)    !,.+Zе––“‘÷ЎЏ№ёавгежийлмнорстуфхцчш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛЩ™іЉЅіђЮСyn[XQUWH40+F3J3BGT^lsЗЛЙВВВВzztqnlkgdRhQj[[^sИСЭ°•≤£Т£ЯҐ••®ЂЃ≠ЃѓѓѓµґЈµ≥≥µ≥≥µµµµ≥ѓ≤≤≥≥≥≤≥≥ЈЂ ющї™†І†ЫЯЪЪЪЭЪЫЫЫЫЦЫЫЫЫЮЫ††®°£§™і∞∆ЫЧСССССС°≥љЖЕkК~ФЫЮЫ°•¶¶¶¶¶ЂЃѓ≤≤ѓЃ≥ЃЃЃЃЃ∞Ѓѓ≤ѓ≤≤≤ѓѓѓѓ±ѓѓѓ±≥ѓђѓѓЃЃѓ≥≥±ѓ≠∞Ѓ≤ґµЉµ≤≤Ѓ≤≥ґґ≤ѓ≠ЂђІ™§¶¶¶£§ҐЯЮШЫЩЧСНВВ|uhXwczYn}Б~ЖЛУЩФЩРСМООИГ|me\XRKGD>6884/,*)&'#  ##&$'*(+)---0...0.+002.0.--......++*-0..++-0----**(*-,,,(-%--+&..0..--+,./.,...,--)-*,***0-+*+*.*..,&*)*),)*,..0,*)%%)'*******,,,))(&(%)&((()($%&%%&%&$$%%$#$*&&&&*%$ "&&&()%())#%((%%)((%%%##!  ()+ѓЏѕ“‘’„ўџЁябвджзйлмнорстуфхцчч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФУУТТСРРРПООНННМЛЪ™ґљЇ∞§ШВqrd`WKKDI7,G4EBM8FPWbzvutxТАТБР}xuhm`mdЖЦҐ§ѓЦ•ЫЖЪТТХЪЮЯҐ¶¶©ЃЇ≥≤≥≥ЇґЈЈЈµ≥±µ≥ЈґЄЇЇЈјЇїо€зіІіѓ≠ђ®•§ҐҐҐЮ†§§†††††Э†°Юђє≠і±≠ґђ••ђЯЯЯҐҐ†°ҐЪССОТОУДЗy~ИДНИУУЬЬЮҐ••¶ЃІЂЂЂ≠∞∞∞≥≥≤≤ђ±ѓѓѓ±Ѓ≠Ѓѓѓѓ±≥±≥µєїїЉјЉЉњЉљЇЉЇЈЃґ≥≤Ѓђђђ©Ђ≠ЃЂЂ≠≠ђ¶¶•®™™™™І£§І§°ЫЩЩЩРЙЙpqzxj}j}rЖЗПМЦРЫЧПСМЗЕ}}}phc\\QLGC@>833/)-*))&*(' (&&&'%%''*,.+-.00.1/../---..42..)---------.11...5.112111.....0002-.242.243112221/../1/.-,,--,--04..00.1..,*,%),,1).,,.,,*)),*,**(((('())&,-,-*(*&%$$%'%%'%'''')(**&%&&(%(),,))+-'&%%)"#(,67Ь№–“‘÷Ўџ№ёавдезиклмопрттуххчч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооонннммммлллккййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООННММР†≠єњњЄЯЧК}uhjZEQCF07F1H4CQPQZauЛТЧzИ|ДЙБЗsЫ…Ї–Т`bbdcelmtjv|ЙПЧЧЫЮЯ§¶©¶ђЃђЃ±≥≥µ≥≤іЇјƒ‘юъ”•±Є≤∞≥≥±ѓѓѓЃђђ≠ђ¶™®§•ЭђЇ≠єЃ©©®••ҐЬЮЫЫЬЫЯЫЬ†ЯЯ§¶ЂµЉбај•ЯФУТОМЙИwВИНМДТУЧЫЬ°ѓІЂЂђ≠≠≠Ѓ±±Ѓ≠≠ЃѓѓѓґЇЇ∆ЇјЎƒ’љљЇЈЈЈґґ≤≤ѓµѓѓђ®®ђђђЃЃђ®ђђ©¶¶•¶¶¶®ІІЂ≤Ђ™¶ІІ•®©®§†ЮШШХТРЙЖ|uk|pszt~tАМ†УКК•Ь£І™МЗЧ≤≤uuqcRYUKHEC>8652)+(&'%"   '+,8.&(,,--&*-.111---7*---+*+.220.0412111.......+7.-)0000223241..0--.--...---1-000--..-..;)(),**+**---**,.,,-.---*#-''(7)+0,,)-,(&&%6  ' %%&,&&'&&)&)&&)*)))),)'')%%%$"! #%,/(!>љ„–”’„ўџЁябвджзйлмнорстуфхцч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§££ҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТССРРПОООННМЛХ•∞їњЄ≠£ФДwodILJ?5G1//46CQWhrwИШЗРЦЧ°ТДnXdX^P^XdBPWhso|ГМФЦЬЮҐ£¶ІЃЃђѓ±∞∞ЄЄљёзлћІЄЄі≤µµ≥±±±±±≠ЃЃ®™ђ®Ђ®ђ™≠≠Ђ•¶§ҐЯЬЫЫЩФЪЧЪЦЪЮЮЮ•™ЃЇЋ€м…Ґ™£ЯЮЧУООКИ~ЗЕЖ]ВЖЗЖЛТЦЪЮҐҐ¶¶®≠≠ЃЃ≠Ѓѓѓ≤ѓЉЇ√ўјЅјљњѓЇЇ≤≤≤ѓѓ•ђђђЃЃђ®®®®®ђђ®®ђ©ІІ•••¶§¶••ІЂ•І•ІІІ¶ђЃЂІ££††ЮЬЪХТРЙВ}hwarKoS]mszОЯЯҐҐЩЫЯ°кРРЙА|xhaXRPIE@C?<72*,(' %"  !&(+$#&)----,-.1.1.*-)*-,+''/+.0.04.0.........+#----,-.000.2.---+*---00.---1----&---***-&&(***.*')*+)**.,+--..,)&%&%)(((+((!,++&&$%# $%$)$$&%&(&&&&&-)((()''''&"%" #%),),%Жќ““‘„ўџ№ёавдезйклнорстуфхцч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘‘”““——––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПОООННМЛЧ®іЊњ™•ЭП|sad\VCE81.M+IWZ\acw†ЧТУМ~unnmmhffhcR_LaLhhnoxГТЦЬЯҐЯҐ•©ђѓЃЈєї э„¬єЄЈі≥µµ≥≥µµ≥±®±±ЃђђЃ®¶ђЪ®©©•©©І††Ц°ЮЮЫЫЮЪЪЫЫЮ¶ЃЮЈ—€ьј¶Ђ¶†ІЯ•ШШЩҐУУТОМВКВКrЛВМВОТФЮ°®§©©Ѓѓ≤≥ґЉ“њ“јЇЉЇЇЉЇЉ≥©ѓЃѓ±≠ђђ®ђѓЃђђђђҐђѓђ®ђЃђ•©©®®ђђ®®¶¶¶•І¶¶¶®≠±Ђ≠ЂЂІ§£££††ЬЪШТСОЙЗtlazowМАФђЩЪ°•§§ТЪРФМИЗАА|tje^XOID?;9731.-(&# !$!# "&'')**&))-)-...-+./...7.'..2.202./......+-----0/,000007.-/0-,--011---07-&--**------**--+*.-)#+-*-..,+-+++,)))),),,.,,+((2,+(+')''%+ %%0%$'&(,)&))-1)&&)&&''&&&&%%"!#%)//,)2§в“‘÷ЎЏ№ёавдезиклмопртуфхцч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµіі≥≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛЫ≠Їј∆Є≠ҐУИveg_WQC9L,I/10I\ijsБНЫyХz}zАpibd^]Y__N_Xg_f`v{ИФТЦЮ£©¶≠∞ЈЉ њЉі≥≤≥≥µµ≥±µµµµ±≥ѓЃђђђђѓ≥ђђђђЃѓЃђ®•Ґ®¶Ґ§ҐЮЫЮ°†У¶¶™Єб€мњ•©ІЯҐЯЮЫЬ••°°©Ю•ЧЦЦУОМКЖЖЖИvМКФЩЬҐ¶ђѓѕ¬ќ¬™љЮґЄЄЈЈ≤≤ЃђЃЃЃЃЃђђ®ђЃђЃђЃѓђЃЃЃђЃђ®ђђђђђЃЃѓђ©©ђ¶ђ®¶ђ≠≤≤±ЃЃ≠ђІ§££§£££І§ҐЯЯ§™ЫСЙЙДsАДЗМФЫЙmu}ЙНТУЮҐЧ£Ч±≠ІЬХЖztlbQOKE7>95,140+((&$&$& &&$&&&$&&)),-.10445224..2.5.21120..///.0300-13,,40...0-,-0--000000-0010-7---0.1.+.-01....-))-.+-.--,.,*..-,-,-,,+.,+(($,++#+,,++2+'#  %%',*,++--,--&&&&&&&'&&&&"##!#%(,,,3)6G÷””’„ўџЁябгджийлмопрттуххч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууууттттсссррррпппооооннммммллллккййййиззззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЭЂґЉЅЈЂЫФР{h_gQXC7;CRPWBOau}ДwЗЪС{szqylkgf]c__ZKFWPkrrizo{ws{svlge_]]KZG`XSOS\[fmzЗХ££§•†°ЯС°¶°ЃЂђЃѓ≤ѓѓ©≥≤Ѓ±±±ѓѓѓ±±±ѓЃѓ≤±ѓ±ЈѓЈль„¶°£•°ЫЧЧФЦЩЪЩЪЩЦЬЩЪЫЫЪЭ††°§•ђґ∞Њ«©•§ЯЬЬЩОЮІЫНВzОИВСЛСУЪ°•°Ґ§¶®®•¶ђ¶®ђђђ≠≠ЂЂ®•®®ђ®¶¶©±ђЃђІ©©Ѓђ®ЃЃ±≤Ѓ≠≠ІЃ±∞µіµµ∞іµ≥≥ѓ≤ЇѓЃђЂ©¶•§£§§§££†ЮЬЮХРПОЙ|hg]]А||Е|ТЙЙХЂЂ™Юіі≠¶СЧПЙЕ|]c]TOHB=9542+-)%%' $&""$$%#%&'''',**,----//720145541441..101.-.022)2.2..1..10..-%-+-++++++..--.-0,00-.,-**,-0,'---+.5--.-+.02--/0/0-0&$(((&'9#  " &)'''-&)))))&$####!!%((,,,,/3-)%\№‘‘„ўџЁябвджзйлмопртуухц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооооннммммллллкййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєЄЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§££ҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХХФФУТТССРРПОООННМЛХ©ії¬√і¶ЩЖyk_TPAL*I(9C:=\hgyuТВТ{{nlig`dcZKPDM>?BRqС®ЫЮЦН§°ЮЂЯЬ°§©©©ѓ≤ѓ≤ґѓђѓ±ѓЃѓѓ±±≥±±±≥≥≥µЉЃ щь…І°≠ІҐЬЬЬЬЪЫЫЫЬЩУЦЩЩЩЪЦЩЭЭ°••Ї«Їћї≤ЃЃЂ••ЯЬЩЮЩТ}ИЗИhВvЖЖ~ОУЩЪ†£•§§Ѓ¶¶©ђ©ђ®®®®®•®ђђ©¶©ЃђЃЃ©Ѓ≠ѓЃђЃЃ±≤±ѓ≤ІґЄЇјЇЄЄ≠ЇЇЈґ≤ѓЃЃђ©©¶©©•£ІІІ§™™•§§§£¶§ЮЫЯЫТСИЗЕgzTyX^g{НОЭ•ѓіЄҐєµііђЮЗpj]aNIABA?9500..(((###" # %'')'**+,,--000144514551110./1/1124444440..--122..+.)......-.0-+-*-,-000-0-*-0-,-..1/1100.-,-00/-0003-((+,+)),3.%  )&)%&&$&))&&%%%%%# #!%%(,,,,033-/ ©в‘÷ЎЏ№ёавдезйлмнорстухх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннмммммлллккййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛШ¶≤ЉЅЄѓЦНАqgfWUK=*PUU9U]lЛЗЙУЦrВuЙnnmf]XUQR7O>zНЂТЬuКЅµ†ЦММТЭђЮЮ§Ѓ©ђђђђѓЃѓЃЃЃ±±≥±≥±≥µєЈј±’ююї≠Ѓ≠©©££°£Я†††ЮЮЫЩЩЦЫЮЪУЭЪ®Ѓ≤ЌЄіі≥ѓ≠™©¶∞££†ЯЯЯЯ°ЬШРЕЖОИrЖ~ИЖИЛУ•ЭЪЮ°°Ґ•§§°•®•ђ®•©ђ©ҐђЃђЃђ•ІІ©ђђђѓ≤ЈґЄєєћЊ Їєґґ≤љґі∞ѓ™¶І©•®•®•°°•ІЂІЂІЂІІІЂІ®••§ѓ°ЭЭЬЩЧСМЙЕАsА\lxЗИЛСЦ≠Є√Я ЬѓііЂҐziaMSOLHB==;851--))($ ## %% #%%'&(),*,-.01141011/1100214224224451/.1--1333.))%.4...2.-.+-,,3,)--.+-+*0--**-.../..--.,)-4-&,--:(""&'0--.>,+%*  $$&$&$$&)%%%%#%%%!!!!#%),3,-0034"tƒ÷’„ў№ёавгезиклморстуфх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПООНННМЛЫЃЇƒ≈µђҐХИv[ONOC3*I*14DTadl{~vuКqmhaa^[`gСѕ»…СИtDHK^it{ГЙПУЪЭЮЯҐ§¶¶©≠ђ®Ѓѓѓѓѓѓ±≥≥≠Ї≥г€к∞≥∞Ђ®І£••І•§§ҐҐ†ЮЫЩЫЫЮЪ†§•Їѓ≤Ї≥ѓѓ≠І¶ҐЯЭ†ЮЮЮЮЬ°•®ђ≈г«©ҐУОЛЖВБs]ЖeЖЙОТЦЪЮ¶†°°†§¶•¶©Ѓ©Ѓ®¶®®¶†¶¶¶§≠≥є∆њ’љљЊЇї±µ≤±ѓЃ≠≠І¶•••¶••°•†£°£ІІ£££І§¶¶ЂЂЂІЂЂЃ≠≠≤ђђ™І£†ЩЧФРИВztzc}hz[hlЙРЯ§ІђЃѓЯіОws~fa\YTHD>@;863-/*&$!!  "$&$&)+-,....00.2/.02.0.020000/,//---13/1/)&'*.-++.++)+.,,,%()+-+.-&-*-))-.-..,.-))(((-)),(%%,))+,.'))'' "$&%%%%$!%%!!#!!!!%%,((,/-0LЖё’„ўџЁябгджийлмопртуфх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘‘”““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЫ™ґЉЅЈЂЫЖrpm[WB8=GGCZIQPditixВhukouyЖТљЎЇ§Ж@HCMEXHYelty~ГИФЫЬЫЮЯ£¶¶ђ®ЃЃѓЃѓ±±±ЉЇуп”±і±∞Ђ®І©©≠©¶®¶§§§†Ґ††°§ђђѓµѓ≤≤Ѓ©І¶ҐЬЮЮЫУЬЭЬЭЭ°®±®ќихЇЃ•ЫУУСРЗЗ|ЗzАЖvЗ~ЛСУУЦЩЩ†°°•¶©©©¶•¶ЂЂ®ѓѓ®±µїѕƒ¬»ЉЇµґґ±≤±ѓ™¶ІІ¶¶•¶¶®¶§§¶§•£•ІЂ•£•Ђ¶Ґ®®®Ђ≠ЃЃ∞∞≤ґ≤≤і±∞ЃЃЃЂ•ҐЮЩСПЖНuqcZАcsuЗПЬ§±ЄПИЖМ{ЙЙЙxh][UPKH@<4/.,(*($  !#"#$''''),,,.0.:--/4...0202111----,&/311/"&)-..'....+).,,*&)-..&.4+..-**-0...*--*0)&))(),)&" "%)+'''%' %&$""&&&&&%$#&#!(!!%!#%##%%&((!,0/5+2M“„÷Ўџ№ёавдезйлмнпрттух€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУТТТСРРППООНННМО†ѓј∆¬њі£УДoii[OZC96AW>YYh_swxЛЖНХ•љ•ЭБQZQXLRBARCYLU]gr|АДЛРЪЭЮ††§•ЂђђЃЃ±ЇЊа№»Єµ±і∞ЃѓЃЃ∞∞ЃѓЃђђђ¶®¶®§®Ѓѓ≥≤≤≥ѓђ¶£ЯЫЫЫЬЫЦЩЫЩЪЭ°§ЃђЏ€ь«≠І•°ЮЫЪЩХХССЙМ~Ж}zВБЗ}ОСУЦЪЯ°Ґ§ҐҐ§§®Ѓ±ґњƒѕљ√ љњЇєЄ≤≤±≠≠ђ©•Ґ§¶•••І•®®¶®ђ®®•ІЂІІІ®ђ®¶ђђђ≠Ѓ≤±±іґїЄґєєЄєЇЇЇїґµіґђ¶І£ЩФОБnБikhdБ}Ь•≥•П{ПЛЫІЮІЙРЙskuАF<;;9652.+(+&(!%% %'%###''(+++1,*,/,,,0423311/--/-)/1113)-,.00-02-0.+.,-*)*332).2-.0.--000--+)+)-((-)%+-,))# $%'''%%%%) &%$%')'''&%$&%#&#%%!%#!!%%%%%))%))(%-//55,#≠џ’„ў№ёавдезйклнорстуф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффуууууутттттссррррпппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММР§≤љ»√і®ЯСЗ}gTGDVM09=FMYceovxВИНУХЩЬЭ°£¶£Іђ≠Ѓђђђ®ђЂ†•¶ЯІђЃѓѓЃ©ђђ®••§§•£°†Ґ††ЮЮЫЫЮ†Щ§јпшаљЬУЫЦУТУУЩЩЩЪЪЪЫЩЩХЬШХХСЪТСП}ЗsВmЖuРМ§Љ≤≤∆Я°¶¶©Ѓ•©Ю§°°°Ґ†Ґ†Ґ§°†Ґ†§§§®¶§§¶®¶®¶¶§®©©¶©©ђ©≠≠±±≤єєєєЇєєїњј√ƒ≈≈ƒЅЅњїєЄµ≤µ≤≤іі≤њѕХDcДППОААtVu@rKT]gzuЯZ&;47.-::HP]ZMEID=94,.,+)(!! #####%%%(**--//--113/01).,01100..,...0+,-/-)+,++,.++..0,,.0+-*''*--(,-,*/-+.&  !%(((***,&*++'''(&&%%#%#%!%$%!%%%#%!&&&)-))&&))(,-//3%+G‘Ў„Џ№ёавдезйкмнорсту€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммллллккйййииззззжжееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТСРРРПООНННМЛЪ™іљƒЄ±£†РЖqbTNAf5bCVfkxОЬЪЪxЛuuАУp[fb][TF?7QAU6L[_djtx|ДЙХШХШЮҐ¶®¶¶ђЃЂ®§В§¶©ЃѓѓЃЃђҐђЃЃ≠ЂЂЂЂІ•¶ѓ¶¶§§ҐҐ§•Ђ£Ћоо ЈНЧЫУЙССУУЦФЩЩЩЫЩЦЩ©ЫЬШШЬЬЫЮЫЩЩТРЖН|СФЭ†•ж£ФЪШ£љЮ¶ЮҐ°Ґ†††ҐҐ§§ҐҐ§¶І•Ґ§Ґ§§¶¶®®®ђ®®®¶©¶©ђ®ђ≠≠±±єњїєЇЉЉЉњ√ƒƒƒ√њїЉЇЇµґіґЄЄЄєјї ’®/З™¶ѓ§ЮШЧСПИЕz\faxMpRUNID9"ГЇЊЅЊ¬ƒ√ƒƒ∆«««≈≈ƒƒњ¬њњЊ√їЇїЊ√ѕ√јј«ЉЈ≥∞∞∞≠Єђ®®©¶ҐЮЫСАxti[N=72,$ 531/>GNhnx}БДМТШШЭЭ††ђ®ђђ¶°Ґ°•§ІЂ≠≠ЂЂ§£ЮЬЮЮ§І•ЃЃЃЃђ¶Ч°ЮЮЪЪЦЪХТООЛССОАЮХµсси≈ЬУЮЩУЦЦЦУЦЧЭЦЩШШСССРПММЙДАБВnoВiСЙ¶ј∆ЅћЅµЂ§°ЃЉ≤≥ѓѓ≥єїњЅƒ«∆ƒƒƒЅƒЅЅЊ≈‘”Qa•ЄЄїњ¬¬ƒƒƒƒƒƒƒ¬ƒ¬¬њ¬ƒ≈Ѕ√¬¬јј¬√љЇ≥їі≤©∞іµµїЄЉЉ√¬ЅљЈіі≤•ЩСЖ|ti_UI@=0+3C1;CBB=//.,$($ #  %##%'-'%',.++.))-..-.0-+020.000,,.,*.,0.,'(((%!$&(((),/))((%-)*))&&&*%),,*-,++)%-)++,%,,,,,//(2"Яўџ№ёавджзйлмопр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццххххххффууууутттттсссррррппоооооннммммллллкййййииззззжеееедддггвввбааааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУТТТСРРППООНННМОҐ≥∆ЎЎќї≠ШvwY_OZWLmQn`ru{ГЗГrЙnqkkhb`]Y^PXOLIFQH_Qeinnw|ВЙЛЦЭҐҐ††ЭЭ•†ҐҐ§ЂЂЂІ§££ЯЮЦЯІ™Ђ≠Ѓ≠ђ¶•†§ҐҐ††ЮЮЭЦТЛТХХССС†≤тцЏЄФЛЧФСТТУТФЦЧЦХШЫШШЧЫШЫУУПЗРСЙЖБИ~ГКЙСЙ±ЌЅ√ШТЬђЃ¶©¶ђѓ≤ЇєњЅћƒƒƒ∆ƒƒЅјј—’Љ'vґіЄЊЅ¬ƒ∆∆ƒ∆ƒ∆≈ƒ≈ƒƒƒ«≈«√√¬≈ЊЄїєґђ≥Ј≥ђ≤ЃєЉЅ¬ƒ∆≈ћ……»∆ƒЋЅЉґґЂ§†ЬОБРЂ[#  5QVgyЛrc\WUTD..0,"((%" %#" %""''')+')4----.-+-0...01,...,0...+)**((&&( &%%),,,*,))(,*,*)))&,(,,,,-,**)&)+--,,//,,%,,,/+CЈё№ёавдезйлмнпр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооонннммммлллккййййиизззжжеееедддггвввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљЉЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПОООННММС©їЋџ’«Ј®ШРЙqaeNOIKclzНЪ•©Ј¬љЇљ∆ƒм—ЎЌ«їЫіѓіЄЄЇЉљј¬√«ƒƒƒ√∆««««Ћ »»»∆∆√јЊЊЇЄЇЈЄЈЇЈЈЅєєЈњґµ±ѓЃЃ™™Ђ≠≠Ѓђ™™ђ™І™µђЃђ≤™§§≠§††ЯШТПЙРТЖqfXO?4"&*$$"#%##%**(***+..+,)++,+5+')+''!&&,,,%)),((),)++.---)"&(,4)&)),,,/,#(%(),/1405%mеёавдезйлмно€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууууттттсссррррппоооооннммммллллккйййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”““——––ѕѕќќЌЌћћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМН†≥√–‘…Є•ЫП~g[TNP@0P"P8CBOUgkuАХЭАЧu{uu{zПѓЈЏЮgnPhWgVmft|ГИМОТХЦЩЬЮ††Ґ§®®ђђђђђЃЃ•Ј√ЏжƒЮђ††ЭЭЬЭЭЩЩЫЫЩЩХХФЧЫ≈ЊµЄ≤≥±ђ•ҐКФФФСХХЦЩЬЮЭЮ¶™∞≥ѕ€у„µї±І°§®±Ђ°ЯЫЦТЙЙ|tnegaXutЗ{ИСЧЦЯІЉ÷…≈…ƒ«і¶ѓ∞іЄјЉњЅƒ≈«««««« «««≈«∆ƒƒ√ЅЊЇЄЈЄіґЈЇЈїљЉЉЉєµ±ґђ±ѓѓЃ∞™ђ≠Ѓ≠ЃЂ≠Іђ™™™≠•ЃђЃђђ™Ѓђ™ІІ£££Я£°ЮЬЯТНЙИxkUMB3,(,(%$$ !%%$'''&))')+)+,+.++,++,)'%),,,,3,)*,,,,,,-03/,,-&))-/))--/,/,,()&#),..002.%'∆аавгезйклно€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттсссррррппоооооннммммллллкййййииззззжеееедддггвввбааааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУТТТСРРППООНННМР°±Њ Ћљ∞¶У~{lgkOTE?76N=519&"303.1/9GScpfkor}txuzАУЉЄ≥УИmwt}uВГИИКРФУУЦ†ЮЪЮЪ†Ю°£•£§•§•®®™≠†ѕ€щѓМҐЮЪЩХРРХЯXG>N[vМ≠Ј®ҐЮ©≠ђ∞µЇЊЉњЉїєїЉїїЉЉЉєєєїєЇєєєЇєєµєЇЇЉљЅƒѕƒґ≥¶∞ѓЃЃЃѓ±ѓ≤±≤±±ЃЃЃ±Ѓ±Ѓѓ≠≠ђЃђ≠ЂЃ≠±І≠≠і≠Ѓ≠±≠ђ®ѓђђ≠Ѓ®ђ®ђђ≠ЂЃЃ∞≠≠§®ЂЂ§®®•§°°§°®®®•®®®®®®•§ІІђ©™©©І©ІЃ®І£§£Ґ†§§ЯЯЯРППНВytfOEA83,$&()&/%%,*+-,),,,,,,0/,,031//3//,33%"Ж’джзйлм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєЄЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶••§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРРПООНННМЛЭ≠Є¬Ќ»љЂЩТЗwfWMMG>,0%'./@9KRWblmurx~ЙТҐТГ|erjtkuxxxwБЖЗЙПУТЧЪЮЮЮ†°††°°§••®≠§÷юё†Щ§°ЭЮЮЫЫ®°g\tyЙК•±¶ЭИЭіµЈЈЄїЉЉЊЉїєїїЇєєєєєєєєєЈєЈЈЇґґ≥ЈЇЇЉƒ»ƒгкѓЬЭ≠≠≤ЃѓЃ≤ѓ≤±ї±±Ѓ±Ѓ±Ѓ±ЃЃЃіЃµЃЃЂЃ≠≤І≠≠і≠ЃЃ≤ђ®•ђђЂ≠ѓ®ђЂђђЃ≠Ѓ∞∞≠±•ђђ≤§ђ•®§§§ђ§®ђ±®®®®®®®••ІІђ©™™™®©®±©ІІЃ•©¶¶¶¶££ҐІІђ£†ЬСВВxi\S730/-,%%%%!!"%%%%#%&)).*(),,,,,0,,-000*,1//,035 Lѓзжзйлм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРРПООНННМНЯЃЈ∆…¬ґђЩУЖuhTD=9A;852&2+6/<5CGNVcmqzzvsoutusptnnhntlvr{v{ЗМТХТХЧЪЪЮЮ††°†™•–ћљУЬЮ††ЯЯЮЮЃУzЙЗМЦФ™ЧВ\`ЮЇЈљЊїЉїЉЉїєєєєЈ≥≥ґґґґіґ≥ґґґґЈґґґЈґ≥ЃƒЋ√ф€ѓwЛђђ≤ЃѓЃµЃ±±њ±ЃЃ±Ѓ±ЃЃ®ђђµђЄЃЃЂЃ≠іЂЃ≠ґЂ±Ѓµђ®®ђ®≠≠±®ђЂЂ®Ѓ≠Ѓ≠Ѓ≠≤ђђ®ґ®ђ®ђ•••±®®ЂіЂЂ®®°®І•І™І≠®®®®•®®≤•ІІ≤ІѓІ©¶®°¶£≠Ґ©††ЬЩЬ•ЮФООwm]YRGA330)%$"!%%+&%%(()())),,--,&(1-0/00<3+kеезйлм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиззззжжееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМНЯ±ј≈«ї∞ҐУЕrodZF@754- *( .=FQHTdqАt_kxw}АГx}|ГГЗЗЙОТЦЯ±Ъ≠РЦ~@3 0Ю—ЋЅ«∆√ЅЅЅЊЇЈґіііґЇєєєЇЉљЇЈµµ≥µЃ±ѓ≤ѓґЄ»л€„Ђ™•Ьѓ™ђ™ѓЃ≤±є±ґЃЃѓ±ѓѓѓµѓі∞Ѓ™ЂЃµѓѓЃ±Ѓ≤Ѓѓђµѓѓ≠ђђЃЂµЂђ≠Ѓ≠≠ІЃ™™¶≠≠µђ™Ђ≠ђ±®ѓ§®••®®®•••®≤®ђ≠ђ≠±™Ѓ™™™≥¶ЂЂ±ЂЂЂЃ©©©©§¶®ђ™≠™Ѓ™™™±≠≠®∞©©©ђ©©§І§§£ЯЯ¶ЭЭШУОПК|{rYLF@6%//&!##%%))/,,,,25+4lайкл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„÷÷’’’‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђђЂЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТТСРРПОООНННМТ£±јЌ–Ѕµ¶ШЛwoaUMH<:4(&!%# "$!#'-/>@@OZ_fjplqswА{||В}РЯЃЃ¶ККS<  Eі”»њ√ƒјјЊїЇ≥і≤Ј±ЈЇЉїЇєЇЈїЃ≥≥≥±≥ѓѓѓѓ±Јђљ€€„£∞ѓ©ѓ™≠ѓЃЃ±ђіЃі®ѓЃѓ≠ЃЃ±Ѓ±ђђІ®ђ±ђЃ≠Ѓ≠±ЃЃ≠≤≠≠ЂЂЂЃ≠≤®®°ЂЂЂІЂІІ†ђђ≤™ІІ≠ђѓ§Ѓ§¶§®®®І•ІІІѓ®ђђ≠©±ЃЃ™ЃЂ±§®®ѓ¶Ђ®≠©©ІІ§©©©©™•™•®©Ѓ©ђ§ђ§¶¶І•І§ІҐ§§££ІЫЮЫЭЫЮЬЦУСД|ДzhLMG>,,,%##!!!##%!&%&,/$(-Љикл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТТСРРПОООННММУ•≥љ∆«Ї∞°ЧЛ{d[ZPF94.&) %!)3356oвкл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттсссррррппоооооннммммллллкййййииззззжеееедддггвввбааааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПООНННМЛЧЂєƒЌ≈ЄЂЮР{f[\RJ8:3-%!!  /2472{ОЮ¶ѓїЇЉЉљјЉЅЉЉ≥ЈµЈЂєі±±µѓґ≥Ј±≥ѓ±ѓ≥±≤±≤±ґ≤і≤ґѓѓ≠Ѓѓ≤™ѓѓЃ≠Ѓ≠ѓ•≠™™£ІІ≠≠Ѓ≠±≠ѓ™≠І≠©ђ©ђђ≠І≠≠ђІ≠≠≠≠ЃЃЃђ≠©ѓ™™™≠≠ѓѓѓ£™І©°ђђ≠™ѓІ≠®≠ђ≠®™І≠ІІ¶©©ђ¶©§ІІІ¶®•®І©ІІІ®•••©І©І©•®••••Э™§•§••§ҐҐҐІІ©•••І£§Ґ©§®£¶Я®•®Ґ£Я££¶®©ІІҐ§ҐҐЫЯЯЯЫЬЪУРЙНЛ~o_X4VАµикл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттссрррррппоооонннммммлллккййййиизззжжеееедддгввввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТСРРРПООНННМЛШ®Є√ћ¬≥¶ЮРЖl\WOIB:0*,'  #2*CzТђ±»љЅљљљљЉЉЇЇґЈЈї≥Јі≤±µ≤їµґ±≥±≥±≤≤ї≤і≤≤≤ґії±±ЃЃѓµЃѓѓ±±Ѓ±ґЃѓЃЂ®™ЃЃЃ±ЃґЃ±Ѓѓ™™©©©≠≠ЃђЃ≠≠©Ѓ≠Ѓ≠±Ѓ±≠ђђЃ≠І™ѓ≠ѓѓЃђЃ™І•Ѓ≠≠≠ѓђђ®≠ђ≠ђђІІ®™©ђђ≠©ђІ©©©©∞©≠®≠™®®®®®••І©©©І™•®®®•™•®•©І¶§§§І®≠ІІІІ§¶§©¶®¶®§І£££¶Ґ¶¶®Ђ©І¶£¶££Ґ≠£ђЯҐҐ°ЯЯЫШЧУРИК£Їгйкл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУУТТСРРПОООННМЛЛЪ©Є√Ќ«ЇІЮСЕw_QFC@50))$    ,0JОЇєЇ»їЅЉЉЇЉЈЈЈЈЈЈµїµµ±≥ѓµ≤є≥≥±±±≥±≤≤Є≤≤±≤±і≤ґѓ±ѓѓ™≤Ѓѓ±±±±≤ґЃ±±ѓѓ±≤і±≤≤і≠±≠Ѓѓ≠ђђђ≠≠Ѓ≠Ѓ≠Ѓђ≠ђ≠ђЃЃЃ≠≠≠Ѓђ≠≠Ѓ™≠Ѓ≠ђ≠ђ™©≠≠ЃЃЃ≠≠ђ≠ђђ©ђ®™®Ѓ≠≠≠∞©ђђ©©ђ©≠©ђ©™™™®™Ѓ™®®®™©≠≠™°™™Ѓ™™®™©ђ©©Я§§©І©©©§І§®¶¶¶©§©¶І¶£•®•®•Ђ®©§¶§®¶¶¶ђҐ®Ю¶¶І£®Ю•ђ≤≥Ј¬ќвзйкл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶••§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРПООНННМЛЛЩ®іљ√¬ЉЂФД}vhYHE=..)&   $7?\v≥»ЊїЉЄјїЉЈЉґґґЈЈЈµЈµє±µ±≥≤≥≥≥±ґ±≥±ґ≤ґ≤≤±≤±і≤±ѓ±ѓєЃµѓ±±µ±ґ≤ґѓ≥±≥±Є≤ґ≤≤±Є≠±ЃЃ±±≠Ѓ≠≤ЃЃ≠ЃЃµ≠≠ђ≠ђ≠Ѓ≤≠Ѓ≠≤≠≠≠≠©≠ЃЃ≠Ѓ≠™™±ЃЃ≠і≠≠ђ∞ђђ©ђ®™®Ѓ≠≠≠±©ђђ©©ђ©ђ©ђ©™™™®™Ѓ™®±™≠©≤≠™£Ѓ™Ѓ™™®™©ђ©≠Ґ¶§©¶©©∞¶¶¶≠¶¶¶©¶©¶©¶¶•®•®•Ђ®≠¶ђ¶©¶¶¶¶Ґ≠°ђ≠ѓѓµ±Љ√Ћ“џёдезйкл€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиззззжжееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЬЫЫЪЩЩШЧЧЦЦХХФФУТТСРРРПООННММЛЛТ§±ЄјƒљѓЧ{p^WPD:,*!#FkГЯі≈ЇЊЇЄґјЈЈґЉґЈґЈ≥µ≥Ј≥їЈЈ≥ґ≥±≥≥±Јѓ±≤є±≤≤±±±≤≤≤≤±±ѓЉ≤є≤≤ЃґѓЄ≤Јѓ≥±≥±ї≤Є±≤±Єѓ±∞±±ґ≠±ЃґЃЃђЃЃї±≠≠Ѓ©ђ≠ґЃ∞Ѓі≠≠ђ≠ђЃ≠ѓ≠ЃЃЃ≠µ™Ѓ≠їђђђ±®≠ђ≠•™•™ђ≠ђ≤ђ©©©¶©§¶¶©¶®•™®™®™™µђ≠®і©©¶≠©™™™•™І©ђ∞©ђ¶¶§©¶±®©©±¶§І™©ђ¶ђ¶¶¶®ҐЂ®ЂЂ∞®∞®ђ®®•®™і¶ѓ≥Їј≈Ћ”ЎЁабвдезйкм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссррррпппооооннммммллллккйййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ  ……»«««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉЉїїЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХФФУУТТСРРПОООННМЛЛКМЯЂіЉњ≥ЪРЛvaaYH5U_yЭ¶±©∞µіЈіі≠µ≤ґ≤µ≤ґ≥ґ≤≥Ѓґ±ґґЈґЈ±≥±±ѓ±™ѓ±µ™±ѓѓ™±±≤±±ѓѓЃ≤≤≥±±•µ®±Ѓѓ®ѓѓ≤™≤±±≠±©±ЃЃ≠ѓѓ±§Ѓ≠±≠Ѓ©ЃЃ±±ЃЃ™•≠©±Ѓ∞ЃЃ©ђ©≠≠ЃЂЃЂѓЂЃ™™§ЃІ≠§®¶©І©©©•™••§І§®©¶¶І§§Ґ§§¶§•§®§••®¶ђ©ђ¶ђ¶¶Ю§§ІІІ•™•©©©¶©§§Ю§§©¶©¶©§§•®І®§©§§Ґ•ҐЂ•®®®•Ђ•®І®©Ђ≠Є£±єЋ“÷ўџ№ёябгджзйлм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууууттттсссррррппоооооннммммллллккйййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ  ……»««∆∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУТТСРРРПООННМЛЛЛКЙЪ®∞µЈі®ЭЕМСЩЂЃђ∞±іЄµЄµµіґµЉґµµµЄїЄґµґґєґєєЇЈЈ≤µ≤µ≤µµї≤≤±≤±≤µµ≤µ±±ѓѓ±≤≤±±ƒ±і≤≤±±≤ї≤і∞∞∞±±Є∞∞∞±≠±≠≤≤і±≤ЃЃЃ±±±ЃЃ™±Ѓ≤±Ј±ЃђЃђ±±±ЃЃЂѓЃѓЂ≠≠іЃ±≠≠ђЃ≠©ЃЃ≠і≠™®™®™™•®™¶§¶§¶¶¶¶©ђ©©©©¶ђђ≠®ђ¶©§ІІ©©©ђЇ©ђђ©©ђ¶©•¶¶ђ©©©©©©©®©©©©©ђ¶©ЂЈђЂ®®Ђђђђ∞≥±≥ј»ќўЏЏ÷÷ЎЏ№ёавгежийлм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттсссррррппоооооннммммлллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ………»««∆∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЯЮЮЭЭЬЫЫЪЩЩШЧЧЦЦХФФФУТТСРРПООНННМЛЛКЙЙХµб∆ЄєєЉЇЇµЄµЄµµіµіµіµµµѓµµїµґµґµЈЈґµґ≤µЃ≤≤µЃµ≤ґ≤≤≤µ≤µ±≤±≤ѓ±ѓ±ѓ±±±ѓµ™±±±±≤±і≤≤≠∞≠∞∞±≠∞≠≠ђ≠≠±≤і±≤Ѓ±Ѓ±ЃЃ≠™≠±Ѓ±≠±ђ≠©©©±±ѓЂЂ†ЃЃЃ§ЂЃѓЂЃ≠Ђ®ЂЃѓѓѓЂЃ≠Ѓ≠≠©≠©≠©≠•ІђђІ©І©©ђђђ©©©©©ђ©©Ы¶І©©ђ©ђ©≠©≠©©¶©Я©®¶Я©©ђђђђђ¶®§®Ґђ©ђ©ђђ∞ђђІђѓ∞§±Є√»ќ÷Ў’––”’„ўџ№ёавдезийлм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЪЩЩШЧЧЦЦХФФУТТСРРППООННМЛЛК…№’‘”ѕЌ…≈њњЊЉЇЇЇµЄµЄЄїµєґƒґєґєµїЈґ≤ґµґ≤µµґµїµїµµ≤µµµ≤≤≤ї±≤±≤±≤±ґ±±Ѓ±±ѓѓ≤±і≤і±≤∞∞∞±∞∞ђђ≠∞∞µ±ґ≤ї≤≤±≤ЃЃЃЃЃі±≤≠∞ђЃ©©≠ЃЃ≠≠µ•ЃЃ≥ЂѓЃ≥Ѓѓ≠™™®ЃѓЃѓЃЃЂ≥ЃЃ≠Ѓ≠і≠Ѓ®™ђђ©ђІІ©≠ђ≠ђђ©©©∞©ђҐ∞©ђ©іђЃђђ™єђђ¶©§≠¶©§ђ©іђђђ±©ђ¶∞©іђ≠ђ≠ѓ≥∞ђ≥≤ЄЇ¬ ”ёџ’ћЋЌѕ“‘’„ўџЁяавдезйклм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩШЧЧЦЦХФФУТТТСРРПООННПђЉЌЁаёџ’–ќ «јЈЈµЈіЄ±Ї±ґґј≤ґµґ≤Ї≤≤±µЃµ≤µ±µµє≤ґ≤µ±≤µ≤±±±єѓ≤±≤Ѓ±≠≤ѓѓЃѓѓЃЃ±±≤±≤±≤±≤≠∞ђ≠§ђђ≠≠≤Ѓ≤±ґ≤≤±±®™™Ѓ™±Ѓ±ђђ©≠І©©≠©©©±•≠≠±≠Ѓ™ѓ•ЃЂЂЂЂѓЃ§Ѓ®Ђ®ѓ©Ѓ©≠≠≤©≠ІІ§©І©§І¶ђ©ђ©©¶©¶≠¶¶§≠І©Ґ∞©ђ®®•≤©І§І§ђҐІ¶©Я∞©©©∞©ђ£≠ђ±¶≠ђ∞ђ∞ѓЄј≈ѕќ’÷—»≈« ћќ–“‘÷ЎЏ№ёабгджзйклм€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъъщщщщщщщшшшчччччччццххххххфффууууутттттссрррррппооооннммммллллккййййиззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏЏўўЎЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦХФФУТТСРРПОООННЪЂЉћџё№Ў—»∆≈¬ЊЊЈїµЇЇєіґµґµґ≤≤±ґЃµ≤µ±µµµ≤≤≤µ≤µµ≤ѓ≤±≤±і±≤≠≤≠±ЃЃЃ±ѓѓЃ±±±Ѓ±±≤±≤≠∞ђ≠§≠≠≠≠Ѓ™ѓѓ≤≤≤ѓѓ•™™ѓЃѓЃ±≠©≠≠©≠≠≠©©®©£І©≠≠≤©©•ѓ™ЂЂЃѓЃ§Ђ®®®ЂІ≠©≠©Ѓ©≠І©Ґ©І©І©¶ђ©ђ©©©Ѓ©Ѓ¶§¶©¶©Ґ©І©®••™І§Ґ§¶ђ£®®©ЯђІ©¶≠®≠•ђђѓЂ≥≥ґЄљњћ—Ўўћ√ј¬ƒ∆…ЋЌѕ—”’„ўџ№ёавдежийлмн€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссррррпппооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩШЧЧЦЦХФФУТТСРРРПООННМЫЃњќёаяЏ’ќ »»ƒјЉЄґґїєЄЄґµїµґµґµґµґ≤µ≤Єґґ≤µѓµ≤≤іі≠≤±і∞±±±±≤±±ѓ±∞±∞±±≤≤і≠±≠±≠±±±ЃѓЃ±±±ѓѓѓѓ™™Ѓ±ѓ±≤≤ЃЃ±±Ѓ≠≠Ѓђђђђ¶¶®≠≠і™™™≤™Ђ≠ЃѓЃ®Ѓ™™©ђІђђ≠ђЃђђ©ђ©ђђђ©ђ©≠ђ≠ђ≠≠±Ѓ±©І©ђ©ђ¶©©ђ©©©ђ©¶Ґ£®∞Ђђђ≠©≠Іђђѓђ∞ђ∞≥µЈљ√≈ѕ’Ў„ јїљњЅƒ≈«…ћќ–“‘÷ЎўџЁяавдезиклмо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххффууууууттттсссррррпппооооннммммллллккйййииззззжеееедддггвввббаааяёёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’’‘‘””““—–––ѕќќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ††ЯЮЮЭЭЬЫЫЪЩЩШЧЧЦЦХФФФУТТСРРПОООННМЫЃ¬“бяёЏ‘Ћ«ЇЄЇјЉЇЇЇЇµµґµґµґ≤µ≤ґ±Єіґ±≤®≤±≤≤≤°±±≤∞µіі±≤ѓ≤Ѓ±Ѓ±±≤≤ґ≤≤©±Ѓѓ≠±±±ѓѓЃ±ѓѓЃЃѓѓ™ЃЃ±ѓ±±і±±і≤Ѓ≠ђ±ђ≠≠ђ®ђІ™©≠®®®™®™ЃЃЃѓ°Ѓ®™®≠§®®ђ®ђ©©¶©©ђђђ©ђђђ©ђђ™™Ѓ™Ѓ®®©ђ¶©§¶¶©©∞≠І©ђ£¶®≠®ђђђЂ≠£ѓѓ∞∞іѓЈЄЊ¬ќ”ўџ љґєїљЊј¬≈«…ЋЌѕ—”’„ўџ№ёабгджзйклмо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттсссррррппоооооннммммллллкййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩШЧЧЦЦХФФУТТСРРРПООНННМЬ±¬’еа№’‘–ЋЄ≈≈ј≠ЇЇЇєЄЄµґґЅґєґґµґµґµґµ≤≤≤≤ґіњµµіµіє±≤≤≤±ґґїіі≤і±≤ѓ±ѓѓ±±±≥±ѓЃЃѓґЃ≤≤Ј±≤≤єѓ±±±∞∞∞Ї≠ђђ≠≠ЇЃѓђ≠≠ѓ™®®ЃЃѓЃµЃ≤Ѓ∞ђЈђ≠ђ≠ђђ©ђ©ђ©≠ђђђђђђ©©ђЃ™ЃЃ≤®®®ђ©ђ®ЂЂ∞µњіЯ∞ЇІ£¶Їђђђ∞ђ≥∞ЈіЄЇєƒћ”ЏёџЋЉ≤іґЄЇЉЊј¬ƒ∆» ћќ–“‘’„ўџЁяавдезийлмно€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттссрррррппоооонннммммлллккййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩШЧЧЦЦХФФФУТТСРРПОООННМЛЮ∞Ѕ‘гЁЎ‘–Ћ∆њњєЄ±Ї§ЇЄЇ±µіµ≤µµµѓ≤≤±ѓ≤≤і©і®і±≤≠≤ѓ≤±±ѓі±і±≤ѓ±ѓ±ѓѓЃЃ≥±±±±ѓ•ѓ±±ЃЃЃѓЂЃЃ±•ЃЃ≠ђ≠©≠§ђ©ђђѓ™≠§≠≠Ѓ®™®™®™®Ѓ§≠©©¶≠¶®¶®©©§¶§¶¶®І≠©≠¶©§¶¶І•®•®••¶®©©ҐЂЭ≥єњјЅ…ЋvЙЖ≠®ЂҐЂ°∞Ѓіґ√»ќ”№ё єЃ∞≤іґЄЇЉЊј¬ƒ≈«…ЋЌѕ—”’„ўџ№ёабгдезйклмоо€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЬЬЫЫЪЩЩШЧЧЦЦХФФУТТТСРРПОООННМНЯ≤јѕЁя’‘ѕ »≈Ѕƒ¬ЊЇЇЇЄµЄµґ≤µµ≤±µії≤і≤їіЇ±≤±µ±≤±ґ≤≤∞≤±≤±≤≤ЈѓЃ±≥±Ј≥Јѓґ≤≤ѓѓЃЃЃѓѓ±Ѓ±ѓ∞≠∞ђ≠ђµђђ≠Ѓ™™®ѓ≠Ѓ™Ѓ™Ѓ™Ѓ™Ѓ©≠©©®ђ®ђ®¶ђђ©©¶ђ™™©Ѓ≠Ѓ®ђ¶©¶§І©§•¶§®®©ђ¶ђ°ЪЊт“ЈЋЏЗmЮЈµ≥≥ѓ≤єЅ»ќ”ў„»ЄЂ≠ѓ∞≤іґЄєїљњЅ√≈«…ЋЌќ–“‘÷ЎЏџЁяавдежийлмноп€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбааааяёёёЁЁ№№№џџџЏўўўЎ„„„÷÷’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤∞∞ѓЃЃ≠≠ђЂЂ™©©®І¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩШЧЧЦЦХХФФУТТСРРРПООНННМН°≥√”яЁџЏ‘ѕ њ¬¬їЈЇЇїЄґµµ≤ґґїґЄµЇіЈіµі≤≤і≤ііі±±±≤±≥≤і™ѓ±±ѓґѓ≥Ђґ±±ѓѓЃѓѓѓѓ≤≤≤Ѓ±≠≠ђ∞≠≤™™≠Ѓ®™®Ѓ™ѓ™Ѓѓѓ™ЃЃЃ™ђ¶©®ђ®ђђ®≠≠©ђђ≠®≠≠≠≠≠®®¶©©¶§¶§¶®І®®¶ђ¶ђЭЗјюгёоиЭГЈњЅЅƒ√»ќўЁ№…Ј©ЂђЃѓ±≥іґЄЇїљњЅ√≈«…Ћћќ–“‘’„ўџ№ёавгдезйклмнор€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййиизззжжеееддддгввввбааааяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—–––ѕќќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√√¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦХФФУУТТСРРППООНННМО°і∆ЎаЁ’‘ѕ ««√√њњЉїєїїїЄЄµµіµіµіµ≤і≤ііµ±≤±≤±≥∞∞™≥±±ѓ±Ѓѓ®±ѓ±ѓѓѓµѓѓѓѓ≤≤ѓµЃЃђ≤™Ѓ®™™Ѓ™Ѓ™ЃЃµ™Ѓѓѓ™ЃЃЃ™≠І™©ђ©ђђђЃ≠©ђђ™®≠≠≠©≠І®¶©©ђ§ђ¶©©™©ђ©∞©ђЮКЄ€рньшТВ¬ё‘–”„ЏўћЄІ®©Ђ≠Ѓ∞≤≥µЈЄЇЉљњЅ√≈∆» ћќ–—”’„ўЏ№ёябвдезийлммопр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссррррпппооооннммммллллккййййиизззжжеееддддгввввбаааяяёёёЁЁ№№№џџџЏўўўЎ„„„÷’’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤±∞∞ѓЃЃ≠≠ђЂЂ™©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩШЧЧЧЦЦХФФУТТТСРРППООНННМР£ґ∆’яџ„‘—ќ «≈њњЉїЄЇµі±і±µіі≤≤±≤±Ј∞±±±ѓ±ѓѓѓґѓѓ™ЃЂЃ®ѓѓ±ѓ±±ґЃЃЃЃЃѓѓґЃѓЃµ™Ѓ®ЃЃѓЃ±ЃѓЃґЃѓЃѓЃЃЃѓЃѓ™Ѓ®≠™™І≠™™§ІІ®®≠©©©≠©ђІ©§≠¶∞©ђђ≠ђ≠©±©ђ•Ц©щлёерt|Ћтзё‘«ґ¶¶І©Ђђ≠ѓ∞≤іµЈєЇЉЊњЅ√≈∆» ћЌѕ—”‘÷ЎўџЁёавгежзйклмнорр€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууууттттсссррррпппооооннммммллллккййййиззззжжеееддддгввввбаааяяёёёЁЁ№№№џџЏЏўўўЎ„„„÷’’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋЋ ……»««∆∆≈≈ƒƒ√¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£Ґ°†††ЯЮЮЭЭЬЫЫЪЩЩШЧЧЦЦЦХФФУТТТСРРППООНННМТ•µ≈‘№Џ‘–»»њљєљЇЄі±ђµіі≤∞≠∞∞∞ЃЃЃѓЂѓЃѓЃ±ЃЃ§™§ЂҐЃЃѓЃѓѓѓ™ђ™ђ™ђЃѓ™ЃЃѓ•ѓ•™ЃЃЃ±ЃЃ™Ѓ≠Ѓ™Ѓ™™™ЃЃЃЃ™•™••°®®®ЭІ••§©І≠≠©І©•ІЫ¶§¶¶ђђђ©ђ§©®ђ£Ђ£≥«‘ЉЩpЄ‘и«І£§¶І©™Ђ≠Ѓ∞±≥іґЈєїљЊјЅ√≈∆» ЋЌѕ—“‘÷„ўџ№ёабгдезийлмнопрс€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффууууутттттсссррррппоооооннммммллллккййййиззззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘‘”“““—–––ѕќќЌЌЌћЋЋ ………»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµіі≥≤≤±∞∞ѓЃЃ≠≠ЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЫЪЩЩШЧЧЦЦХХФФУТТТСРРПОООНННМТ¶Ј…’№Ў’—» «љ∞ЈЇЇЇЈ±±±іі±±≤≥±≥±±±≤±ѓ™™Ѓ±ѓ±±±ѓ±ѓЃЃѓЃ≤ѓ™Ѓ≤Ѓ±ѓ±ѓґѓЃЃ™ѓґ±≤±≤≠±ЃЃ≠≠Ѓ±ѓЃ™™™™™™™™ЃЃђ≠©©¶ђЃ±Ѓ≠©©≠Ѓ™®©©©ђђ≠ђ≠ђђ∞≥ЈЉµ≤„м„∆–„“ѓ£§¶І®©Ђ≠Ѓѓ±≤іµЈЄЇїљЊј¬ƒ≈«» ћЌѕ–“‘’„ўџ№ёябвдежзйклмооррт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццхххххфффууууутттттсссррррппоооооннммммллллккйййииззззжжеееддддгввввбаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕѕќќЌЌЌћЋЋ ……»»««∆≈≈ƒƒ√¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТТСРРПОООННММФІїЋ№аџ‘–ќ…¬ЊЈµ∞ЄЄµЃіґµЃµґ≤±≤ѓѓ™ЃЃ≤±±ѓ±ѓ±ѓѓЃѓЃ≤≤ѓЃѓЃѓѓѓЃ±ѓѓЃѓ±≤±≤≤±ЯЃЃЃЂЂЂѓѓѓЃ™™Ѓ™∞∞ѓЃЃ™≠¶©¶ђ∞≠©Ѓ≠Ѓ≠ЃЃЃ≠ђ©ђ≠ђ§≠§і≥ЉЅЋ””№вйяё«¶§¶І®©ЂђЃѓ∞≤≥µґЈєїЉЊњј¬ƒ≈«… ћЌѕ–“‘’„ўЏ№Ёяавгежзйклмнопрст€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооооннммммллллккйййииззззжжеееддддгвввббаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘‘”“““—––ѕќќќЌЌћЋЋЋ ……»««∆≈≈≈ƒƒ√¬¬ЅјјњЊЊљљЉїїЇєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂ™©©®ІІ¶¶•§§£ҐҐ°†††ЯЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХХФФУТТТСРРПОООННММХІґЋЎџЏ‘ѕЋ∆ї¬њЄ∞їєµґµ≤≤ї±±Ѓ±ѓґ±±ѓ±ѓ±ѓ±ѓѓѓєѓЃѓґѓѓѓ±ЃѓЃѓЃѓѓ±ѓ±±є©±ѓѓЃЂЃЃѓѓѓЃЃѓЃі∞≤Ѓѓ™ѓ™≤®ђђ©©±ЃїЃЃЃѓЃ≠ђ≠∞∞ієє¬≈∆Є§ЭЮЂ∞∞∞™•¶І®©Ђђ≠ѓ∞≤≥іµЈєЇїљЊјЅ√ƒ∆«…Ћћќѕ–“‘’„ўЏџЁёавгдезийлммопрстт€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыъъъъъщщщщщщщшшшчччччччцццхххххфффууууутттттссрррррппоооооннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““——––ѕќќќЌЌћЋЋ ………»««∆≈≈ƒƒ√¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТССРРПОООННММХ®ґ«’Џ‘‘ѕ»њ√ї±±≤ѓ©Їі±ѓ±ѓі≠±ЃѓЃѓЃѓЃЃЃ≤®Ѓѓ≥ЃѓЃѓ™Ѓ™Ѓ™ЃЃЃ™ѓЃ≤®±ЃЃЂ™ЃЂЃЃЃЃ™ЃЃ≤©ѓ™Ѓ®Ѓ®ѓ©®®©ІЃ≠ґ≠≠≠Ѓ©ѓ≠ѓЂґЉ≈…ЊђЭЮЮ†°Ґ£§•¶І©™Ђ≠Ѓѓ∞≤≥іµЈЄєїљЊњј¬ƒ≈∆»…ЋЌќѕ—“‘’„ўЏџЁёабвдезийклмнопрсту€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€юююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппоооонннммммллллккйййииззззжжееедддггвввббаааяяёёёЁ№№№џџџЏЏўўўЎ„„„÷’’’‘‘””““—–––ѕќќЌЌЌћЋЋ ……»««∆≈≈≈ƒƒ√¬¬ЅјјњЊЊљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩЩШЧЧЦЦХФФФУТТССРРПОООННММХІµ∆÷Ў”Ћ¬ЅЅїЈЇЈ≠±µ≤≤≠≤∞∞ЃѓѓµѓЃѓѓ•ЃѓѓЃѓЃ±ЃЃЃЃЃ±ЃЃ™Ѓ™Ѓ®Ѓ≠ЃЂ™ЃЂЂЃЃЃ≠≠ђ∞¶™™™®™®™І®®≠©≠ђ≠ђ©≠±∞ѓЄЉЇ«Њ∞ЯЮЮ††ҐҐ§•¶І®©™Ђ≠Ѓѓ∞≤≥іµЈЄєїЉљЊј¬√ƒ≈«… ЋЌќ–—”‘’„ўЏџ№ёабвдежзйклмнопрстуу€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннмммммллллкййййииззззжеееедддггвввббаааяяёёёЁ№№№џџџЏЏўўЎЎ„„÷÷’’‘‘‘”“““—––ѕќќќЌЌћЋЋ  ……»««∆≈≈ƒƒ√¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ЃЃ≠≠ђЂЂ™©©©®ІІ¶¶•§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТССРРПОООННММХ¶µ∆‘Џ’”…ƒµЇЊЇєµЈµі±µ≤єѓѓ±±Ѓ±±ѓѓ±±µѓѓѓ±ѓµѓ±ѓѓЃѓЃѓѓѓЃЂЃЃЃѓЃЃ≠∞≠≤ђ™ЃЃ™™™Ѓ©©ђ±ђ≠≠∞≠Ђ≥єЊЇќ…ґ£ЮЮ††ҐҐ§§¶¶І©©Ђђ≠Ѓѓ∞≤≥іµЈЄєїЉљЊјЅ¬ƒ≈«»…ЋћЌѕ–“”‘’„ўЏџ№ёабвдежзййлммопррттуф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннмммммлллккййййииззззжеееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎЎ„„÷÷’’‘‘‘”““—–––ѕќќЌЌЌћЋЋ ……»««∆≈≈ƒƒ√¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТССРРПОООННММХ¶є∆‘÷‘ѕ»ƒїЊЊЉµЇµµѓ≤≤±∞±±±ѓ±ѓѓѓ±ѓ±ЃѓЃ±±ѓЃ±™ѓЃ±ЃЃЃЃЂЃ≠Ѓ≠Ѓ©Ѓ©≠ЃЃ™Ѓ™™©ђ©≠≠ѓ±і∞Јє«ЋЊ™ЮЮ††ҐҐ§§¶¶І®©ЂЂ≠ЃЃ∞±≤ііµЈЄєїЉљЊјЅ¬ƒ≈∆«… ЋЌќѕ—“‘’÷„ўЏџЁёабвдежзийллмооррстууф€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййииззззжеееедддггвввббаааяяёёёЁ№№№џџџЏўўўЎ„„„÷’’’‘‘”“““—––ѕѕќќЌЌћЋЋ ……»»««∆≈≈ƒƒ√¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТССРРПОООНННМХ®їћ„„‘—ќ…≈¬ЇЇЇЇµµµµµ≤±ѓѓ±≤±≤ѓЃѓ±±≤ѓґЃѓ±ЉѓЃЃѓЃѓЃЃЃЃђЃ≠±Ѓ±±±Ѓ™ђ∞∞ііЈЉЅ«Ћ¬∞ЯЮ††ҐҐ§§¶¶І®©™Ђђ≠Ѓѓ∞≤≤іµґЈЄєїЉљЊјЅ¬ƒ≈∆«»…ЋћЌќ–“”‘’„Ўўџ№Ёёабвдеезийллмнопрстууфх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккййййииззззжеееедддггвввббаааяёёёЁЁ№№№џџџЏўўўЎ„„÷÷’’‘‘‘”““——––ѕќќЌЌћћЋЋ ……»««∆≈≈ƒƒ√¬¬ЅјјњЊЊљљљЉїїЇєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶••§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТССРРППОООНННЦ¶є«‘„—ќ»≈Ѕє∞∞©Єі≤≤±ѓ±±±ѓѓЃѓЃЃ™∞ҐЃЃѓ®ЃЃѓЂЃ≠ЃђЃ©ЃђЃ≠±≠ЃЃѓ≠±®∞є≈ћ«µ£Я††ҐҐ§§¶¶І®©™Ђђ≠Ѓѓ∞±≤≥іµЈЈєЇїљљЊјЅ¬ƒƒ≈«»…ЋћЌќ–—“‘’’„Ўўџ№Ёёабвдеезийклмнопрсттуфхх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффуууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввббаааяёёёЁЁ№№џџџЏЏўўЎ„„„÷’’’‘‘”“““—––ѕќќќЌЌћЋЋ ……»««∆∆≈≈ƒƒ√¬¬ЅјјњЊЊљљЉїїЇєєЄЈЈґµµііі≥≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶••§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШШЧЧЦЦХФФФУТТТСРРРППОООННЦІµƒќ’–Ћ…√ЊЉЉЄѓґµµ≤±±ѓ±ѓѓЃ∞©ѓѓѓЃЃѓ±≠ЃЃ±Ѓ±ђ±Ѓ±±≤≤іієµђЊ»…єІЯ†°ҐҐ§§¶¶І®©™Ђђ≠Ѓѓ∞±≤≥іµґЈЄєїїљЊњјЅ¬ƒ≈≈«»…ЋћЌќѕ–“”‘’÷„ўЏџ№ёёабвдеезийклмнопррттууфхх€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшшччччччцццххххххффуууууутттттссрррррппооооннммммллллккййййиизззжжеееедддггвввбаааяяёёёЁ№№№џџџЏўўўЎ„„„÷’’‘‘‘”““—–––ѕќќЌЌћЋЋ  ……»««∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤≤±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩШШЧЧЦЦХХФФУУТТТСРРРРППОООЧІґ∆’’—ѕ…¬ƒјЉґЃ≤±µ≤≤±∞∞±±±≤±±≤±≠ђЃЃ±©±±≤іЄ∞Їњ«»«¬≠Я†°Ґ£§•¶¶І®©™Ђђ≠Ѓѓ∞±≤≥іµµЈЄєЇїЉљЊњј¬¬ƒ≈∆«»…ЋћЌќѕ–““‘’÷„Ўўџ№№ёяаввдежзийклмнопррстууфххц€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыыъъъъщщщщщщщшшшчччччччцццххххххффууууууттттсссррррпппооооннммммллллккййййиизззжжеееедддгввввбаааяяёёЁЁ№№№џџЏЏўўЎ„„„÷’’’‘‘”“““—––ѕќќЌЌЌћЋЋ ……»«««∆≈≈ƒƒ√¬¬ЅјјњЊЊЊљљЉїїЇєєЄЈЈґµµіі≥≤≤±±∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЩЩЩШЧЧЦЦЦХФФФУУТТТТССРРРРРРЩ®Ј≈–‘–ћ≈ЉњЉЉїЇі∞і±±ііі≤Є±ђђ±±≤ЃіµіЇЊљЋ”…і§†°Ґ£§•¶ІІ©©™Ђђ≠Ѓѓ∞±≤≥іµµЈЈєєїЉљЊЊјЅ¬√ƒ≈∆«……ЋћЌќѕ–—“‘‘’„ЎўЏџ№Ёёаавгдежзийклмнооррстууфххцч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъъщщщщщщщшшшчччччччцццххххххффууууутттттсссррррпппооооннммммллллккййййиизззжжеееддддгвввббаааяёёёЁ№№№џџџЏўўўЎ„„÷÷’’‘‘””““—––ѕѕќќЌЌћЋЋ  ……»««∆≈≈ƒƒƒ√¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЭЭЭЬЫЫЪЪЩЩШЧЧЧЦЦЦХХФФФФУУУТТТТТТТТЫ™є«—’— Ћ…њєЇЄµµ±Є≤ї±±Ѓ≤ЃЄ≤єљљ≈ЋќљІ°ҐҐ§§•¶ІІ©©ЂЂђ≠Ѓѓ∞±≤≥іµµЈЈєєїїљљЊњј¬¬ƒ≈≈««… ЋћЌќѕ–—“‘‘’„„ўЏџ№Ёёяабвгдежзийклмнооррстууфххцчч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррпппооооннммммллллккййййиизззжжееедддггвввбаааяяёёёЁ№№№џџЏЏўўЎ„„„÷’’‘‘‘”““——––ѕќќЌЌЌћЋЋ ……»»««∆≈≈ƒƒ√¬¬¬ЅјјњЊЊљљЉїїїЇєєЄЈЈґµµіі≥≤≤±∞∞∞ѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЮЮЮЭЭЬЫЫЫЪЩЩЩШШЧЧЧЧЦЦЦЦЦХХХФФФФФФФФФЭђЇ≈“‘–…«ЇєЃЇ±Ј∞≤≠іІї∞љ…ќјЃҐҐ£§•¶¶І®©™ЂЂ≠≠Ѓѓ∞±≤≥іµµЈЈєєїїљљЊњјЅ¬√ƒ≈∆«»… ЋЌЌќѕ–““‘‘’÷„ўўџџ№ёёааввдееззййллмнооррсттуфхххцчч€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююээээээээьььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррпппооооннммммллллккййййиззззжеееедддгвввббаааяёёёЁ№№№џџџЏўўЎЎ„„÷’’’‘‘”“““—––ѕѕќќЌЌћЋЋЋ ……»«««∆≈≈ƒƒ√¬¬ЅЅјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶•§§§£ҐҐ°††ЯЯЮЮЭЭЭЬЫЫЫЫЪЩЩЩЩЩШШЧЧЧЧЧЧЧЧЧЧЧЧЧЧЧЧШ°±Њ “‘—Ќ √Ї±іЈ»ћ“≈≥££§§•¶ІІ®©™Ђђ≠ЃЃѓ∞±≤≥іµµЈЈєєїїљљЊњјЅ¬√ƒ≈≈««… ЋћЌќќ––““‘‘’„„ўўџџ№Ёёяабвгдежзиййллмнопррсттууфххцччш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррпппооооннммммллллккйййиизззжжееедддггвввбаааяяёёЁЁ№№џџџЏўўўЎ„„„÷’’‘‘‘”““——––ѕќќќЌЌћЋЋ  ……»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶••§§£ҐҐ°°††ЯЯЮЮЮЭЭЭЬЬЫЫЫЫЫЫЪЪЪЪЪЪЪЪЪЪЪЪЪЫЫЫЫЫЬЭ•і∆„бџ‘”‘–Љ©§§•¶¶І®©©ЂЂђ≠ЃЃ∞∞±≤≥іµґЈЈєєїїљљЊњјЅ¬√ƒ≈≈««»… ЋћЌќѕ–—“”‘’’„„ўўџџ№Ёёяабвгдеежзийклммнопррсттууфххцччшш€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшчччччччцццхххххфффууууутттттсссррррппоооооннммммлллккййййиизззжжееедддгвввббаааяёёёЁ№№№џџЏЏўўЎЎ„„÷’’’‘‘””““—–––ѕќќЌЌЌћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇЇєєЄЈЈґµµіі≥≤≤±∞∞ѓѓЃЃ≠≠ђЂЂ™©©®ІІ¶¶¶•§§§£ҐҐҐ°†††ЯЯЮЮЮЮЮЭЭЭЭЭЭЭЭЭЭЭЭЭЭЭЭЮЮЮЮЮЯ†††°¶ѓЈЉЃ§•¶¶І®©©™Ђђ≠≠Ѓѓ∞∞≤≤ііµґЈЄєєїїљљЊњјЅ¬√ƒƒ≈∆«»… ЋћЌќќ––““”‘’÷„Ўўўџџ№Ёёяабввддежззййклммоопррстууффххцччшшщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччццццхххххфффууууутттттсссррррппоооооннмммллллккйййииззззжееедддггвввбаааяёёёЁ№№№џџџЏўўўЎ„„„÷’’‘‘‘”“““—––ѕѕќќЌЌћћЋЋ ………»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓЃЃЃ≠≠ђЂЂ™©©®®ІІ¶¶¶•§§§££ҐҐҐҐ°°††††††††††††††††††°°°ҐҐҐ£§§§•¶¶ІІ®©©™ЂЂђ≠ЃЃѓ∞±≤≥ііµґЈЄєЇїїљљЊњјЅ¬√ƒƒ≈∆«»… ЋћЌЌќѕ–—“”‘’’÷„ЎўЏџџ№Ёёяабввддееззийкллмноопрсттууфхххцчччшщщ€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€ююююююююююююююююююююююююююэээээээььььььььььььыыыыыыыыыъъъъщщщщщщщщшшшччччччцццххххххфффууууутттттссрррррппооооннммммллллккйййиизззжжееедддгвввббааяяёёёЁ№№№џџЏЏўўЎЎ„„÷÷’’‘‘‘”““——––ѕќќќЌЌћЋЋЋ ……»»««∆≈≈≈ƒƒ√¬¬ЅјјјњЊЊљљЉїїЇєєєЄЈЈґµµіі≥≤≤±∞∞ѓѓЃЃ≠≠ђЂЂЂ™©©®®ІІІ¶¶¶••§§§§§££££ҐҐҐҐҐҐҐ££££§§§§••¶¶¶ІІ®®©©™ЂЂђ≠ЃЃѓ∞∞≤≤≥іµµЈЈЄєЇїЉљљЊњјЅ¬√ƒƒ≈∆«»… ЋЋЌЌќѕ–—““‘‘’÷„„ўўЏџ№№Ёёяабввгдеежзиййллммнопррсттууфхххцчччшщщщ endstream endobj 9 0 obj << /FL 1 /Type/ExtGState >> endobj 10 0 obj << /Width 1021 /ColorSpace/DeviceGray /Height 753 /Subtype/Image /Type/XObject /Length 768813 /BitsPerComponent 8 >> stream ўЏ„„Џўў„ў„ўЏўџџџЏўЏўЏ÷ўўўў÷ў„ў÷÷„’ў„ў„Ўў„ўўЏ„„ЏўЏ÷„÷÷ў„ў„ў””„„ў’÷””÷—ў„ў’””ќ„—’”’”ќ„„ў’’÷“„÷„„÷”–÷’÷””÷’’Ћ—’’“ѕ’÷÷ѕѕ÷’’Ћ—÷÷—»””’ѕѕ”””—”——“—””’““”“”—”———ќ———––——“––––ќ –—“—–—–”–—––ѕЋѕѕѕќќќЋѕ»ќѕѕќЋќќќќќќЋќ Ћ   »   »»»» ∆»≈∆∆ј≈√ƒ≈ƒ≈∆»≈∆∆∆≈Ѕ≈Ѕ≈≈≈∆≈∆јƒЅЅƒ√∆∆»∆∆»∆∆ƒ∆»»»∆∆∆∆««» ћ»ЋќќЋ»ћ ћ ЋћќќЋЋ»»ћ ћЌќЌЌќЌќ»ЌќќЌ ЌЌЌћћќќћЌќќќЌ»ЌЌЌћћћ ћћћќќЋћЌЌЌћ ћЌЌЌЌћћћ»   »»ћ ћ»   »«»»»∆∆«»»«»»»∆¬¬Є£O'+(FdУФВ^$%'8<3%!%2XСЇЊ¬ƒ≈∆≈≈Ѕƒƒƒ≈≈≈√ƒ≈≈ƒ¬ƒƒƒ¬¬ƒ¬¬¬¬¬¬Ѕј¬ЅЅљљЅЅЅЊњњњњЊЊЊљљљљЊЊљЊЊЊЊљљљљљЇљљљєљЇЇєЄєєЇєЄєљєЄЄљљЇґєљљЇЇљєљЇљЊЊљЇљљЊљљЊЊЅљљЊЊљєљЄљљљЊјјј¬¬¬¬ј¬¬¬¬¬ƒƒ≈ƒƒƒƒ≈ƒ∆∆∆ƒ≈∆«∆∆∆∆≈≈ƒ∆∆∆≈∆«»∆≈∆∆∆∆∆∆««∆≈∆«»∆∆  »«»«∆∆∆«∆«≈«ЋЋ«∆«Ћ»∆∆«»«∆«»»«∆∆∆∆ƒ≈ ћ»≈∆««∆≈∆«»«∆««∆≈∆∆∆∆ƒќІs2'Ff®£ђ}RD/'/m©Ђc4".2fҐє√∆«∆««»»»ЋЋЋ««»»Ћ» »»««»ЋћЋЋЋЋЋ»Ћћћ  ћћћЋЋЋЋЋ»ЋћћЋЋћЋћЋћ ЋЋЋћЌћ»« ЋЋ»Ћ »»«Ћ»»««»«»∆«» «∆«ƒ»»««∆»∆«∆∆∆≈«  ∆≈∆∆∆¬ƒƒƒ√¬¬¬ƒ¬ƒ≈ƒƒ¬¬¬¬¬Ѕƒƒƒ¬¬¬¬¬Ѕ¬¬√ƒ¬¬Ѕ¬¬¬¬¬¬¬¬¬¬¬¬¬¬√√√ƒ≈√¬¬≈≈ƒ¬¬ƒ≈≈≈≈≈∆ƒ≈∆≈∆≈∆««∆≈≈ƒ≈≈∆««∆ƒ««∆∆∆ Ћ»«««»»«»«»«∆««Ћ ЋЋ»∆ƒ»»Ћ «  Ћ∆»»»∆∆««»»»Ћ»Ћ»ЋЌЌћЋЋЋћћЌќЌЌћЌћћЌЌќЌќќЌћћЌЌќќќћЋЌЌќќќѕѕѕЌЌќќѕѕѕќќћќѕќќЌќќќѕѕѕѕѕѕѕѕѕ–ќѕ––—“ЏџџЏџЏџ„ўЏЏџЏџџЁ№ЏЏўџўџџџЏўЏўЏўўЏЏЏ„ўўўЏўЏЏЁЁЁЁЁбЏЏўёвЏЏўЏўЏџЏаўўў№ЁўџўЏўЏџўёўў„„ўўёЏ№Џ„ўЏёўЁџЏЏ’„„„’’’÷Џ÷ў„„ў’÷÷Џ„„Џ÷÷“÷÷„„“’’ў÷’„’”“”””“—”’„÷ў№’’””””””““”—””””—””””–—””—–——”———””ѕ—––ѕ—’––ќ–––ѕќќЌќќќќќ–ќќќќЋ ЋЋЋ    Ћ»»»ѕ—∆««∆∆∆»»Ћ∆∆∆  ≈»≈∆∆∆»»Ћ∆∆≈≈∆≈»» »»»»»∆»   ∆»∆»» ЌћЌћћЋќќ ћћЌћћЌќќћќќќЌћЌќѕќЌќѕ“ќќѕѕќЌќќѕќЌќћЌЌќѕѕќЌќќќЌћЌћћЌќѕѕЌћЌЌЌћћЌќќЌќќќћ ћћЌ  ћћЌ ћћћ »ћ  »∆»»Ћ«»ЋЋ»∆“є°O'**FcПЛrQ(%9;/%%&/SФ¬Ѕ¬ƒ∆»≈≈∆«≈ƒ≈∆∆ƒƒƒƒƒ¬ƒƒƒ¬¬ƒ¬¬¬ƒ¬¬ЅЅ¬√√ЅЅ¬¬¬њњЅЅЅјјЊЊљљЊЊЊЊЅњњњљљљЊљљЊљЊљљљљЉЄЄєЇЇєЇєљєљљљљєљљЊљЊјљЊљљЊЊљљЊЊ¬ЅЊЅЅЅЊјјЅЊљЅЊЊљЊЅ¬¬¬√ƒ≈∆¬¬ƒƒ¬¬ƒ≈∆√ƒ≈≈≈∆ќЋ∆≈≈∆∆»∆««≈ƒ≈∆∆∆≈∆»»∆∆≈∆∆»∆»««∆≈«ЋЋ«»»» »Ќ»∆∆≈∆«»∆«»»«∆∆ЋЋ««»«»∆«»»»∆»∆»∆«» ћ»»««∆∆»»»««« ќ∆∆∆«∆√≈Яg@'!!;ДЂЖ<*&5Hw∞Ї√∆«∆»ЋЋ««ЋЋЋ««»ЋЋ»ЋЌћ»»Ћћћ»ЋћћЋЋЋЋЋ ЋћћћЋЋЋЋЋ»ЋћћЋЋЋ»ћћЋ  ћ ћЋЋ»»»»ЋЋЋ»»»«»»Ћ»»ЋћЋ«»ћћЋ  »Ћ»««∆«∆∆≈∆«∆∆∆«∆∆  «ƒƒ¬¬√¬√ƒ≈ƒƒ≈ƒƒ¬ƒ¬Ѕ¬¬ƒƒƒ¬¬¬¬¬јЅЅ¬¬Ѕ¬¬¬¬Ѕ¬Ѕ¬Ѕ¬ƒƒ¬¬¬¬¬¬√ƒƒƒ√√ƒƒƒ¬¬ƒ≈ƒ≈∆«∆ƒƒ∆∆«∆«««∆∆≈≈∆≈∆∆«»«»  «∆««»∆»»»»« ∆∆≈∆««Ћ Ћ»»«∆»»ЋЋЋ   «  ЋЋ»»»Ћ»Ћћћћ«ЋЌЌћЋЋћћЋЋћЋћЋћћЋЋЋЌ»ЌЌЌЌќќћЌќќЌЌќќЌЋћќќѕЌЌЌЌќѕќѕќѕѕѕѕќћќќќќѕ––ѕѕѕ–——––———–ЏџЏЏџџёЏЏџЁёўЏўџўўЏЏў„Ў„÷÷’’’’÷“ѕ’ќ–”’”ѕќќ– «»≈≈≈¬ј¬¬√њЉµєЇЈЇєЄњЄЉЉєЊЊЇЇЇЉЉЄЇЇґµµµµЄЄґљњЉјј¬√√ј√ƒ«ћ Ћќѕќћќ”“–”–“’Џўў№„Ё““”’÷“”“”““””„”””””””””“’„””–’””””””÷””’”—–—””—ѕ“–”––“ѕ–ѕ––——––ѕѕѕѕѕ—„ѕѕќќќЋЌќ’—ќќЋќ» Ћќѕ»» Ћ »»»»∆»»»∆∆ѕ»∆∆ ќ»»≈ »∆∆≈∆∆ ∆∆»»Ћ∆»»∆∆≈»»»»»»» ∆»»» » »   ЋћќћЌЌќќ »ћЌЌћћќѕћќќЌЌћћЌќќЌќќѕЌќќќќЌќѕ“–ќѕќѕЌќѕ—“ќќќѕќ–—ќ—ќќќЌћћћЌЌћћЌЌЌћЌЌЌћ  ЋќЌ ћћѕћћћћћ        ѕ∆∆»ћћ«ћЄНC%%&C_ЖАoV)!#44'$'4]ЬЅ¬ƒ≈≈≈ƒ≈∆∆≈≈∆∆ƒ√ƒƒƒ¬Ѕ¬¬ƒ¬¬¬ƒ≈¬¬√√√¬√√√ЅњЅ¬√њЊњ√≈јјјЊљљЊЊ¬њњЊЊЊљљЊљљљљљЊљЊљљљЇЊљљЇљЊЊ¬љљљљљљЊЊЊљљљЊ¬ЊЊЊ¬√љЊЅ¬ЅљљЊЅљЊ¬¬ЅЊЅЅ¬Ѕ¬¬¬√¬¬√ƒ¬јј¬ƒƒƒ≈≈≈ƒ√ƒƒ√√≈«∆≈≈≈∆»∆«∆∆∆∆»««∆∆«∆»∆∆∆∆∆∆∆««∆∆»Ћ»∆∆∆∆«∆««∆∆∆«««≈≈«»»««»»«∆««»«»»«∆∆∆««∆«  ћ»Ќћ»«∆»»»«∆« –»»«ЋЋ¬≈Т`@:QБ∆ѓ∞M<% !?Е†w7,!(5EБµњƒ∆«∆«ЋЋЋЋЋЋЋ»«»»Ћ»»ћћЋЋћћћЋћћћЋЋћћЌћЋћћЌЋЋћћЋ»ћћЌћЋћЋЋЋЋћћћћЌЌЌћЋћћћ»»ЋЋћЋЋЋЌЋ»ЋЋЋ»ЋЌЌЋ ћЋћЋ»Ћ»»«««∆ «∆«ћЋ«» «≈ƒƒƒƒ√ƒ≈∆≈≈∆≈∆≈≈ƒƒ≈ƒƒƒƒ¬¬ƒ¬¬ЅЅ¬¬√¬¬¬¬¬¬¬¬ƒ¬¬ƒƒ¬¬¬¬¬√√ƒ≈≈√¬√ƒƒ¬ƒƒ≈≈≈∆≈≈ƒ≈∆∆∆≈≈∆««∆«∆«««»Ќќ»Ћ  ««««Ћ» ЋЋЋ«  ∆≈∆ »ЋЋЋ »»∆«ЋћЋ   ««ЋћЌќЋЋЋЋЋЋћЌѕЋЋЋћћЋћћЌћЋћћЌћЌЌЌћЋЌЌќЌЌЌќќЌќќќЌќѕѕЌћЌѕѕѕЌћћћќќћќѕќќќќѕћћќќќѕ––ѕѕѕ–——–ѕ–——ѕ’ўўўў÷ў“–“–Ќ“——“—ћ–Ќ«∆ ≈«≈ƒ≈≈√¬ЅЅЊЊЉЇґЈґµ≤≥≤Є≥≥ґµЈґґЄґµЈіµµ±≥±∞єѓґ±©≥±©±≠≥і∞і±∞≤±±±∞єґґЄґЈґЈЉґµЄЄЉЇЄЇЄЉЉЇљњјјјЅЅЅ√¬√≈√∆«ћћћћЌЌќќќЌќќ–—““““–““”““”“–ѕ–ѕ–—–—–—ќќ—––ѕ–––ѕЋѕѕѕѕќѕќѕќѕ––—––ѕѕЋЋќѕ–»ЋќќЋ Ћ»Ћ »Ћ  ∆»»» ∆  Ћ»∆»∆∆≈∆»«∆¬∆∆∆≈∆»∆»ƒ≈≈≈¬єƒ≈≈√√≈Ѕ≈јƒƒ≈≈√∆√∆∆∆∆√»∆»»»»∆ ∆»»»  ћ∆  ЋЋ∆  ћ Ћќќќ»ЋћЌћ ћЌќЌћЌЌќЌќЌЌЌћЌќѕќЌќќќћЌ ћЌћќЌќЌЌќЌќ ћќЌ »ћћћ  ћћћћћћћ »  Ћ»∆»∆ »»   »»» »»∆∆∆≈∆∆∆∆ƒ∆≥ПC&% A_kjY<%$)*$%*HW]^dhiqvzГКМУЩФЧЦЫЬЯ°†¶¶§®©®І®©®©©®ђЂђѓ©©ђђ±©©≥©≠±ѓ±≠∞≠≠∞≠≠ѓ≠≤±¶ЃЃІ±≠≠∞≠≠∞∞∞∞≠∞±і≥ѓЄ≠Ђ≥≥≥±іµµ±≤Ђ≤§ЯЧМДДЕГИТ¶≠ђ¶ЦКЫnf8DW|СЩҐѓѓґґЄґґ≠≠§ХПЦЭђ≥Їј¬√√≈√∆ « «« ќ»»  ќћќќќЌѕќќѕќѕЌѕќќѕќѕќќќќќЋќ ЋЋЋ » »»»»»«»» ∆≈∆≈»≈∆∆∆≈ј∆∆∆∆≈≈ƒ»ƒ≈≈≈∆≈≈ƒ≈≈≈∆≈≈єЅ≈≈∆ƒ≈≈«ƒƒ»∆»«»   » » » ЋЋЋ» ЌЌћ»ћ ћЋќќќѕћЌЌЌћ ЌћЌЌЌќќќЌќЌЌЌћЌќќЌЌќќќћЌЌЌЌћќќЌћћЌќЌ ћќќћ»ћ ћ ћЌћЌ ћћћћ    » ћћ ≈«»»∆¬∆»Ћ»«»«∆∆∆∆∆≈¬∆≤Р?"*+>V_[I0$&$%)9k•Ѕ¬¬≈ƒ¬Ѕƒ∆∆ƒƒ≈∆ƒ√ƒ≈≈√¬ƒ¬¬¬¬ƒ≈ƒЅ¬¬¬¬ј¬ƒ¬њњ¬√√јј¬¬јљЊЊЊљљљљЊЉљљљљљљљљљЇљљљЇЇЄєЇєљЊљЇЇљљљЄєљљљЉЊљЊЉљљЊЊЄљЊЊљЉЊљЊљЊЅЅ¬ЊЅЅЅЅЊ¬Ѕ¬Ѕ¬¬¬¬¬¬ƒƒ¬Ѕƒƒƒ¬¬≈∆∆ƒ≈∆∆ƒ√∆∆∆¬¬≈∆∆∆«∆∆«∆∆≈≈ƒ≈∆««∆∆∆∆∆∆»Ћ»∆∆«««∆«»»∆≈∆««∆≈∆∆«ƒ≈«««∆««»«∆«∆«∆««««∆∆««∆∆∆∆»∆««»»∆»∆∆∆∆««»∆»∆∆≈¬јpM'+\Ињ•ҐpC4 !*I~МY!$ ")0!!/RmpN $ "%*:iЩЄ√≈«∆≈∆»Ћ»»ЋћћЋћЋ»»«»ћЋ»«»ЋЋЋЋћЌЌЋЋЋЋ»ЋћћЌЋ»ЋћћЋ»ћћЋћЌћЌћћћћЌћЋћЌћЋћћћЋћћћЋ»ЋЋЋ»»ЋћЋ∆»ЋЋЋ»Ћ»Ћ»»»»Ћ∆«»Ќќ  «»««»∆∆ƒ∆∆∆∆≈∆∆»∆ƒ≈∆∆ƒ≈ƒƒƒ¬ƒƒƒƒƒƒƒ≈¬¬¬ƒƒ¬ƒƒƒ¬¬ƒƒƒ¬ƒ≈≈ƒƒƒ¬¬¬¬ƒ≈√¬ƒƒƒ¬¬√ƒƒƒƒƒ«—«∆∆∆≈≈∆∆«««∆«»≈∆«»Ћ ћЋЋ ««« «ЋЋЋ»««« ∆∆ ∆  Ћ  Ћ Ћ»«≈∆  Ћ ЋЋЋЋ»ЋЋЋЋЋћЋЋ  ЋЋЋћЌЋ  ЋЌќќќѕќќЌћЌќќЌЌќЌЌќѕќќѕќќѕѕќЌќќЌћЌќќЌћћћЌћЌќќЌћЌѕ–—–—––––––ѕ–—————ўЏ„„ЏўћЮnJ:;37516//7(55%2*+5 %%$*./4;5:BGGMV_chnsuwz}ГЗНРУХЬЪЬЭЯЬЬ°†Ю§Э†£¶†£¶¶§¶•Ы®••¶¶®Ґ•¶¶££ЬКWL78&/LЕВ¶ҐђЭС~ute2n`gmyЙЦЫ£©•ЯТlР"!%.Br©Ї¬≈««∆«»Ћ »ЋЋЋ»Ћ»»»«»ћЋ««»ЋЋ»ЋЋЋћЋЋ»Ћ»»ЋћћЋЋ  Ћ ЋћћЋ»ЋЋЋЋЋ»ЋЋ»ЋћћЋ»Ћ»Ћ»ЋЋЋ ∆»∆∆≈∆»ЋЋ∆»ЋЋЋ»»»»««»«»∆««»»««∆∆∆∆∆∆≈ƒ≈≈≈≈ƒ∆≈≈ЊЊƒ≈≈¬ƒ¬¬ƒ¬ƒ¬ƒ¬¬ƒƒƒ¬¬ƒƒ¬¬ƒ≈ƒ¬¬¬¬ƒ¬ƒƒƒƒƒƒƒƒ√√ƒ≈√¬ƒƒƒ√√√ƒƒƒƒ∆∆«ƒ∆∆∆«∆∆∆«∆∆«««ƒ≈«»»« « «««  «»»»«∆∆««≈≈∆∆ «»«««»Ћ» ∆∆ ЋЋ ЋЋЋЋ∆Ћ»Ћ» Ћ Ћ«»ЋЋћЋћ   ЋћћќћЌћћћЋЌЌќЌЌЌћЌћЌЌЌќЌќќќЌћЌћћЋћЌЌЌћЌќќЌќѕѕќЌќѕѕѕќ–ѕ–ѕѕ–—ѕѕ–————ЏЁ№ЏџЏ»ИH@DAqЃ¬¬¬ƒƒƒ¬≈≈≈ƒƒ≈≈∆ƒ≈≈≈√¬ƒƒ≈ƒ¬ƒƒƒ¬¬¬¬¬ј¬¬¬ЅЅ¬√¬ЊЊЊЊЊљљљЊљљљЊњЊњњЊљљ¬љљљєєљљЇЇЇЉљЇљЊЊЉєЇљЊЇєљљљљЊњЊљљљЊЅљњњњЊљјЅ¬ЅЊЅ¬ƒ¬≈ƒƒ≈¬¬ƒƒ¬¬¬¬ƒ¬ƒƒ∆«ƒƒƒ≈ƒƒ≈≈∆≈∆∆≈ƒ√∆∆∆∆∆∆∆∆∆≈∆∆∆««∆∆≈≈≈∆«∆∆∆∆∆∆∆»»«∆≈∆«∆≈∆∆∆∆»«∆≈≈∆∆≈≈∆««»««»Ћ»« ЋЋ«»»»«∆∆»Ћ»«»»Ћ«»»»»»»»∆∆«»» ∆∆«Ћ«ЉґQ7(2]М ЪАS5*!1c{e5" #'2J{ґЉ«»»»»ЌЋЋ »ЋћћЋЋћћ»«∆ЋћЋЋћЌЌЋѕѕЌћЋћћћЋЋћЌЌЋЋЋЋ  ћћћЋћћЋЌЋћћЌЌЋћЌЌЋЋћЋЋ»»»»»»ЋЋЋ»∆»ЋЋ»ЋЋЌќ»ћЋЋ»»Ћ»Ћ»Ћ»»»« «»««»«∆ƒ≈≈≈∆≈«∆∆ƒƒ∆≈ƒƒ≈ƒƒƒ¬¬¬ƒ¬¬ƒƒƒƒ«∆≈ƒ¬ƒƒ¬¬¬¬ƒƒ¬ƒ≈≈≈ƒ¬ƒ≈ƒ√ƒ≈ƒ¬ƒƒ¬¬¬√ƒ≈ƒƒ≈∆∆≈∆«ћЌ«««««««»»≈∆« Ћ Ћ    ЋЋЋ ЋћћЋ««       ∆»»»∆ ћ    ЋЋЋ  ЋЋЋ»ЋЋћЋЋћћћ»ЋћќѕЋћЋћЋЋћќ—ЌЌЌЌћћќќќќќќќќЌЌЌЌЌЌЌќѕќћЌќќћќќќќќ–ќѕќѕѕѕѕќѕѕѕѕѕ—–—––––ѕ––————ўЏўўЏў∆А3=B?=?<<<<==A<<>;>;;;<;<;7@8877<7:;585373.71)053./557%*;>B?HLUSMZ`dbcfory}ВЙЛЛЙФСЖvb_knТ°£ТЬ£ЪЮЮЩШ~zY>O00Fc}СЧЮҐЪУИ}qqbc>BB[\И§Ы°ИБ[KL@4ypwuРЛСЦЫФП~~oi)%EB`jИ†ЮЬЧТdkPHI{zМҐЩ†¶¶¶І•ђ†®§Ґ°£££І©ђЂЃ©ЂЃЯНКИРЮҐІієљљЊј¬¬¬Њ¬¬¬√»Ћ»Ћ   ћћќћЋЋ »»«««√≈≈≈ƒƒ»»∆≈∆   ∆   » Ћ ћ ћћЌ »ћЌќќќќќќћЌЌЌЌћќќѕќЌќЌќЌќЌЌЌћќќќЌћЌЌЌћЌЌЌћ ћЌЌ»»ЌћЌ ћћћћ ћ ћ   ћћ     » » »» ћ ∆»  »∆ ћЋ«∆«∆»∆∆»»∆∆ћЃ8!$#5CG>2$!!!&/Cr©¬Ѕ¬¬¬¬¬ƒ≈ƒЅЅƒ≈ƒ√ƒƒƒ√Ѕ¬ƒ≈¬¬¬¬ƒј¬јјјњ¬¬Ѕњњ¬√¬ЊЊЊЊљљљљљљєљЊњњњЊљљєљєљєєљљљєєєєєЄєєєЇЇљљљЇљљљљЇљЊЊЇЇЊЊЅљЊњЊЊЄЊЊЅЅЅ¬¬¬Ѕ¬ЅЅЅЊ¬ƒƒ¬¬ƒƒƒ¬√ƒƒƒ¬≈≈≈ƒƒƒјƒƒ≈≈≈ƒ¬≈∆∆≈≈∆∆«∆∆«««∆««∆≈ƒ∆««∆∆∆∆∆∆∆∆«∆≈∆««≈∆∆∆≈ƒ∆∆∆≈≈∆∆∆ƒ≈∆∆»«»«»«∆∆«»∆«»»«∆∆∆»∆∆»»Ћ«»«∆»«∆∆∆∆∆∆∆»≈∆≈≈¬Ї±L7&/^ЖХМАU5*3apX1 !(4NВЄјƒ∆«»«»ЋЋ»»ЋЋЋ»Ћћћ»∆«»Ћ»»ЋЌћЋЋЋЋћЋћЋћЋЋћЌЌЋЋ   ЋћћЋЋЋЋћЋЋћЌЌћЋЌЌћ»»ЋЋЋ«»«««∆»»»∆∆»ЋЋƒ»ЋЋ»«Ћ»Ћ»«»«»≈««««ƒ«∆∆∆∆«∆∆ƒ≈≈≈≈ƒ≈≈≈ЅЅƒƒƒ¬ƒƒƒ¬Ѕ¬¬¬¬¬ƒ¬ƒ¬¬ƒƒ≈ƒƒ¬¬¬¬¬ƒƒ¬ƒ≈ƒ¬Ѕ¬¬√√√√ƒƒ¬¬ƒƒ√¬√√ƒƒ√≈ƒ∆≈∆««∆≈∆∆«∆∆«««≈∆«∆«∆ ««««   ∆ ћћ»∆«« ∆∆  »∆»ЋЋ∆∆ ∆ ∆∆    ЋЋЋ»«ЋЋЋ»»ЋЋЋ«»ЋЋЋ»ћћћЋћЌћЌ ЋЋЋЋ ЌќќЌЌѕѕќЌќќќќЌќќќћћќѕќћќќќќћќћќќѕѕ–ѕќѕќќќќ–ѕ–ѕѕ––––————ѕЏџЏџЁ„¬y8=A>==<<:9<=<==<<;;<=;;<<<<<:A<<;;A=<<<><<<;<8;C:;C258554/;5/WMtvПҐЩТГjP<+0VYПЙХЯЬЬЩЛРНКЙСМФЩЮЩЫ††¶©°≠ЭІЬУЗЗМЛЦЪђ°¶РИhX+*!+}mУЭҐ¶ІЃѓ≠Ђ¶†ХМРРЧ°¶≥ЇЇЉЇњЊј¬Ѕ¬ЅЊ≈«»»Ћћ»ћћћЋЋќћќѕќќќЌЌЌЋЌЌѕћћћћЌ ћќѕќќѕѕ“ѕќќќќЌѕѕ—ѕЌќѕ“ѕ—––—ЌЌќѕќЌЌЌѕЌЌЌЌћ ћЌЌћћќЌќ  ћЌЌћћЌЌ »   »» ЋЋ»   » ћћѕ »»»»∆»ЋЋ»«»» ∆»»»∆≈¬≠~8!&'4@J<* !!!$*AwЃ¬¬¬≈≈≈ƒ≈≈ƒ¬¬ƒ≈≈¬≈∆∆ƒ¬¬ƒ≈ƒ¬ƒƒƒ¬¬√ƒ≈¬¬√¬ЅњЅ√√ЅЅјјљљЊЊјљљљљљЊњјјљљљљљљєљљєЇЇЇЇЇЄљљљЇЇЇЇљљЊњЊљЉљЊ¬ЅљЊЅ¬ЊЅЅЅњЊЊЅ¬¬Ѕ¬¬¬Ѕ¬¬¬¬Ѕ¬¬ƒƒ≈∆≈ƒ¬ƒƒƒƒ¬ƒƒ≈ƒƒ≈ƒƒƒ≈««∆ƒ∆∆»∆∆∆∆«∆∆»»∆∆∆««∆≈≈∆«∆««««∆≈«»«∆∆««≈∆∆∆∆≈∆««∆∆««∆≈∆«««∆»ЋЌЋ««««∆«««∆∆»»Ћ»«ЋЋЋ«»»»»∆∆∆»»«««»∆≈∆∆≈єђC5'0]И≥МАN1*2Z^G.*/5RДґјƒ«»»««ЋЋ»»ЋЋЋ»Ћћћ»«»ЋћЋ»ЋћЌЋЋћћћЋћћЌћЋћЌЌћЋ   ЋЌЋЋЋЋЋЋЋЋЋћЌЌћЌќЌЋћќћЋ»Ћ»»«∆ЋЋЋЋ»»ЋЋ»ЋЋЋЋ»ћћћЋ Ћ»Ћ»ЋЋЋ»«»  »»»««≈∆∆∆∆≈∆∆Ћ«ƒ≈ƒ¬¬ƒ≈≈ƒ¬≈ƒƒƒƒ≈ƒƒ¬¬¬¬ƒƒƒ≈ƒ¬¬¬ƒƒ¬¬√√¬¬¬√√¬Ѕ¬ƒ≈¬ƒƒƒ≈ƒ√∆∆ƒƒ≈≈∆≈∆∆∆∆≈≈∆«««»«∆∆∆«  « «∆∆∆ ЋЋ ЋћћЋ»»Ћѕћ   »«»ћћ «    ∆ Ћ « ћћћЋћЋЋЋћЌћћ»»ЋћЋ»ЌќѕќќѕЌЌ  ћћћЋћЌќЌћЌЌќЌќѕѕќЌѕѕѕќќѕќќћћќќќћЋћћќѕ––ѕѕѕќќЌЌѕ––––––––————–’ўўўЏЏ¬z9<<>><;:99999:99:;9:<79::99::9;;;<<>>=<<<><<<<>B=?B<@>uДКЧШПЛfshnvГКЮЪЧҐХЫЫХЮЭЩЩЗЦИКРПСЦЫ†ЬХЗrrJ0#%0НsУ†ЮЩ|uZP7GhcyЙПИТХ£¶ѓЭТzЕ=/)17YЖШҐ®¶ђђЃЂІ§¶ЭММШЩЮЂѓґ√јЊњ¬¬ЅјЊЅ¬≈«Ћ»«« ћќќќќѕѕѕѕѕќѕѕѕѕѕѕѕѕќ Ќ Ќ  ЌЌќћЌЌЌћ ћћЌћћЌЌќћћќќћ»ћЌЌ   ∆ћ ћЌЌћ ћЌћ∆≈»» » »» »   »»   ∆∆∆∆∆∆∆»»«∆∆∆»∆∆∆∆∆ƒ∆≠}7!#"1<80&%!!'*>tѓљј¬ƒƒƒјƒƒƒ¬¬ƒƒƒ¬ƒƒƒ≈ƒƒƒƒ¬¬ƒƒ√ј¬¬¬¬њ¬¬јЊЊњЊ¬ЊјјјљЇљљЊљљљљљљљЊЊљєєєєЄЄєљљЇљЇЇєЄєєєєєЇЇљЇљљљљЄљЊЅљљЊЅЅљЊЅЅЅЅЅЊЅЅЅ¬¬¬Ѕ¬¬¬ЅЊЅ¬¬¬ƒ≈ƒ≈¬ƒƒƒƒ¬¬¬ƒ¬¬≈≈≈ƒ≈∆∆≈¬∆∆∆≈≈∆∆∆¬≈««≈ƒ≈∆∆≈≈∆∆≈ƒ≈≈≈∆≈«∆«∆≈∆«∆≈∆∆∆≈ƒ∆«∆≈≈∆∆∆ƒ∆»»∆≈««»«∆«»«≈∆««∆≈∆∆∆√ƒ»»»∆««««∆∆∆»∆∆«««ƒ≈≈ƒјґ¶<2*4_ИБnA*$5DK@- !$(2QКЇјƒ∆«»«»»Ћ»«»ЋЋ«»ЋЋ»«»«»««»ЋЋ  ЋЋћЋЋЋћЋЋћћЌЋ ««  ЋЋћЋЋЋћЋ»ЋЋћћЋћЌЌЋ»ЋЋЋ»»»»«∆ЋЋЋ»∆»ЋЋ»ЋЋЋ»«ЋЋЋ»««≈»≈»»»»«»« »«∆∆∆ƒ≈≈≈ƒ¬∆∆∆≈ƒ≈≈ƒ¬ƒƒƒƒ¬ƒ¬ƒ¬¬ƒ¬¬¬¬¬¬¬¬ƒ≈≈ƒƒƒ≈ƒ¬¬√√√√¬√√¬¬¬Ѕ√¬¬ƒƒƒ≈≈∆≈√ƒ≈∆∆≈≈¬¬≈ƒ≈∆∆≈∆««∆∆∆∆≈∆«»««∆« ЋЋƒ«ЋЋ»«»»Ћ«∆ «»«»Ћћ»∆«≈∆««Ћћ»ƒ«ЋЋ «Ћ»ЋЋЋћЋЋ«»ЋЋ»«ћЌЌ  ћЋЋ»ЋЋЋћЋЋЌќЌћЌЌЌЌќѕѕЌћќќѕЌћЌќћћћќќќќќќќЌќ––ѕќќЌЌќќѕ——–––ѕ–ѕ–––—–џЁџЏџўјy9;9@B<;<><<<::99==8;<:7996647889<<:>><:===<<<=<=?>8=ABEIIFFCAA=>>>><<;;<9;B96;5593;232/31/;*,+($'.('**+51*2I@?EPY[ZY]fvufpsanyz~x~{БДДАud[KGmђґЊ¬ƒ≈≈ƒ≈≈«≈¬ƒƒ≈ƒ≈≈≈ƒ√ƒƒ≈ƒ¬¬ƒ√¬¬√√¬ј¬√¬њЊј¬¬ЅЊјЅЊљљљЊљљљЊЊљЊЊЊљЇљљљЄєљљЊљЊљљЇєљљљљљЊљЊЊњњњљЇљЊЅЊљЊЅ¬Њƒ¬¬¬Ѕ¬¬¬¬Ѕ¬¬¬¬¬¬¬¬Ѕ¬¬ƒƒ≈∆≈Ћ≈ƒ≈≈≈¬¬ƒ≈≈∆»∆≈≈∆«»»ƒ∆∆»∆≈≈∆ћ∆∆««≈ƒ∆∆∆«««∆ƒƒ≈≈≈≈≈» »∆∆«««∆∆∆∆∆≈≈∆∆≈∆∆∆«∆«»»»««»Ћ«∆«»»∆«»»∆≈≈«»»»ЋЋЋ««»»»«»»  ћќ»»∆«∆»∆ЄЭ=$!5cВ≠А^9& 7UP<+"!!")4PСЉј≈∆»Ћ»ћЋЋ « ћ—Ћ«»ЌќЋЋЋЋ»»»Ћ Ћ ЋћћЋЋћЌћЋЋћЌћЋЋЋћЋ ћЌћЋЋћЌЋЋЋЋћЋЋЌЌЋ»»     ЋЋЋЋЋЋ»» ЋЋЋћЋЌќ»ЋЋ ∆«Ћ»Ћ∆ ЋЋ»«Ћ»Ћ»∆∆∆«≈∆∆∆≈≈»∆∆∆«»«∆ƒ¬ƒƒ≈ƒ≈ƒ≈ƒƒ≈≈ƒ¬√ƒƒ¬¬≈≈≈ƒƒƒ≈≈¬ƒƒƒ√¬Ѕƒƒ√√√√ƒ¬¬ƒƒƒ¬¬∆∆≈ƒ≈≈∆≈∆∆∆∆≈∆∆«∆∆««≈≈≈« Ћ    « ЋЋЋ ЋћћЋ»ЋЋЋ  Ћ Ћ»ЋЋЋЋ    ∆ ЋћЋ ќЌЋ  ћћћЋћЌћћ»ЋЌЌЋ»ћћ   ћћћЋћћћћЋЌЌќЌћЌЌЌЌќќќЌЌѕѕѕќЌЌќЋћќќќѕќќѕѕќѕѕ–ќЌќќќќЌѕ––——“—–ѕ–———–Џџўўџ„њw;@B>><:<===><<=9=;7<<<;<;9999999;;;><:9><<<<;<;?==:@=IQVZ\YRIC?<==<>=6:::>C:9:9<<;;<<::::;>799977897655752.gJ1#%"#%''.2598;CHMPZ\S`jsnhhp}PkfwЙГВЕЖДДЖИНКНННННРРНТМЛСИВВa^1&T2*5\yАsZ5$$8A@5'!!$,9[Щљ√≈∆«»«Ћ»   ««Ћ«»»ЋћЋЋЋЋ»»ЋћћћћћћЋ»ЋЌћЋ ЋЋћЋЋћћЋ  »ЋЋЋћћЋЋЋЋЋЋЋћћћ»«»  »  ЋЋЋЋЋЋ»»ЋЋЋЋЋЋЋЋ«ЋЋЋ»«»»»«»»  «»«»∆∆∆≈«≈≈∆∆∆∆∆∆∆≈≈∆∆≈¬ƒƒƒƒ¬≈ƒ≈ƒ¬ƒƒ¬¬¬¬¬¬¬ƒ≈≈ƒƒƒƒƒ¬¬ƒƒ¬Ѕ¬≈ƒ¬¬√¬√¬¬ƒƒƒ¬ƒ∆≈ƒ√ƒ≈∆∆∆≈≈≈ƒ∆∆«∆∆««∆ƒ≈«  « ∆«∆∆««Ћ« ЋЋ«∆Ћ»»∆« «»»»»»ЋЋЋ∆ ««»»Ћ»ЋЋЋ«ƒ»»Ћ»Ћћћћ∆»ЋћЋ»ћћћ » ћћЋћћћЋЋЌЌЌћћЌЌЌћЌќќЌћќѕѕќЌќќћћћћћќћѕѕѕќѕ––ќ»ћќќќЌѕ––––––––—————џџЏЏџ„Љq:>@><><<<;;;;:<:<<9>><;<;<=:79:79<;<<;<=<:;9;==?<<;8;;;9:999<99;><;;<>>A8Гб* "%#%&!****'*2532747755=BHPPY\aaefjrpiwvy}ЛЙ{ВИЦ}ej5d.Gc}ИЕЙНЛЪЛМУТНcX@ !\`zЖ£СПЬlUTX^\c_VYciwЕХШШП|G3&cdД}ЧФЦЫГСНЛЕXqZ38GOV|†°ЭС•P@//(rvТЫ§©®±≠≠©®©ђІ©©І§І§§ђ®ІЂЃЂЂҐШФФЧЩФѓЇљљјЅ∆∆≈ЌћЋЋ»≈∆ ћЋ ЌѕѕќќѕѕќЌЌѕ–Ќќћћ »   »ЋћћЋ»  ћћ   »»  ћћ»  Ќ ∆»∆»∆∆∆∆∆∆Ќ≠Д8 %%*/f†ЊЅƒ∆»»»Ћ»∆«««« »ЋЋЋЋ»«ЋћЋЋћЌЌЋћћћЋ»ЋћЋ  ЋћћћћћћЋ  ћЌћћћћћЋЋЋЋЋ»ЋЋ»««» ћ    ЋЋЋЋЋЋЋЋЋЋЋЋЋћћЋѕћЋ «»«»«« ћЌ Ћ»Ћ»«»«ћ∆≈∆» ∆∆∆»∆≈≈≈ƒƒƒ≈≈ƒ¬≈≈»∆¬¬ƒ≈¬¬ƒƒ¬¬¬≈ƒƒƒƒƒ¬¬¬ƒƒ¬¬¬ƒƒ√√√√¬Ѕ¬¬ƒƒƒ≈∆≈ƒ√ƒ≈«∆∆≈≈∆≈ƒ∆Ћ«≈∆∆∆≈∆  Ћ Ћ««∆∆« Ћ ЋћћЋ»Ћ»»««  Ћ»Ћ»»»ЋЋ   »ЋЋћЋћћћЋ«ЋћћЋЋћЌЌ»»ЋЌЌћЌЌЌћћћћћћЌЌЌќћќЌЌћћЌЌЌЌќќќќЌЌќѕќћЌќЋ ЋћћЌЌѕѕќќѕ––ѕЌќќќЌќѕ––ѕѕѕ––ѕ–————ЏџЏЏЏ’Їn<=?><><><;;:9>:9;;9<<<;;9;B:9;<:;;;:;4;:99<9;;??>B@GPduҐƒ®ЧВ`HA=>A<::<<>?@<6;<98799778;99;877=:9;<;;9<<9=2Щх")5,++-*"!$#'#"+$)$&%(#$&%'*,,//--28<<59<<<=<<:<9F<;=<:79<;;6;=<9;88988;;8:::7::<<;<=?CCYМSKпькЈі©C7=<<9:9:;<;<<<<>;;9:<;;9;;;;989C;7;9<8;<9;84Чл!>VMDBIG>:8;<7555-/30,,##'''%%"'!!!#%'! %+"#%,2331599:<;;?DGEQRUY]dea_Z[[[isЗiИ}|ГЖДИБm_C4(!Cd|ЖЛРСКЙВИИЙ\\80 4ksЗХЮ£БАsTJRkДДШЧЫҐЬЮЮЬЬ°ЮЫЮХЦЙЧЩЧЩЯЯЮЭҐЯymG8*>fВ•ЮЯЩwm-#+8dkПУЪЦХЩ¶¶®£©ФЛZD'/YaПЭ•ІІІЂЂЂђ∞≤®•Ґ•І©≠∞ЄЊњ¬∆∆« ЋЌ ћ »»ЋќќќЋЌЌ ћ» »∆∆»Ќ»∆∆» ≈¬ђЗ7"$***$!'*BАЈЅ¬¬≈≈ƒ√ƒƒ∆≈≈∆≈ƒ√ƒƒ√¬¬¬ƒƒ¬ƒ≈ƒƒј¬¬¬√¬¬√√¬ј¬¬¬ЊјјјјњјЊЊљљљЊ¬ЊљљљљЇЇљЊЇєљљЊЇЇљљљЇљЊњЊљљЊЊљљљј¬љЊЊƒ¬ЊЅЊЊљЊјјјЊ¬¬¬Ѕ¬¬¬¬Ѕ¬¬√√¬¬ƒƒƒƒ≈∆≈ƒ≈∆∆≈ƒƒƒ≈ƒ≈∆≈≈≈∆««≈ƒ∆∆∆∆∆»∆∆≈∆»Ћћ∆∆∆∆∆∆«««≈∆∆∆«∆ »«∆≈≈«ћ«∆∆∆∆∆∆∆»∆∆∆»«≈≈«»«∆«««∆∆««»≈∆»» «∆««∆∆«≈∆∆«»»»««»»«ћќ»ћ∆∆≈Ћ≈©В/-*5Zt©mQ5"5D:*$")->??<<<<9;=>>?<9==9;68<;::98;99@<::::79:<<<<=>=BkЗDDч€ъ—”∆J/>=<999:;;;9<;;;<<99:9;<<989868;8997<<;<;>:8РЉ"UZLMLLLJJJKIJHDCEIVRKNE@<8345224/,,,')')%'*!#%!%%""%!&')(#)0*+337889BB=IMSQQSVZZ^ekb`eM[^[szМ|ПАВКААЦxZN,.,3ezВМЦУШПЛМНТЩЬ•С†ЧШ§ЬЬЯЧЩЩУ¶Ы_Z[ZezШЫЮЧРz9Z$Cj}ПЫУУПККГЕ|Хu`F<:<:999:<<=<<;9959;:9=?9;;<<;9:7999<<<=<>:8<АСMMц€мЁ„≥F2B::@:999997979;<<99;99:947998999:767;8:<<<8ЭгdVOMMMLPQPVLQIJNNR\ika[TMJIHHGGKGDDMHC>?>;:85500,'/*#'%&$%#%!#%!%""''$,0.24589:=>=;<<::;;;;9;::;9;;98;;77:;;;<=;99=:7:<:=>=:=<=;ДДXs©ƒ•Я†|<:><:A;::;;9999:=<<99@99:94<:99::::6679998<>4£„kRMNLLLNLMLFLKILPZky|{k^TNLOLLMMLNPMMLMMJJJJGJJKEHC>==>>720152-",/'$'!%"!" "$!"!"$*,,2219=@UЗGxЖХЫЙx_<>=<<;<<;<;9;9;9;9;9<798;;=97797;9<53®б'_MMMMKLMJKJJKKFIYgwБҐєђЧ|jVMOLLOMKLLNNNNMMMLMMOTOOWLJQLLLJLVQJMNHDFA>><544520.01$.'''&'%%$ !"%&!#"%&#&*)(./4@B>>AEKRWaa\dk{uptzxvynhelfjББЦИЛРХСРШПШyg#;"2ЗЫИКМКИЛБДВПrW/%!JRРЬЬВrR:57BgzПioquzГКХУЛnk9 F3ЗБУЮЧПwRTZjБҐ¶Ъ°§°°ЯЯ••£§ЯЂЬЭХХЧЧШЬЯҐ£Ґ†ЪtTBPWjРЯђ±≥µґєљљЊЅ¬љЈЈЈЉ√Њ¬ƒ»«»»»»»»»«∆≈≈∆√¬ƒƒ¬ј¬¬¬ЅЅ¬¬¬ј¬√√¬ј√¬¬јњЊјјЊњјјјЊјЊјЊљљЊљєљљљљєєљљљєљЊЊљєљЊЊљљљ≈јєљЊљљЊЊ¬¬љЊљЊљЊјњјњј¬ƒ≈ј¬¬¬¬¬¬¬ƒ¬¬ƒƒƒ√ƒƒƒ¬¬ƒƒ∆¬Ѕ¬ƒƒ¬≈≈∆≈≈∆≈≈≈∆»ћЌ≈≈∆ «≈∆∆»∆«»»«≈≈∆∆∆∆«««∆∆∆∆∆≈≈»»∆≈∆∆»≈≈≈≈«≈≈≈∆∆∆∆∆ћ∆ƒ≈∆≈≈≈∆»«∆««≈∆∆»»»«»»«≈«»»»∆»«««∆»»»∆∆»»«≈≈ƒ√ЇҐq()%1P[v=0%&/1*"!$).EАЄє¬∆»Ћ»«ЋЋЋ«∆»ЋЋ»»»»»«ЋћЋ ЋћЋ  ЋЋЋЋ»» «  ЋћЌЋћЌћ »ЋћЋ»»ЋЋ»»ЋћћЋ»ЋћЌћ  ћ » ћЌћЋќЌќћ   ћ»∆ЋЌѕЋЋЋЋЋ»»«∆«  ћЌ»ЋћЋ»∆∆∆»≈∆»»«∆∆∆»∆≈≈∆∆ƒ¬ƒ≈ƒƒƒ≈∆ƒ¬ƒƒ≈¬√ƒƒƒ¬¬ƒ≈ƒ¬¬¬¬¬Ѕ¬ƒ≈ƒ≈≈ƒ√√¬√¬¬¬ƒ≈≈ƒ≈≈ƒ¬¬ƒ≈≈≈≈∆∆≈≈∆∆∆∆∆«««≈≈∆»  Ћ»»   »Ћ    «  «   Ћ Ћ«  ЋЋ»Ћ    ЋЋћЋћћЋћћ–ћ  ЋЌЌЌћЌћћЋћ–Ќћ  ћћћ ћЋ«∆≈∆≈≈≈∆««»»ЋћћћћЌћћЌќќќѕќќѕќѕќѕѕѕќќќќѕѕ–––ѕѕ–––ѕѕѕ––ѕ–––ѕ–÷ЏЏў„ѕЈl@=>>@@=<<<9;;<<8<=<<;;:<;=9::::9:77<9977>;;;<<<<><8<<;<<;:99:997;99;9<<778:89;997:9:97777<;A96•џ5_MMMMNNHLKJJKHBKeup¬“∆∞†ИbORPOOMLLOMNNPOMMMOOMOPOONLNPPOPPTPMRZPNZNNRRUZZYWWWURPJDC>>;550.+')/''("$ *%! !!#!!''**,1/3847=KGHYYW`dj`eqyxАЖРКЗГДЕПfbb^gjszЙЙВЗЙЙКФДИИg*9 0`wЫЦЧЛЕzВД}wГ{k9)#*EHИИХЧ{rJ-!/@^rЮЛУЩШФТИССНУЦЬЬЧЪУШЦШЩЯЩЯЫХЬЙhXTWrrРЬҐҐХКRe%7S•ИҐЫЭҐҐІђђІ¶§Т{TbhjЦ£ѓє≥ґ¬љјјЅ¬ЅЅЉљЅ¬Њј¬≈∆«««≈ƒƒ≈ƒ¬√¬¬¬њј¬¬ЊЊјјЊљљЊЊЊљЊљЊљљЊЊЊєљљљєЄљљљєєЇљЊєљЊЊЊљљєљєєљЊЊєљљљљљљљЊљљЊљњЊњ¬¬јљјј¬љљ¬ј¬ј¬¬√√ј√¬¬¬¬¬¬ƒ¬¬ƒƒ≈ƒ≈≈∆ƒƒ≈∆∆≈∆∆∆≈¬≈««ƒƒ∆∆»∆∆««∆ƒ∆««∆≈∆«∆≈∆∆∆∆∆∆»«≈≈«»∆ƒƒ≈≈≈ƒ≈ƒ≈∆∆∆∆∆¬ƒ∆∆∆≈∆∆∆∆≈∆««∆«ЋЋ«∆∆∆«≈≈«≈∆∆∆«««∆»»»«∆∆»«ƒƒƒ∆ЅЯo*)(/CYm5, (4/(#")0KЗњЇ¬≈«««∆»»»«∆»»Ћ≈«»»«∆»ћЋ  ЋЋ « ЋЋЋ  Ћ  »Ћћћ» ћЌ »ЋћЋ»»»ЋЋ«»ћћЋЋћЌћ »   » ћћЋ»ћћЌ »   »»  »∆ ЋЋ»«»««∆«≈≈«∆ЋћЋ«∆«∆»≈∆∆∆«∆«∆«≈ƒ≈≈≈¬ƒƒƒƒƒƒƒƒ¬¬ƒƒƒ¬ƒ¬¬ƒƒƒƒƒ¬¬ƒ¬¬¬¬√ƒƒ¬ƒ≈ƒ√¬¬√¬Ѕ¬≈∆ƒ¬≈∆ƒ¬√ƒ≈∆ƒ≈∆∆∆≈≈∆∆««∆≈«≈∆«∆«∆»»«∆«»«»««∆«« «∆∆««»« ∆   »«»ЋЋ Ћ ∆ћЋћЋ Ћ ћ    ћЋћ»ЋЌЌЋЋћћћ »»» ∆»¬¬¬Њ≈Ї¬≈≈≈¬∆«»ћћћћЌЌЌЌќќЌќЌќќќќЌѕќќЌЌќќќЌѕѕѕѕќ–––ѕќѕѕѕќѕ––ѕ–ЏџЏЏ„—Јj@;==>==??<<<9<<6<<=<<<9;89:99:=<<7799897:9<<=<<<=<8957::9:;A;2ір9^KMNNPQKOLHJKJCJ|qIcрьћґƒ≤ЗRVPOPMLMNMPMMMLLOOOMMOLNLLLRQPQRQPPPPOORRSRSRSRRTXXTXXTTV]ZORZMK[ZRKMQH><@FРП°Я°°ҐЯ•ђ®©¶ЮХppwuВЪ©ЈЊЅЊЊј≈≈√ ћ««√√«√√ƒ≈≈ƒƒ¬¬¬¬ЅЊјЊЊљљЊЊЊєљљљљљљљјљєЇљЊљЊЊЊЊљљљЇЄєљЊЊљљЊЅЅљЊЅЅЊЊЅЊ¬ј¬√√¬јј¬≈ƒ¬¬¬¬ј¬ƒƒƒ¬≈¬¬¬¬≈ƒ≈ƒƒ≈≈∆≈∆≈»∆ƒ≈∆«≈∆∆∆≈ƒ∆««∆≈∆«»∆∆«««∆««»«∆∆∆≈≈∆∆∆∆≈≈∆∆∆∆«»∆≈≈≈≈«≈«∆∆««∆∆«≈∆∆∆≈∆»» ∆∆∆∆»«»»»»∆≈∆»«≈«∆∆∆∆»»»«»» »«»»»≈ƒƒЋ«Яl'##-@S^8*!(,(&"!$*/KИњ√ƒ«»«∆∆ЋЋЋ««»ЋЋЋЋЋЋ»««Ћ»» ћћЋ  ЋћЋ «   ЋћћћЋ» ќѕћЋћЋ  Ћћћ»ЋЋЋЋЋЋћћЋ» ћћ ћЋЋЋЋћЌЌћ   ћ»«»»  ЌЋЌћЋЋЋЋ  ««»«ЋЋЋ«∆»ЋЌ»∆∆«««»»»«∆∆∆∆ƒ≈∆∆∆≈≈≈ƒ√ƒ≈≈ƒ¬¬ƒƒ≈ƒ≈ƒ¬¬¬ƒƒƒ¬Ѕ¬ƒƒ¬ƒƒƒ√√√ƒƒ¬ƒ≈≈ƒ¬ƒ≈ƒ¬¬ƒ≈∆≈≈∆∆∆≈ƒ∆∆∆∆∆∆«≈∆∆ Ћ Ћ««∆«»«∆«««∆ «  Ћ»»∆«      «»Ћ  ЋћћћЋћЋЋћЋћЋќћЋћћћЋћЌЌЋЋћћЌћ   ћ  »»∆ƒ≈≈∆∆∆∆∆««»ћћЋЋћЌЌќќѕќѕќѕќќѕќѕѕѕќќѕѕѕќѕ––ѕќѕѕ–ѕѕѕѕ—–——–ѕ–ўў„„÷–ґf@C>>>=??==<=<=A9:;;<;<;98788:<<:<99;:;=998:;;<<<==<=;CAhh`SJGA?==;;;:<;978;7;;;9;798;;;::<9;=93;:55;;9;=<80µо 5[JJNPNPPPMJGHHEPni8Zъ€÷ЉѕпЦeXSPPOPOMMRNMNMNROPMMNMMLMORRTRQPRRSRPPQPPSVRUPRXUQRTRSRTRPQRRVQVTRSVURRRX[VVXPNWNGORJG?7;8501+*($%"! !"!"! !$%'#(+,288::<@DIHQUY[cjQpYWГ[ЗНКИВЖТЙЙУНЖЙOH344РЙУХЛ{Vi9QGbЙБ~wxsjПР£•§©БS#1'*FKyЫ†££•®®І®Іђ±ІЪЦУКТЪѓ√√Њƒ«««»ќЋ«ћ ∆∆≈ƒƒјљљљљєљЄєєєЇљљЇљЊљљЄЉЇЇєєЇєЊєљљљЊљЊЅЊљљљљјЊјЅ¬јєЊЊЅЅ¬¬¬¬љ¬¬¬¬Њ¬¬¬¬¬¬¬ƒ¬ƒ≈≈≈≈≈¬ƒƒƒƒƒ∆ƒ≈≈≈≈ƒ∆≈∆≈≈∆∆«≈≈≈∆∆≈∆≈∆≈ƒ≈∆∆≈∆∆∆≈¬∆∆∆∆∆∆∆∆∆∆««≈ƒ≈≈∆∆««∆«∆»∆∆∆«»∆∆∆∆≈∆«≈∆∆∆«∆∆»»≈ƒ∆∆∆≈∆»»∆≈∆∆»∆∆∆∆∆ƒƒ¬∆ЅЫk!$ &>O_<,!%*'!#),FИЇљ¬∆»»«∆»«»««»»ЋЋЋ»»Ћ»»ЋЋ»»ЋЋЋ« ћЌЋ    ∆»ЋћЋ»  ћћЋЌЌћ» Ћћ « ЋЋЋ»ЋЋЋ »   « ЋЋ»«ћЌћ»«» ћ∆»»» »ћћЋ «»»Ћ»»«««∆«««∆≈∆∆»∆»∆««∆∆∆«∆≈∆∆≈ƒ≈∆∆ƒ√√ƒƒ√ƒ≈≈≈¬¬≈≈ƒ¬≈ƒƒ¬¬ƒƒƒ¬¬√√√¬¬¬√¬√ƒƒƒ¬ƒƒƒƒƒƒ≈ƒ√√ƒƒ≈ƒ≈≈≈≈ƒ∆««∆∆∆∆«≈∆≈««∆∆≈∆≈∆«««∆«∆«∆∆««»»»∆∆ ∆ ∆∆ «ЋЋЋ  ЋЋћЋЋ»  ≈    »Ћ»Ћ«ЋЋћћћЌ ћћћћ ћ» Ћ»«≈«∆∆∆«»»Ћ«»ћћћЋЌќѕѕѕќѕѕЌќЌЌќЌќќќЌЌќѕѕЌќѕѕќЌќќѕќќѕ–—––––ѕ–ЏЏўў„ќґe=@===><<;><=<==99;;;<=;988:8;<::<:<<;=>;9988;;;<;<===>8?D@<;B?==<6;<:<986;<::;;9867899;9;<:;=;3;877;<9<==75єе :\KMPPPNQQPOKMLCOs`%rщэАwЉ ∞f^XRPPPPOQOMJMNNPPRPNOOQOQRRTVUVSSSVUUSSPPVVRTRRYSPQRRUSSPRRPRSVVTSVXRRTSUSSTXRURRTT[RP]MQTOPMLCFC?>>>B?885.+,)%'*'&%"$! ''"'%&.,*/.*5<<9EMNNPT[WZbhehTmgl|Г}yПТИКФНАНБЫЕРТНТЛЙТЛРСБЙНИНЖ<<;5wvЦЗМДsv||{ЖСuf455@LMМЙПЮsi./[rЙБЕНЕrxЛЭЬЬxR*#*61ИuҐЭЪШtH1?ACkyМЖНЗ}АБЯ£Я®ЭЖQ1&!V5gГЭІ¶©®ѓѓ∞ѓ≥ґЈ≥ґЉЊЊј¬≈∆≈√≈ЋЋ ≈»ѕ»»»«≈ƒЅњјљЊЇЇЊјƒњњЊЊјЊЅЅЅЊЊјј¬Њј¬¬¬Њ¬¬¬¬¬ƒƒƒ¬¬ƒ∆∆¬ƒƒ≈√√ƒƒƒ¬ƒ≈≈∆≈≈ƒ≈≈ƒ≈≈∆ƒ≈≈∆∆≈∆∆«∆≈∆∆«≈≈∆»Ћ∆≈∆«∆≈≈∆∆≈ƒ≈∆∆≈«»»∆∆∆∆∆∆∆∆≈«≈≈∆««««»«∆»» »«»»»«∆≈∆«∆≈∆«»«∆»»∆∆∆∆∆∆« ќќ∆∆∆»»∆∆»∆≈∆≈¬ЈЫg$$%*>N[8)*-*%%$!#),HИґ≈≈∆»»»»Ћ»ЋЋЋћћћЋћћћЋ»∆ЋЌћЋЋЋЋЋћЌЌћЋ ЋћЋЋћћћЋћћЌЌћћћЋ« ћћ « ћЌќЋћћЋЋ«»  »»ЋЋЋ»ћЋћ   Ќ–ћћ  ћ   ЋЋ»»»Ћ»»»»»««««∆«Ћ»∆∆»»» «≈∆»∆∆«∆ƒƒƒ∆«≈√√ƒƒ√√ƒ∆Ћ≈≈ƒƒ¬ƒ≈≈ƒ¬¬ƒƒ¬¬ƒƒ≈≈¬¬¬¬¬¬ƒ≈≈√ƒ≈ƒ¬¬¬≈ƒƒƒ¬ƒƒƒ≈≈≈∆≈∆«ћЋ««««∆∆∆  «∆∆ «∆« »«»«Ћћ««« ЋЋЋ  ∆   Ћ»ЋЋЋЋЋћЌ–ћћЋЋЋ   Ћ ЋЌћЌЋћћћћЌ–ЌћћћћћЌћѕќ–—ЋќЋЋЋЋћќ–ћћЌЌЌћћЌќќЌЌќ–ќѕќќќЌќќЌЌќќѕ–ѕѕќѕќЌќѕ–ѕѕѕ–—–––––—ўЏўў÷ѕ≥g====<=<<<;<=;;998999:;<9:9<<<;:9;<<=><:79;<6=<<>>><<=A===;<=:9999;999::6639;<;<;;::;8949777<<8<><<8µЏ BZNNRSQQQSQPOONNYh`G}≥ЩtБПҐxkQVPMOOOLMMNOQPNRPRRPOMOORRRRTURSSVTTUVVRSXWSVVS[QLPSUUSSSTSPSRVVSRSWUSRRTRRTVQPSSRRRRRTORRQOJMMOMKOJIXUQOJLJJJFFJFEA8>:+*)(,'))"!&!$! " "!$! !!&""(-.'&*-.237<@FGKQXXW\cc_kqzlx|~В}ГИЕЛХ}БНЖyf@R%28Svy{А}АА~В|~Л\V  kkЙДЗКxrbhotzsИU88BOPrБПУ{У9/5`}УЦКАЗКРРУrЕN422DFYЫЦХШРV5)$!GSЛСЮЮ†£°І£§§§І¶§•••£®ІІ®ђѓ≤≥≥≠®•Ґ†Ґђ∞ЈЊ√¬—ѕ¬ѕ— ѕ—Ќ »»«»∆≈≈√Ѕ¬¬¬њјЅ¬љЄЅЅ¬¬¬ƒ¬√ј¬¬¬¬¬ƒƒƒ¬¬ƒ≈≈¬ƒƒƒ≈ƒƒƒ≈ƒƒ≈≈≈√ƒ≈≈∆≈∆∆∆≈≈∆∆∆ƒ≈∆∆∆≈≈∆«∆≈∆«∆ƒ≈∆∆∆≈«Ћ»∆≈∆∆∆≈∆∆∆∆≈∆«∆≈∆«∆∆≈∆«»«∆«»«∆≈∆««≈∆«««∆∆»∆∆≈∆∆∆∆«»»∆¬∆∆»∆∆∆∆∆ƒ≈ƒƒЉЪf$$'-?TY5'&5*#!*-FИ≤ЇЊƒ«»»«»«»»»ЋћЋ«»ћћЋ«»ЋћЋ»ЋЋћЋЋЋЋЋ ЋЋЋ»Ћћћћ»ЋћЌћ ћЋ « ЋћЋ«  ЋЋ»ћћЋ»«»  »ЋЋЋ»∆ЋЋЋ»« ћћ»    »»≈« »»«»«»»»«∆««»«∆»∆∆≈∆∆∆∆≈≈∆»≈ƒ≈≈ƒ√ƒ∆«≈ƒ√ƒƒ√ƒ≈≈≈¬ƒ≈≈ƒƒ≈ƒ√¬¬√¬¬¬ƒƒ≈≈¬ƒ¬¬√√√ƒ√¬√≈≈ƒƒƒ≈ƒƒƒƒ≈≈ƒ≈≈≈∆∆∆∆∆≈∆««»∆«∆««≈∆∆ «∆«««≈≈∆∆«∆∆ Ћ»»»«∆ƒ∆   ∆» Ћ  Ћ»ћ»Ћ « ∆     ЋЋћ»Ћ»»ЋЋћЋћЋ ћ ћЋћЋЋЋ»Ћ»ЋћћЌЌЌћЌћћЌЌЌћЌЌЌќќќЌќЌЌќЌќќѕќѕѕ––ќѕќќќЌќѕѕѕѕѕѕ––––––—ЏџЏ№ўѕіgC>=>==<<==C=:9::=;<:9488;;;;:<998797;49999;;9<;<==456/77**.%&**%!$#!!!"!$%(*./27:>5<;:FOMOTYZ[dflld^dcpndryntyxyГzyИxxmTS#)*2]twИВГГ}}БИzr$/Py~МЕu`]R]`wЛyaGKOYerЖСХРlQ2PЕРШПЦЕtrx}В}ПМТТТУШСЫШЪЬЩЮЫЧЪСЙКМКРУЬЯ§І®НВ7!.5E^П°°¶®Ђ®•≠ђ≠∞Ѓ®ђѓ≥єЄґј¬∆ »≈«Ћѕќ»»ѕќЌЋ««≈»≈≈∆≈≈ƒ≈≈≈ƒƒ≈≈∆ƒ≈ƒƒ¬¬≈≈∆≈≈∆∆«ƒ∆∆∆«∆«««∆≈∆∆∆≈∆∆≈ƒ≈ƒ∆««∆∆∆≈ƒƒ≈∆∆≈«»«∆≈∆»Ќ»«∆∆«∆«««∆«»«∆≈∆«««∆∆∆«∆≈≈∆«∆«∆∆««»»»«∆∆∆»∆»  »∆∆«»»»»«»≈»«≈ЇШd"#$*?@A<<<@=;:<:::=:<:9<;;;8::<89<<<=<9;99::;;<<<<8:;<;9;;<<;=<>>?:<<==<<;<;5:8;;=<<><::;9:97<::79;8>NPVПКПЛЛЙЛННРФЦУПНМЙВЗДНМРТШШЧСЦpNBONGr|ЭШЭТ`fMXЙКЗВЖЛПФЧЩЫХТlW86AM[ЕЯ©≠ЃЂѓ±і≥≥ґґЈіµњ¬¬«∆√√«Ћѕѕ »Ќ»»«»«∆∆∆≈ƒ≈ƒƒ√√≈∆∆ƒ≈∆∆∆≈∆∆≈ƒ≈∆≈ƒƒ∆∆∆≈ƒ∆««∆≈∆∆≈ƒ≈∆∆≈ƒ∆∆∆≈ƒ≈≈∆∆∆∆∆∆∆∆≈∆≈∆«««≈∆∆∆∆ƒ≈∆∆≈≈≈≈∆≈∆∆∆∆≈∆∆«∆≈∆≈∆≈∆»«∆≈∆∆«∆∆∆≈∆ƒ≈ƒƒЉШd!$7BE*"$1)"!$.2NПљљ√ƒ∆∆«∆«»»««»ЋЋ∆«ЋЋЋ«»ћћЋ»ЋЋћћћћћћћћћЋЋЋЋЋЋ»ЋЋЋ « Ћ « Ћ  «  ЋЋ»ЋћЋЋ »«ћћЋЋЋ «» Ћ»»Ћ»  ћћћЋ»»ЋћЋ»»«»≈«»»»«»»»≈ƒ««»≈««««≈∆∆»∆∆«∆ƒ√ƒ≈≈ƒ√√√ƒƒƒ≈ƒƒ¬¬¬¬¬Њ¬њ¬¬¬¬¬¬Ѕ√≈≈√¬¬¬√ƒƒƒƒ√¬√ƒƒ√¬√ƒ√¬¬ƒ∆∆∆∆≈ƒ≈≈≈≈≈ƒ≈«»»∆∆«««∆ « ∆∆«∆«≈∆«««« «»««»Ћ ∆    «« Ћ   ∆Ћ»Ћ  ≈¬    ЋћћћЋћЋ»Ћ»ћћћЋЋћЋћћЌћћћЋћЋЋћћЌЌЌћЌќѕќћќќќЌћЌќЌЌќЌЌќќѕќѕќќѕѕ–ќќЌќѕќѕѕќЌќѕѕ–ѕ–——–ѕўЏЏў’ ≤dAC>=>=<<9:<=@=<<<:::<:<<:=<<<99;958<<<==;;;;>::<<><;;=<<;<:<<<<<<<<<79:<=;<<<;7:999;;<<<:::9999:::9<<;?<<98≈÷ WTMRSRRSNQNOOQP[rbZnА{rha`ZXYTRRTVRPMRRVTSUUUSVVVSURQOQTTVVRSTTVWVWVXUSYVVTRUQMVSSVRTURTTSRXXVRSSWUWXSVXVXXVSVUTXVXXVTVTRROJMPMOMMMMLKMNNNMOQPLLPNQMLMJJJMMMPOPVQQONMRMpГРРЩЫНЦЯФГpaUNKKHFIIKKA<9<7253,*+'&# !&$ !$!!"!'$!"$')'*-/458=CCFG@MTPSX[ajegmrrzxytpNko]jfЙКНБЗЕЕЗММПЛСUW +!Yz~ЛЛЕЕВ{yz~ГЕЛЗПЛКИКФМЛНЛУЛИ†xkdflezДЛЛЙАPO :<<7:::98;<<>:<:99::=:;;;9;:<:989;;;<=<===><<<==<<<><=>B99<<<<<<<=99=<><;;<<9::96789<98::;:::99:9;9;;<>8< Ё ]OLOSSPURQQRSTY_kc]bZ^ZZWWTWTRSTTVTSQTTTRRRRUVVVVRUSRPROUXXSSVXXVVVVYSSXTVVUVRRVSXVVSTTVTSRXXVVVVTTXVXYVSVXXUWXVVVVURRRTRPMLLLMPNPQOOMPNPPOMPNLLPPRQNOLJLOOOQOPWPPSQRV[ЖЙШЯ©ђ†ЮЃЄЦИo[UURPSSWZaZQSZeONcXORMEJF@=>9.23-*$+//%$$! !$# %'*-18:>CKMQWWS`fVffrttryГВyГННМЖehOSYjrАЬКПУЛСКЗХИХККУКЛРСТЛКНИЛНВЛДИ^2"D]ДЙЗЙx6'/14B=><:<<<:;<<<=9;97:;5;9:99889997688<<;=<=<==;9<<:<>;>>>>>=;===>>;<<<<;:9:89778:77=:;997999799<<<>87№” ^NPSOTRRTSTW[T[che_Y]^ZSRXXXXXXXXXVVXZZVVUSRSSTVVRTRRPRRUVVVUXYXXVVV\UUVTTVVVXVRSXVVXTTTVSSVVTXXXTVXUXXVSRXXXXXVVSVVRQRTUPOOOJONNNPQONNMPMOOQMLLMNPPPMMIMQOOQOORQPSTQZo|Піћ µЯљ”ҐҐt]XUQPRPOPKSUUVZWRXVXXXTXZVSSPQRLMIJJRI??A@@?5--))+,%"$%()&"150:?CQOMSZ_lmerА{{З~|АЙЙДЗКЙЙМКРНЛРНРТФЦУСТФТСТФПo2$}}ЫЙККЕxtvutxГИS;#./'imГЭСШ8<!DВФЗvБВstyАЙЙИФc,""@cФРЧЦЗE68B7;|ИЬtqvxyzЕЩШЧЬ}J+!)*&z~•££¶ђђђђѓ∞≥≥≥ґґЇЊ¬¬¬√≈«∆»»Ћ ћ «ЋЌ–––ќќќ  ћћ»»«»»∆∆∆««≈≈≈≈∆∆««»«»»ЋЋ≈««∆∆ЋЌ» ≈∆«Ћћ∆∆«»«∆«»»∆«  ∆≈≈∆«∆∆∆«ћ∆∆≈√ЈЦa*%!$+.( %#! $23NУњ≈ƒ∆∆»Ћ»«∆«∆«Ћћћ»«» »««»««»ЋЋЋЋ ЋЋЋ»»ЋЋ»««ЋЋ»»ЋЋ  ЋћЌЋЋћЌћЋЋЋћЋ»»Ћ»»»ЋЋЌћЌћћ » ћЌћЋћЋћ» ћћЋ»»ЋЋ»ћЌЋћ»»ЋЌЌ«ЋЋЋ»»»∆Ћ«»«««∆∆««≈≈««∆∆∆∆∆≈≈≈≈∆≈≈≈≈≈ƒ≈ƒ√¬√≈ƒƒ¬¬ƒƒƒ¬ƒ√¬√¬¬≈ƒ¬¬¬ƒ√√√ƒƒ√¬Њ¬ƒ√√√ƒƒƒ≈∆∆≈ƒЅ≈«∆≈∆∆≈≈≈∆««∆«« ««  ∆«   ∆≈∆ Ћ»»ЋЋ       ЋћћЋЋћЋћћЌЌЌћћѕћ–ѕЋЌЌЌћЌЌЌћЋЌћЌћЋћЋЋЋћЌЌЌћЋЋ–ѕЌќЌЌЌќќќќЌЌЌќЌЌЌЌќЌќѕѕќЌ––ѕќѕѕѕ–ѕѕѕќЌЌЌѕ–ѕќѕѕѕ––––––ўЏўў”ƒЂa>@>=<<<:;<<==:<=:78:<<<<:;;9:88987999<==8;;<;99;<::;9:::::;9<<=<<3;<89<<><;;;99:;9;978766=897:9:;;9:9?A<><3ѕѕ!UWZ\ZZ^]PRZmvosvogddgpyg_a^`^^YZ]ZZ\Y\ZT[XXXVX[ZVXWWVWWXXXXXXXZXWXSVSVVTXYVVVVRXXUUZTTRXSXVSTXVXVXXVZYSVXYWXXVVVSVSSURSURQPUCMNPNPQQPNKQOMMOMMRMNNNNPOLRPPPPOOUPPUQP]ВКKxхъ„»® «©ЧБa[UPRROOOJSUUVWUUWWVTVXUXYUXYXZWZXYTUTVV[TXWRRQPOMIGGEB;87855+++('&""! !! "!"#),-454,44/cn•ЫЫЯVX$)*'AВРЮЩШЩҐЫЩЩЬЮЮЬЭЭ•ҐІ®¶©©ЃѓЃ±≤≤і≥Ѓ®†§§®±Њ≈»«» ЋћћЋ ќѕЌћЋћ »  «∆∆∆∆∆∆««≈¬∆∆∆≈∆«∆≈ƒ≈∆«∆≈∆∆«∆∆«»∆≈∆∆«∆ƒ∆∆«∆∆«∆∆Ѕƒ∆∆ЉШd*%&($!" !".0NФњњ√∆∆∆«∆∆≈∆≈∆»ЋЋ»»»»∆≈»Ћ»∆« ЋЋ ЋЋЋ «ЋЋ»«« ћћ»«»»»∆ЋЋћЋЋЋЋћЋћЌќћЋЋ»»ЋЋЋћЌ     ∆»» ЋЋЋЋ ∆»Ћћ»∆»»»««»»Ћ«»»»«≈«»»∆∆«∆»≈∆∆∆∆ƒ∆∆∆≈≈∆≈∆≈∆∆∆∆≈≈≈ƒ¬¬ƒ¬≈¬ƒƒƒƒƒƒ¬ƒƒƒƒƒƒ¬¬√¬¬Ѕƒ∆≈¬¬¬ƒ√√√√√ƒ√¬√√¬¬√ƒƒ¬ƒ≈≈≈ƒƒ∆∆≈≈∆≈≈∆∆∆∆«∆«∆∆∆∆«∆«∆«  ≈ƒ∆«»««»»»∆« ««∆  Ћ  Ћ ћЋћћћћ»ћЋЋ  ЋЋћЋћћћЋ»ћЋћЋЋћћћЋћћћЌЌЋЋЋћћЌЌЌћЌќќќќЌЌЌЌЌћЋЌћЌќќќЌќѕѕќќќќѕќѕѕѕќќќќѕѕѕѕѕ–––––——ЏџЏў’≈ђdB@=<:9<=:<:;@:<<:77;;<;;9<<9<87999;<:<=A;<=;<;<;;<<:<:<:9978;9=<969<:9<;;<886:>B;НЏq1'OАxtqxvphda[С†≤•wiljhixxrmmpimickgehhefebcba_^__\\^\Z[\ZZZ[[[[]]ZZZXWWXXUW^XYVXXXVWWXVVTXVVVRVRWXVXVTZYRXXZXXYVTUVVTWUTSVRPPQJMNPPPOOOOMRRRQSQU^PPPPPRQQRRRTRNNQJNPOH[Цk<Щф€ƒ≈Ћ√ЈЬЧЕ^^UQQRROQRVXWZ[UUWVTTTYYX[VVXVXVSXVXUVUWZXX[][[[`_[[__ZVPSSMSXSNHJKJJG?<8553/10,+*)(   ! #!#!$&##*-*068<;8:<99:9=:::99;;8;;;>=:9B75899;;9<==;;=9::><<<;<<<<98;88:<==:<:=<:<::<;887:<<99;8698677799999;<::;<<@H7fёи{"MГЛЖАЙЙГЖ~p/vШЏ»gVdbedejfiikkmhkphjokmpjphhpiiiiqeeeccb]eaab__^_^^X[ZZZZYZZXZZZ\][ZYY[XX[ZVVYZWZ[Y[XXVZZ\[YXXXVUWTVVUXYVVWPPQJMNOOQMMQPQRRQPRQRURQQRPOQMNPRURNNPJMPPQ_uhSГџпЋІ≈”ѓЬЬЛ_^SQRURQQRWXWX[WVXVWYYZYYXYXYXVXPVSVVVVWYYZZZ\_YZ]ZYZZWWVZ[X`XVYTV[^``XWPRRRPSSOIMKA?C;575*)'.1,#!&# " !%*)$$+*+2449;;>@<=<<99=<<=;<=<<;<;??:7<878::9;8;==;9<;<:9<::7;;;<99;9;::;<<<<=<:<97<99;99<<;;<96976799;9:877<99<;9AJNMTTXa`oopw{|zАИКХЧrnfnrhh}ГШСМФНЖЧСЙШНФ†85 /[ПШКИИГА~ЗМКЖЖХХУРНМКТСНШЛТРИНЕzqenrsuzКЛРРo( 8НМЙНtБ=AMUI[ЕНzlflmpjБКНЫЗh qТУЦТУФТХШЭЮ••ЯД~БЕКРЯ≠≥ЈЊЊњ¬ƒ√≈» ≈ ћЌЋ  ЋЋ»ћќћЋ≈∆∆ƒєЭf%!!%%,!!&/8ZШјјƒƒ∆«»«»«ћЋ««»Ћ∆∆«»»∆«»«» ЋћћЋћћћћЋЋЋћЋ» ћ ∆«»ЋЋ»ЋЋЋЋЋћћЋ»»ЋћћЋћћЌЋ Ћћћ»Ћћћћ  Ћ»«« Ћћ  ЋЋ»«ЋЋѕЌ»ЋЋ»∆»ЋЋЋ»»ЋЋ»»ЋЋЋ»»»»»»Ќ»ћ»∆««∆∆∆∆∆∆ƒ∆≈∆∆≈≈ƒ≈¬√ƒƒƒ¬¬≈ƒ¬¬ƒ≈ƒ¬¬ƒƒƒƒƒ¬¬¬ƒƒ√¬¬√ƒ≈≈ƒ≈ƒƒ√√√ƒƒƒƒƒƒƒƒ≈∆«∆∆≈∆«∆≈««»««  «««« «∆««≈≈∆« ЋЋ»»ћЋ»ЋЋЋ»ЋЋћЋЋЋ»ЋЋћћћЋ»ћЋЋ ЋЋ ћЋћЌЌћЋ»ЋћћћћћЌЌќќќЌћЋћЌЋЋћЌЌћЌЌЌћћћЌќќЌћћћћЌќќќќѕќќѕѕќЌѕќќѕѕѕѕќќќѕѕ–––––––––ЏџЏў”√Ђi@C>==>:<;<::=<;<<<<:;9<<7?::<:7<<<<<<=<<;=9;<989779::99::<;99:;:;;;;9;998=69=;;<<;;;9794499:::<9979:7;>>BJ9^сэІ3 `gw{~yun!&^wxww{st|Д{xwurzxrxnnpkimahUYdBb^McSZlZch_fa_ragi^dbehiionliiqlnhfhknqigijfgcbdcccda_Z```_S^_^[Z^\[[ZZZWVXWWWRPPPOPRRRQPSSPPPPRRQPRRQRTRQPOUQNMRLNQPNONQcil[ЕПЩЦІ≠¬Ф†ЫЕZZXQOUUUUVZZYYWYZ]ZZZZ]ZZYYZYVWXUUSXXSUYZYYZYYXYZZYYYXYXYXXYXZYXXZXXZZYZZY[YZZYZZYYY]]VYVV_XYTTYWVYZYW[_TS[VQQNKLGCC>>=@4252++++,*!$!$!%# !!!$!/.*223DB@@BMPWc_ddlos{~zy~ЖЖБПЗБЩКЛ]V=NVSgВРНПЖРКЖНКППЗМКФФМУТСУШРЭНЦУЛУЛZ-7-.2}ЙТУЕx!$tПК~zl{ДВРСФЧПИ5$-TqРЙПwW.)-*&A{Ъ|zvvuw~ГРХТЭo7'/.1GЧ£ЬЭЯЭЯ°¶®ђђЃ©¶¶£©®•Ђ≥Љ√≈ƒ«  »ƒЇ®Дi?//(! !(/8ZШЇњ√≈∆«»∆∆∆«∆∆«»»«««»«««»»∆∆»»Ћ« ЋЋЋ Ћ Ћ «»  «»ЋЋЋ»ћЌћ»»ЋЋћЋЋћћЋ»ЋЋЋ «Ћћћ»Ћћћћ  »Ћ»« Ћ »  Ћ»≈»»Ћ««»»»≈∆»»»∆»∆»∆≈∆«»«««««∆«∆«∆∆«»«≈∆≈≈ƒњƒ≈≈≈≈ƒ√ƒ¬¬ƒƒ≈√√≈ƒ¬¬¬¬¬¬¬¬¬ƒƒ¬¬¬¬√ƒ≈ƒ√√ƒƒ≈√√ƒ√¬√ƒƒ√ƒƒƒƒƒ√≈≈∆∆∆∆«∆∆∆∆∆«∆«» «∆∆ƒ«∆∆««∆∆ »Ћ»»»∆Ћ»»»»»∆Ћ»Ћ»«»»ћ»Ћ»»Ћ»ћЋЋ  Ћ«ћ»ЋЋЋћЋЋћћЋЋћћЌћЌќќЌћЌЌЌЋ»ЋћћћЌЌЌЌЌЌћЌќЌћЋћЋћЌЌќЌќЌќќќќЌѕќѕѕѕѕќѕќќќќѕѕ––––––ѕЏџЏџ÷≈ђg>>><=<;;<<<<=9;<;;=::;=96<<<=;:<<;<=>@9<=;9;989:=<<:<<;999:;;;:99:77;;79=;;;<;997972799;::<;979:9:>>DI4iуъ±H/)!#Bq{|u,!Z{Г||Б||{{||{~|{{~}{~ВА~ЛЗx{wy|vrqukophimde]RhTY^C[SUd^XhXgcWrcgp^houЬ©Щ{phkixomrkrmfmhhmf`hhhfcfbb`^`]\Y]\`^ZTTTTTRSRTSTRPPPPSSRPRRRUWRVUU\XUQSTPPONQQRmuuГМЭЫ¬ЧЮ¶Ы®С}^ZWSNRRRUVYYXYXYZXZZZYYYYYY[ZXZXXWXYYUTX[[Y[[[YZZ\ZZaYY`ZZXYXZZVVXXWZXYYZZ\ZZZ[\ZY[[ZXZXXW`XVXYXX][[TUXZW[a]___^ee^``cflYYYMM[SMPKECC;:<772/,-)&&"!$!! !!!!!"!## ''%,+&*202:>MOYfВНФПZ*BХЙЙЙuwyЖВГИЗЭХU>.<@>=<:;<;?=<99;;9:9:::999;;:98;;;;<<==<=>;<=<;<9::<<<=<9?<=;9<<<<;=<>:19:<<<99<<;89774499::9999;:99:<==>=><::<<99<<<99<<<<;99<:7::<:;9;<8:;:<<<=CJ8gсъ©pmh^K2''MxЙ.*[ЗzБААБААБАБАА}~|ДА~Д~~|~|||~~||||{||{zzxvtrponprrkrttvtxrr27Vruqrwy{}{x~Вv|tutqrsspfpmkhf`fk^\b\Zh`ehdkhkmkrqhtlh|pvsfprirfmiati[|єАdfdb\aZTiГУСЛЛЗВВЙРСlЬЧprg`UXWWWWZWZZZZ]XY\ZZZX\]^[[]][XZVVXVZXZ^ZZZZVXVZZZXXXXYZZWX^Y_ZYZ[ZZ[Z[]^Z\\__ZZ]Z_\^^Z[YYYXWXXXXZZZZZZZ\ZZZZZZZ_ZZ^^_^]]]_`^^__^_`^````^]a`^^__Z]^\\VcnЗЙМШФЙ~rhf_ZhWZ_PZVPVZMHKE???<32/./,(*%)&$%%  # #!!"$!%)"#&37;:<>KTPS[pjmqБЙЙТШСЙИПСППrchc^ckЮУРЪТЫЧЧУЪЩ°°£22 (Y£ЛЦУЗ|{{xz}МФЭg75@550{ИЬ°РQ) !9VЂЯХШСРЛЖЕМПРУТШХШШЧХЦФЦСЩЩШ£ЭЭ†ПДЙКИХЩСЯҐ©†P!!$**VЇЮ¶¶£©ЂЃ≠±≥≥ґµЂ†•©©ЂѓґЅ√« ЋЌћћЌЌЌЌЌЌЌЌЋЋ ∆ЋЋ ««»ЋЋ«»»»»«»ЋЋ «ЋћЋ« ЋЋ»«»ЋћЋЋЋ»Ћ»ЋЋЋЋ»»Ћ «∆»»Ћ«»   »»»»«»Ћ»»∆««««∆»«»ƒƒ«∆»∆∆∆∆∆∆«≈∆≈≈∆∆«ƒ≈∆∆∆≈∆ƒ≈ƒ√ƒ≈ƒƒƒ√√¬Ѕ¬√√√√¬√¬њЅ¬¬ЅЅ¬√√≈≈√√√¬√ƒ√¬ЅЅ√√√√ƒ√≈¬ƒ≈≈ƒ¬≈≈ƒ√ƒ≈ƒ≈≈∆≈≈∆≈«««∆≈∆∆»»»»  ««∆«»»»««∆«∆ Ћ»»«»»»ЋЋЌЋћ««ЋЋЋ»ЋЋЋ»∆Ћ»Ћ««  ћЋћЋЋћЋћЋћ»»ћЋЌћЌЌЌЌћЌћЌќќЌћћЌЌЌЌћЌќЌќќќќЌѕЌЌЌѕ––ѕЌќѕѕѕѕќЌќѕѕѕ–––––––ѕўў„„”«Іe<<>;:<99:;=<;9<<:9;;9;;8999;;9;;<><<=<<<;=<<:=<=:;<<;<<;;99;<<::<;;9;;==<>;<;<=;9;;;999:;89:;9;5;<<<<<<9BGCaршЂknqi[M9+Av;!bГИБГЕЕДКГГББ~{~~{ААyВАББА~}~~~|zБ~|||yzxwsnljhkkhhnoooppnh=FJQV]ghwЖУУСЗСЭЦФШЦШЫЩЦЦУХ§ГY2GF?G`Д•УШЧЧЦЯЯШШУ£ЪШ.' ЙПЫШП|e_hdbpКЬЭХЩУЫЭЪЪ¶Ґ†ЧХ°ЬЩШХЩПФФЦЫЮЫЩЪЫЬ`29CHI/МПШ£МH'*4-КєҐЯҐҐҐ†ЯЯ•£•§†c=PUKJV}®ђ±≤µµіЄЇЉЊј¬њЅј¬√«∆∆ћћЋћќќЌЌќЌќЌЋ ћћЋ ћЌћ  ЋћЋ»ЋЌћ»»ЋЋЋЋЋЋЋЋ»ЋЋЋ »»ЋЋЋќЌћЋ»»ЋЋ»ЋћЋЋ∆«»  »»ЋЋ»» »»∆∆»ћЌ∆∆∆««∆∆«»∆ЋЋ»«∆«∆ћ»ƒ≈ƒƒƒ≈ƒƒ√¬¬√¬ЅЅЅ¬ЅЅ¬√¬ЅЅ¬¬¬ƒƒƒƒ√¬¬√√¬¬√√ƒƒ∆»ƒ≈ƒ≈≈≈ƒ≈∆∆≈ƒƒƒ≈∆««∆≈«∆∆«∆∆≈∆«Ћ»ЋЋЋ «»»»««»« «  ЋЋ»ЋЋћЋЋћћћћѕЌЋЋ ћЋћЋЋћЋћЋЋћћћЋЌћћЋћЌЌЌћЌћћЌЌќЌЌЌЌќЌќЌќќќќЌќќќЌЌЌќѕќќѕѕќќ–ѕѕѕќѕѕ–ѕ–ѕѕќќќќќќѕ––––——–ѕ–„„’’— £b>=@>==<<<=>=<<;;<<999;9779;89:<:;8;<<<<<<=@>=>==?=<<=88:::<=9;=<9;99:>:::::9;979<:<=;96::79975779;179<999<8<<=<>=<:771/./,!$"!'! ! !!!! !!$&%"$&))&,2453227>BGHPX]dmrv|ВКТХЫЛ~КЦ®ХЙЫnі††ҐРЬЫЫЩРЩЬЧЧЯШЬЮЭЭЭЯЯЭЯҐЯЯ†Яµ}8%(+-/1Б≠Э§Т0#*.&)E£ҐЭМyЖМИКПЦ£ЫђХC%$!/ЦЬ°©Ч`;GC<0YЙ®ЦКВАЕЖЛФХЬ≤ЂЯ5!!5r≥ђ©ЂІђђ•®ѓѓ≠≤∞ЂҐ§ђђђЂ≤Њƒ»Ћ» ћ“—ѕЌ––ѕѕ–—ћЌћЌћ«∆«»»»Ћќѕ ЋЋЋ»»Ћћћ»  ЋЋ»   »«»» ∆»»»«∆∆»»«∆«««≈«««∆≈≈ƒƒ≈≈≈ƒ√¬ƒƒƒƒ√ƒƒ√¬¬¬ƒ√ЅЅ¬¬¬Ѕ¬√√√√ƒƒƒ¬√√√ƒ√ƒƒ√√√√√ƒƒƒƒƒƒƒƒ≈∆∆∆∆∆«≈∆«ћќ∆∆««   «»««»  «»ЋЋ»«   ∆ ЋЋЋ»Ћ»ЋЋЋћћЌћЌћ   ѕЋћЋЋћЋЋ»ћЌЌћЋћћћЋћЌѕЏќћћћЌћќЌЌћћќЌќћЌЌЌќЌќќЌЌЌЌЌќќќѕѕ–ѕќѕ–ѕѕ–ѕќќќЌЌѕ––ѕ––ѕѕ–—–——”’—„„÷’–«§^;>A=<=<<<;99:97:<:<<9:=<<<;99=9:<<<=;;;=<99=<97879:759888:;;99::97;<:<<9=;<;;;9::97269747888999::9;<<<@/h{rnqrrsvtttrtrrruusstrsttsttsrtstxwwtuwwuxvvvtxyw{}{{~ВВГДИЕЕЖЕВПze8RhrlprrxИЛЛЛДЛМЙРЮsXuqhrXmmZmb\mZgjWlhVmgameokkkjkkrrortmmrmqrhfhijkihjmpnojabc[`^\]ZYZZ[^][Z]][Y[ZZ][[]]][]\\\]]]^]ZUXZW[ZZ[_[`_][\^]_ZZ_^^_\_]]\\\Z[Z_^`^_^^`_`_bb`c`_^ZZZ^]_ЛГAZльЂњг’ѕ^dfe_a^`]\___^^__]^_^``aaacba^^_a^^][^`^b`^^`gbg`]i_`ilcc^fpm`lwrni^Z]`bZZVRPLIFC@>:55422/121(&&)'!#&'" $$!!"!!  ! !!!!! %$$""***,//<<>7:FKPUQX]`hfuuДЛЕЛКТЧРЩЬРРЂУ•§Х£†ЮђЪ£°ЩҐЬЬіd# AЦЃЯЭЦПРХПКУЦ®≤ЦZ??FAELv¶Ю•Ф'%°£†ЧУСУЛСУЛЦФ≤Ґ`.4GC;7В†≤§Цs!##Н°ЬЩЬХЫЫШЩЮ•®®≤f37=E=Xg≤±≤іЈЈЈЈЉЉЉњјј√≈«««« ќЌ ќ—–ѕѕЌѕЌЌћЌ  Ћ  »» Ћ ∆»∆»∆∆»∆»∆∆««∆≈∆∆∆≈∆«∆∆ƒ≈∆∆ƒ¬ƒƒƒ√ƒƒ√ƒ¬¬≈≈≈ƒƒƒ√¬¬¬¬¬Ѕ¬√√ЅљЅ√√¬¬√√√Ѕ¬Ѕ¬ƒ√ƒƒ√¬¬√√ƒƒƒ≈≈ƒƒƒ≈∆≈≈∆∆∆≈∆≈∆«∆∆∆««« ««≈∆∆∆∆«»»Ћ«∆   ∆   »»»»Ћ  »»ћЋћЋ ∆≈ »ЋЋЋ»«Ћ»ЋЋЋЋ»ћћћЋ»ЋћЌЋћћћћЋЌћћЋЋћћЌЋћЌЌЌЌѕѕќЌЌќќќќѕќѕ–ѕѕѕѕќќѕѕѕќѕЌЌѕ––ѕѕѕѕ——–––––—“ўў„„“ ¶_=@>=;<;;<<::;;9<=:::89;<;9979>:9;<<=;;;<799:::7989;:9;98;<==<97989<>=<<;<<<;9:9;;995::96647977:;<::;<;<<7M8jчц≠f|}{vtsrobV>*8;4Y|zzАБАДДГЕВВВАВЖАААББААГ~|~~~}~|~~~~~~}{zxvurpigidfhkkkkkigcA6a}rpqrst~vuttyrrrstsrtrrssrtqrooprssqrrrropnjljonnqlrrrtvxuyx{{}~~ИГbFltw{|{|~ИЛКИДЖРРЗЙМxo{~И~~~~~{y|wzzwrtqeolemUmkMjcYfSmmVmk`nhns_jrororotzzzПВzrqhjgeec`cbeeebfdb_\^^bb^]^\^___]]]_\Y^]Z[WXZ[Z\_[_]]^`^]]ZZ^______^^\^]^^`_``abbdidefedcbb_^]]_\mЧuScщщЖ¬а–«c^fb`^^_`^``^_^_^^^_^_^^```c`^^ac^^```^b`_^_`jdda`acdidb^`aedebfbbe```cecceilhgh{l[]_]]_a`_PSUPKAAC>7;7-14+*/%(+*&(!&&&&&&$&&#!""$!!!!!! $$ %)*'+/./553780;?CP\`[^ckpttxБАДЛУЛУХРЮЬЮҐcRVZXMbПН¶©Щ†ЬШЯЧЫЬЩЮ≤4# %oЄЮ†Й{mgkjdr®¶Ю}c[dequyШЩЃ£25$.m≠ђЦШАr{ГqКФ¶ҐПc[abhQАХІ†Ѓ^/#БҐ®¶•¶©£©≠≠ѓѓѓ±≤≥≥іґµґґґЈЈєљјј¬¬¬¬≈ћЋ»ЋЌ–ќЌќѕќЌћЌ  » »»««««»«««∆≈∆«∆∆≈∆««∆ƒƒƒ≈ƒƒ≈ƒ≈ƒƒ≈≈≈√√√√¬¬¬¬¬Ѕ¬√√¬ЅЅ√¬¬ƒ≈ƒ¬¬¬√√ƒ√√ƒƒ√√√ƒ≈ƒ≈≈≈ƒƒ≈∆∆∆∆«∆∆≈∆∆∆≈∆«« «∆ ∆∆∆∆∆∆««Ћ»Ќћ Ћ   Ќћ »»ЋЋћЋ  ћ–ЌћЋ  ∆  ЋЋЋЋћѕћћћћћћ–ЌЌћЋЋћћЋћЌЌЌћЌЌћћћЌћћЋћћћЌќѕќЌЌќќќќќѕѕ––ѕќѕ–ѕѕ––ѕѕ–ѕЌѕѕЌѕ–ѕ–——ѕ–––—““„ў÷’–ћ£_<>>>???=B>:;;::<998;;99:9897::9;<<:;::;939779=7538999;98;<==;:7999<<9::99<;;<:<<<9:5:<=8<99=949<::<;<<<=??==?>===;:::989;;:<:;<8;;9::=<;=<::89:::997788;:9<:899<;<;9:;;:9:<:93<;9<7<<:9;9;<=9<<9<:69<<:<=<><>FM4iшцѓiА{xxxxusvkeZHH?'OUUx{{АДГВГВААААБ}~АБyА{{~||~~~|~zБ{ytssqledcbdfddfefh]ZCікёЂgAd]Sabd_\bcgjjktmiomqomoqmnhjmlonkjljihdimkieecc_]cabacaaa\]^`a^Y\`]_[]^Z^^Zccbe_``aacb`^^^^Zbcf]\ZXГПЛЯНКЛШЕrlfa`^_Wa_bbc^^___`_^e]^\]^_^_^aaa````]a```_b^__bbdabi[Xidfdiihgdddb`dd`dddfecbcb`ccccceecceflbbbefecaa`aabceaccfef`fjgaZZakZMNNNTK=C<-165-*%&$!%)%#!!!!!!!!##"#!%)%%#&&! !&('&%*+.125577A?CKRSY]_ckruxyВxnninnrvoХЪСЫЧСХХП•†Ц©®Ђ##]ґЪФЩМПЛДЕЖЛШЧ≠Г@7235,JВ¶≤°p)*5-2E¶ҐЫ†ЩТЧУФСФШ†•©ҐҐІ£££†£££§Ґ¶¶£££†ИЕЖИМПЭЫђЃЃE#//"!~іҐ≠©ЃЃ©Ѓ±±іµЈµ±≠≠≤і≥Єљ¬∆»ЋЌЌќѕ–—“––ѕќЋћЋ»»∆«≈≈¬ƒ√√¬Ѕ¬¬¬¬Ѕ¬√√¬¬¬ƒ√¬¬√√√¬Ѕ¬¬√¬√ƒ√¬√≈∆ƒƒ≈≈≈ƒƒ≈∆∆≈≈∆≈∆≈≈∆«»««« ∆≈∆≈≈≈∆∆∆ ««» «∆»Ћѕ Ћ »ЋЋћћЌЋ   ћЋЋЋЌќ ћЋћЋЋћћЌЋћћћћЋћћћЋЋћћЌћЌЌЌЌЋЋћЌЌЌћЋЋћЌћћЌЌЌЌќќќѕќѕќѕќѕѕќЌќѕѕќѕ–’—ѕѕЌЌѕќќЌѕѕѕ–––——––—„ў„÷– £`=>?@=<<<:;<:9::;;99998969:<:<::<=:;:<<98<<::<8;<;<<;<<;<=;599;;75:;999;98:7:;999;;9;79::9<99<<;<=<<;rvjlklpprtqrrrroooqtqrrrsrrttrrrtqsrqtrquponkkmknkhkkmllnnjnnkkkjnmkh`a¬Ґckngikkkjkkhkkafdbjjipnjnorttxw~|ЙЙЙНИЧЕЙКЕЛДЖК{КГvПy~ЛrВБzИЕnЖ~r}5CЙ}rXZvmm~jpu\giaq\^jSe^UhNYcRff]jdcpekГsvppur~vrumkohkkkihjhhebehihe_boadaa`bcd_efdeaaa__cab`_bd^cdeca[ZПФЇТ~u{tgji``b`^b^aa`_Z``^_`_cacc`bb`^^aaaakeb^````_d`__a_ad`fb]idifffgeb`bbbeb``bcfccbcb`ccccccgggffifdbbdegaffgdbkefhgefdeffeecffefbecafe[`i[]`^\YOMLIJACC<5/+/*!&$%! #"$!&%!%'%%%!!"#"!!  "%%&/.'*,.3;:9;@?JRSSZddfotrsz|АГАГЙyfYPSX[V§ЩФЯУЩ¶ЧЪЦ§Ъ†≈R56И©£ФЕАwwrqkМЮЮТЯЮЫ°ШЩ§ЪЫЯЭ•ЯЮҐЭЮЫЦМТФФЧЧЫЫЩ£|B5GIH5\И¶ЃІE,'0G&6h≥°Ѓ°†ХЬ¶£Я°Ґ•®Т\Ra[XQqФ∞Ѓ≤іµЄЄЇЉ¬¬¬»»»√«Ћƒ≈»ќќ–ѕЌЌЋ  »»»∆∆«∆ƒ¬ƒƒƒ√√√¬√√¬¬¬¬¬√∆≈√√≈∆≈¬ƒ≈≈≈ƒ∆«∆≈ƒ≈ƒ∆∆∆∆∆∆≈«∆∆≈≈∆≈≈≈∆≈≈≈≈«««∆∆«» ƒ« »Ћ»ћћћ»∆ ∆»«»««»«ЋЋЋ»»ћћћЋћћћ»≈ЋЋЋ» Ћ ћћћћћЋ»ћћЌћћћЋћЋћћћЌћћЌќЌћЌЌЌћЌЌќќЌћќѕќќѕѕ—––ќЌЌѕќќѕ––ѕ–ѕѕ–———“ўЏў„–∆£_>>A@=<<;;;;99:;<;89999979;989999;:99::55<<=<:9<<<<;;><=:=<;;97===<<99:99B99<<;<<<;;;;996899:<;99;;99799;CC-tщф≤dt{zzxxsvvtsmgW<#P\ CmГ{ААБ~~А~А}{А}Б}~~Аy{||{xyxvyxvzvvssrllaffbaaddeacb\V>AgАijknprttrrrrsrrrq{qnnqrrqstpprrrppppporolpkklkkkkkfjjikllrljjjjiihiY?ћҐkhnkkjjjghhhigkidgjjggjekgjijlgjknkjglliuwz~{Б}}Е}ИБ|РВБУ|ДИ~КГВГvw~uВ02Аslhi{w~БnrДnВ{uВsБМ}rx|xsrwkrp^p`[jMfjQhWZiXlnYrdduetunmuqКnrnl|nmzhmmbiijjhljhhhdhhhgdbefff`fhgqgikhg]luРЭТoqomgdb``d``b`]]_]^]g^_b`_a_``b`]^`a_`b`^```bcb`dcdeddebdldfiffliiifb_```b``bbcecb``bbcccccgjfgcfdffbbd`feeghfcgcghgghggefkihffhgemhfhggeheefcfbachefch[]\aeZSW\TRTMJGIGIIECFB872.-.*)&%"#&!#!!!!"!!!"!$ ! !!"!$&'**)*/4717?CIPPZ[]_egjjjyИАxЕВВНЛЙНРМУРk<@851ANФЯЯЦЮ°ЂЂ°£ІЧЪѓЦЭ£ЫЬЧЩЫШЩЩТЩФТЩТЭТebdge_`ЖМЦЪy%,!.HД§ҐШГerianmГҐЮ¶ГcfkrssЖ°°іI%&(ШЂѓ•І§Ґ°ЯЬІ•£®ІХЗМММУЭРѓєњЅњЅ≈«Ћ÷–Ќ“”“ќЌ ћќЋ  »»«∆√√¬Ѕ¬ƒƒ√√≈∆≈ƒ¬ƒ≈≈ƒ««≈≈≈∆≈∆≈∆«««∆«« ∆≈«∆ ∆∆∆∆««»» « ЋЋ  ЌЌћћЋЋЋЋ    Ћ»Ћ»»»»ћЋћЋћћЋЋЋЋћћћ»ћЋћЋЋЋЋЌЌћЋћћЋћћЌЌЌЌћЌћћћЌќЌћЌќЌЌћЌќћЌЌќѕќѕѕѕѕѕ–ѕ——––ѕѕќѕќќќЌћ–ѕѕ––——–„ў””ѕ¬•[<>>><<<<<;;:::;;99<;;<;:<:788999:9:97969=98977;<<;<<<:<=?=;::;<=<<<579;<<889<:99877878;9<9;<96<<<9:7779;@<.zшрђdt{wwwuprstuqmd/)R_ :g{}~~}А~||}Б}}}А~zА~{~{{}{{{{yyywwtstrolieb__``a`b`^\Y[.1apihkorpvprrrttpptrrqpnqrrrsttrrrrprprqqonouiklkkkkkhkfdhijljijggifhj]9Ѕ†gjmklggieefiijiijgggfjjgjgjjgjjjgjjlkjiijllmonnmlnnnnorswxw{{ААДИЗЖ|28}АuwЖЙБДzy{uzyz}y{А|ux|{{|{|}||zvx|wxВvusqqnppdkhgm`eihcfglejg`jfgvhkphpqЙАЛЕ}ssnimpprighgnj\hhjmkokkigb`]jfnolifcbfbeb`b`^]aa^[a^_```c]^^`]^^^^__`_b```cccadaadbageddfdiiikkhige_`ebecegbbcccbbccccbcccgffcbbd`_ec_cdbeegbbbgcechfhehkljeefgehigghchffdfcdeddehfgfdbaghgefkhbcd_ae~ЗА}~ГШКxpeWNG<159:310-,)!""## ""!!!###!!!! "$$$$!"## !#"#((***-/..5<>C<;<<<=<;<<;8=9;;=<;;;<==8:<::<::::88<=C98=85<<<<<<:<<<<<=<:;<<<<<699;;;;89::9:977;89;;<<==:9;;:9<<=<;>=>=98887987:9:;;;9889995798;=::9999<><:7<<<>?@==<<<<<<==>=<=<=@=6;;;<=;;<<99::9<<<;;9:99<<<;;87::<<4=IC7rчф≤[rxsuwxttvvwqkk/*YfE-)v{{uzГ{y{xxx||zyxszzxwvzxyyxxywxvzxsttsrqqkhfda^^``aa`[[\Z^X;arjkllllllnppoolkoknqoolnololppootrokknkkjkkfhkffhhhhhhhhfgkkhnhjliecTVВДrljkjjedefhjhffgfefffafjjgggdhffmfdgeegijigpgefdbde`bddcccadfcccceffdd.;lwh^flnpstvtwx{|zzВИРЗПЪВНЖ}Л|ЗЗ~}Е}tАrzxr}x|Гt|АwВxzЗr|~pЗyrБrrwftXl}в“•l[_Uej[c^b]bibftenrqooryooifjnІІy}}sqmkkmihkihjhggeb`eeeeebcc__`ddeba`aaacbedbebdb`accgabcfffdddeddebbbbcabggdfcd`biccccgfgkggkehhfa`cccedcigghhfiiiijrhhfghhddfilgghgcfbdddddecfgcgcccffcglfgkfggbXcqЪБzЬ•ЈњЃќжу°Л~tnmnjjijfinlrqpkgb`e`_`ZZZUNMGFA=<7/1/*//,+#+,&)('("!""!#"!!#"!!!$! #""#&*)*((''%+,/00,275;ACFHJMSTTSXYdg`fowБzwqVMXXKKPАЖЗТКГДЖИИИПКСЯЗ8 >©УШУП|Иop{ЭТЩЖuRVU\Z]pМЭЮWA=~±ЫФ|rkxt_oМТЫ§МfcippruХЪ®Т082*TlЂЂђѓѓ±≤±≥µµґґЈєЇЉњњЉјј¬√√ƒƒ≈«ЋЋ»ѕѕћ——“’—–“——“ѕ–ѕЌѕћћ»«»»Ћ≈«ЋЋ»«»« «∆« Ћ∆««»Ћ»Ћ»ЋЋЋЋЋЋ»ЋЋЋЋ∆ »ЋЋЋЋ ћћћЋЋћЋћЋћЋЋћЌЌЋћЌЌћЋќќЌћћЌЌЌЌЌћћЌЌќЌќѕѕѕќќѕ–ѕѕѕѕѕ––ѕѕ–ѕЌѕ–—“–ѕўўў„–ƒЮWB>>>A@<:;;8999:79:889;9:9999:9:7777789:<433;;<<<<>>><<;<<====<<=7=<<=><==74;:9;<;=;;9:99<<><;6899;A;?JC5pчсѓVnwvuststwuunol0"^oRA0!3oxxuwwwwxxxyyzyy~uxywxxwuvvxuxvvurpronnkkgb`^[[ZZZ\^[ZYZ[U5amfgigkikknnkmooknllopolpooppppoppolnknkkhfkiikfkkhfekhfhhjikfkkkkjc_Z/jrmmhjhlffeeefhfhgggfgeahhhffgfhdggfdeegjkjgfjfbddddab`dbbbeeddbb`bdeefj22creecccefggjkii_ji`llhqnrywwy{y~~ВЕЕМЕВКЖЗРГЗЕБГДГДБДД}А{~~vy{dБ}s~|x|rucHlsГЗQShnomhhghhjneej^hjkkhfnlkggglВЛtytrrsrruyrrrrrrlkmjimmkijikkhchhefefddbbbceeggdhgb`ccgbceiiifffggggeeeeda`bbbfae`ccbbbbefgigejefhdceecdffdfcgnhfdfiiiifmhghfffiirbgjhffddfifeghgfcfccefeejgffhgfe`\eyЛuYІЮљ№ћ√хшЦЕБwpmmnnnkiknllprrrppvttssvywosxlmwjefi`Z^TOMC<>954+)(*##&&'%!%%$$(%%%%%$$$$!##$#!%%!"!!###$$% )*+,(+.+*000377<==FILJFLMOQQUZ^ahplklswrwБЙЙЛhK3992'89ѓАПНЙЕДЕЖЛКСЛЩШM,,IВ•ЮГiOMEDE^}ѓЩХД{xt{ВПЧ†И*A#*9#<ЙЮЂРrcPUO;s|¶©¶©©≠≠Ђ≠ЃЂ≠≠©Ѓ≠±±≠ђ±∞ѓ∞±≤≤≤і≤µµ≤§¶§©ѓµЈљЅ« ЋЋЌЌѕ““””“’“””“”“—ЌЌћЋ « ЋЋ«»ЋЋћЋЋ»ЋЋЋћћЌ ЋћћЋ  ЋћћћћћЌћЌћћћЋЋЋћЋЋћЌЌЋћЌќќЌќќќЌЌќќќќќќќѕќѕќѕѕѕќЌќѕ––ѕ–ѕќѕѕѕѕ––ќѕ––——ѕ÷„„÷–ƒ†W?>>>=A<;==<;;:<:99998;::98;;;;995::2;:99;;99;;<<<<;<:;;;<=99::9:6<<9<;1<<<<99699;;<<<<;=<<=<<<=<;=<;=A>@HG2zцс©Vpvvtssrsrrrosf2"Sp_XE01Uktxrtvwwxvvuyxvxuwwuxzwutvvvxzzvtrsqnplid`][YZZXXXZYXWTXG0`hccbhjijikkhkmmklllllllopopoonnookkklmnnjkojjjihokiiiffhkjhhdohijgd^S0Zpgdfffleebdfmfahgegfieffefcagffffffgdgjkkkggfffffdbbcfkebeeeeeedb`cbbca1&drcb`__`bddbdba`f`]dd]eaeeffceiifcnrqnnlrvtyГЖЕНРТХХРГЧКПСЖММГКББА}|srrme;`r}|SgpЖ~srorpryrryqvrsqqppoqjgljfhamgci[`faihhnjroomsqnr}zqmnrrspooomommkiihifjkjgggifcfc^cdehhhhhkhhefefffdc`ccfgeggffgegeefgggejfelfcedbdiidfcglccefeffgfkhhhedeehjcgmcdfddddcbgfbgghffhnjgjhgfhgge^^iwsi:≥ѓњак”фуРИГxnnnnlnjjjlikmjlspppprpnrrrrswutwvrstvttstsnpqinsice\T^ZOHC@<95.,+#+-$""  !!##%"#%$##&#$$#! !#$$"$!$"#'(&(%*,.**/0./07759CZПЬЂМSD12A>}ТЫЫУПЛИЖММЮ°Ђ£¶®Ґ©ЂЂ©¶®©£®ђІ≠££≠£ЪФФХШЫЬЮ££Щz@>===;;<;9;<:=:9799889::89=9<::9:<6<;879;;;<;<<><:<<<=<<=;<<:<;9;;;9;6;9999;99;<;:8<<=<<<==9:;<;?=?=@>>HH4zшх£Yrsssssrrqtsprg5!Rkf`UC2#/Jwvnrtutvuusuussssvuwwusxssvvtutrrsrlnkgd`^[WXYZYZ_YZWV[.:^hacdljijihkfhjkgggjfiilklkkhkkkmnkjjlklkjhkiiiihhhiiiffkkhfhhrkkjjjaO*Jiffgieeceddbdfeeeed_befffgeelgeffffffegijifgfffddddfddjfefgeedffddhfbda2!ftdb`__\\b````baa__cc````bcaaaac_acceccaffefebhkiiejmpvx{~uЕИ}РВДУ{ЕФ}ЭДq?arЙt}}НЖvzjzos|ar~p~xoxrsq}Вuxy{ksyj}beq`ihXr^ZkSei]f[^rZfiapokvjmukxtrvmqukГtqqmkpmonkhhhhhkfhhghihhgfeigfeigggfgcgdfhgejgjgjeghfnhhgfffiihiggecehfffhgfhijgggggghhekcacdhfegfofdghhhgejiehhfehgfgb]lufY3–эЂЋюьждПЪЛzqmlkjljliiiimljpnnqppooorqrqqrprropqrrqrsuporqputrrtorrprqmmkkg_`\[VOUMGBA;7522/-%+-"$&%*(!!!""!!#"!!!"#%%#%!$$$!'&%(&$&'&)),).++../3436::8<CEIOMOZ[__cddkgpr^MJMKLMZrФЗВНЛМСЗЦКЛФЦЮz'ВТЪРЕvutrwwЪЬ†£Ю¶Ю°•Э±Ґ£ѓ••±Э•••§£†ЫЪЪЬЪЬЬ†®†Д\ZV]afwЩ®Ьk36+=!(ZІ†®∞§І•І©©•ЂѓЃ≠ЮАНМССЪ±Њј√√≈∆»»ѕ–ѕ–’÷’“––—’ѕѕѕ––ќќ Ћ ЋЋЋћЋЋЋЋЋ»»»ЋћќѕЌ»  ЋћћЋћћЌћћћЌќЌќќќќЌѕѕѕѕѕѕѕ–—–ѕќќѕ––ѕѕѕ–—–ѕ–———–÷÷—–ќ≈£T;>=<=<:;>88997:;97:9698;<::A<<;;:;<4<;479:;;;:;><;<;9;<::=::99:;;<5;;@HA1}фхЮZkrqrrtssqsqspn9QkpieZM3%Jylstutussttusrrrtrrurrusptrptrponlkkjea^ZZVUWYWUWVWRNP<;fdccgihjmihhkklhigifihjifjgjjjjggkjhijhhdgehfcgfddfgiggfkhhfhhkkijhfhM!?qdgjjjjfgggebefbfffbffhhfgccgcdgcabddbcecfddddb`bbbb```ddfgffbddbddddaZ/!ftgd_``_`fb`dbfebcadb_`^^ec_a_aaab````bd___\^^bacbbcddddggfikllllnpopqrniXho{uzАФВУ~РzzТЛБЦ{БДД|{Еqxsh|oyhv}tГwwДx{{oДqn~truhxd^rbfiUhc\k^^g[eb[l^jYзЎТzrptrБ|pzrrljprlrjnpljl^olfkfkkihhgadhhhf`dgghifgddhjgghhhfffhhffghkdhjjlnmmkhjjjjghheecceeghhgejeccgghgghhghffhjfgidfm{mHJЌмІ|ююг’ЗФНynmkhhljnlmkkouqrrrsrromooownnnnpqnnrstrtttrrrpprrorrqqqtxvwxxvtwvtwtppmttrhekaZ[YUVRLKJDC9997522/.+-$!#%"$%%$&"!!#$&!!)#""#""$$#%%$#$"$$#&''()'%)+''-,.5258<<@BDEFFCEKGLMS_`gjrtrvtzv{БВЙgN26971><<;::==<<99:;<<;<;:<::98988<:;;<;;;;>A;jcfijjifgegecdeeifefeeggefdgggejferjfdflfhffgfdfaa^^``bb__`^bb_b`b`dd]^-+`ndd^`b`a`b`b`degead``ba\dbbe_c_bfbcbbbb_^_Z][a]`f_````\\b`bcecacccc`dfecZmrkkhjlkorjqsswwy{ГБЕЕИЕСЧУУСПСУКВПВБ}}zy|~xxtzurxwsuw|yy{{wtvrpnpljjfddbefeOффИvaffbhiiijnlhknrjpnlrlnupuronopmkornnhlolpiiifhgfgfdhggffgifffgffeggdfinrsvsrkikhhlhjggggehhhkhjgjggggghhijjjffhhkhfffkmt`YnЃ†}oƒё »НШЙvrjmhhlljnmkkmmnqooqqoorqqownqnnssrstuyxxstzrpnmqonqooooquswzzxrvurvvsstuxywsyvuwБtvvqqsjhhhed^YWVSLIA8><256/14*&&)))'%$## $""####$$&#""!"!$$!#&&$$$##&%*%!#%$$'**%'%*,*++15089<@EHKLRUXZZaTRQOUYY^hД}ААЕИГРЙИТНСФРХХЧЦУЩЩЩЮҐЯҐЯЯЮЮ°°В976190=k≠ЭРbO??G.gАЂЯіЃђҐvy£vЦҐЦђХyFHHDGPgН•М]C50.*5yђ•®ѓ•ЯЬЪЫ•§£≠ђІЬpjmlnwМ®іљљЊЅ¬√∆Ћ»ћќЌЌЋѕќѕ–ѕ—“ѕѕѕ—“–ќћЌЌћЌћћћЌЌЌЌЌЌѕ–ѕЌѕѕ–ѕќѕ––ѕѕќќѕѕѕѕ–——––““——”’’”ѕ≈ҐU8;<<==99:<9:<;<=:::;;<69;;9::::::<:9;<=<=<<<=9:9;;999::997699;;99<;;;;:9;88<<;9:899;;87<<<<<<@:02/*//*+,+,**+*)('&$#%%%%#"!!!$&%&$#$%%&&$&&&&%"&%%'%"%"#%&#%'++-0/22157<77:<<<<;999:::9;;;;988889<<9:79<;:99;;=<==<=::<<;;:<9=89;;::;89999;;;<<8668999889<;9;9<<<;;>;9<=;=<<>;99:9:97;;9989978::::958;9998;;99;<=;;<<<;;;7;<98;;<<;78;<;;<<;8889819;9;<<96;798999:88<<<#Ji^hhecbbbfbaaabfeabcebbaabfbba`hbffbbabebbebfbbb`^bb`dbaac_bddbbbadb`jW#.kiddbbfjbcacc`dgf```bcecci``cce`aabccb`^^_^Z`^^^\_____b`^`aaacaa``aaa``_\MXnfaa`b_``e`c```a``a```c_aa`dffff^h`Zbeaaee`fiiljiorrrutsxw}АВАБРСЙСДПЖЗЛЙД}^<\}{ox|}Б}rskrutvvtww|svvsrrsmjikhgccbfda^dc_]`bdedjmmmprpqrwvuwwvtwwttyxyyq†кƒ~qyzusurrnppqmmjknlljnpmqppomnlkknnkjkhjehvНЙМНН†јЪБЧ†ҐЬФЙ}xrjjkmnlkklomnjnolnnnopqoroorrrsutsttsztstrnqlnmnrprsssqppqrxwwwuvqrwvsqqruvzz{}}~|~ББ~~ГБ~}}{xxx{||БА~БА|~~~~{{~y}}ВЖВ}~zyyxuum[``Y[[TNGCDCC9782/41/,*%&&$%"%'%&%&$%***/&&+# (&!&%%')$%&()&%&$"#'&&&+%,)!&,&$*+/15)J}t{oiikeekhcfkfckw~~АrШГМЩНКППНЩЩЧЫЮ£~]4*11'2M©ЯЯШЫЫЭЫЫ•Э§•®ЃПB<95AKUИІ£СrYOA/#xy≤£§Ь°Э°Э°¶Ы≤°®†Ф]lm``nЕЩ≠ЦXq2/4hzЮ®ђѓі®≤≥ѓЈґ≤ЈґґґЄљЊњј¬¬Ѕ√«∆«»ЋЋЋЌѕѕ—“–—“–—ѕѕ—–—–„ў„’ќ«†L:?A=<<<==><CG*ГчоХWqrlkkooikkifdq,NjfegededbdVI9,5nciikigiikkjnnlikikjgeeba```]]gZZXTRMLMLIMMEGGFK85hSWXZ[XZZ\\`\XbY\^^_\]\``d\^`````aaebb`bdbecece`aeaaaddfbddbeeeeeca\]C1[b_bacabbbbbaaa`ba__\ZZ`_abbbbebebbeebceefeeacabca_abbfbbcc``bjddeab`afX'+Zea``bb^^a``a^b_b_`baacebcb`occfcebbb``^bbba`aabb`bbb`bbbdhfceacaa_abb^[R:Ha]__ca^_\^^^^^^^_a_\aa^_`b`````d`b]bea`aaa`^`b__``^`b_^_bbfbbbd_Z^bcceacddbY>2VlchiqzxwБw|БyНЖ~Т~ЕСАТИБФЕДЙАНДtЛ{uДjzjgrВmyЖlЙss}~{xpЛxnrnph]jb^i[^hMh^EГp„рдЙТqrlp}i{rlyqsypvtrvtvtrxvpyuqurrpjnrfxГЩЩТТКЙЙНТЯ†ТЗИБ{omkjighhjmjomhjlnopmqqrolnrsrstrtsusrqrrsrrqrqrqrtrtsrtrrxrusuuuusrrlrsuututxzz{}|{z||~~~А|{{{vtttw{{|~ВА~А~~АА~}||~}{АА~|||~~~А~А}{||z}|}~}~{}||}}}yvtrqopmligfca][\YTP=AE>>4.2874/,/*,+#)-/,*(&&"%&%''$$%%%%$%%$&-gЯЂґіґґЄјƒƒћ’є–≤Є—ЊќќЊЊЃµ≈√Ј∞≥±•°Ш†ККУА}{}yvlГm|ЖyЛЗЕРЕПЧНЦШЬ§u`ZUUGebЛҐШ°ЮЫЯЬЮ£ЯЂ®£®†hW):2NWР≥ПНДvvjdoК±±•ђҐ†≠†¶ІІѓѓђђ≠≠Ђ®Ђ¶©ђІ¶Ѓ††®ЬХ•®ЩЩШУЦНГz~x}}yqr`]_I>5√——–„„’’ѕƒЭP59<;<<<<<<99===<779<;<=;;997<7:<97:88;9;899<::<99899:;:9<===;;9;;;:99979999<A@%ПхоХSilollnojliifdj, Udeijhegeeb\[M<*7]idcdfgfhhgkhjggfcfbbdaa`[[[Y[ZZTPRPMLJILIIGGGQ4,dXVZYZW\\^^^^\_[[\[\^ZZZZ\ZZ[^^^[`_^\`[```bdc`^[^^``^`bda_bacecdcdbaaH5cjaaccbaaeeeabcaba_`\\Z`_aaaaaa`baZba_aa_baeaecaaeb_bd`````b_`cdcaecc_a^')hjbbddebaedb``b`bbbbf`cdZ```gb`bZbbb`bb^`bda`a`bb`bbb`b_`bddbb_aaacccb^]R3Fl\_`jcb``^b````habb]`c^_]^b^^^^`]`ZZa`^``bb^]db`^]^aabaabbdbbd``bb_]`c`a`_`V8<;<<;999:<<:<:<;:959987958:8896797889::79:99:99<;48;><69A;;<889;::>=<<<:<;9<99=A?$УхсЧRckollkkjkliche.!Vliigjegedbb[WK;.#8Zr`egggjjjgeiffc]d^\\^]\ZZYVXUYQRRNMLHGIGHGDDP1*hZTYYWWZZZ^\\\^YY[Z[]\ZZ\\d^[db[[^[[``^ba^`\]^\[Z^[Z[Z^`^[_a`a``aa_aj<5hlbacaa`acec_bb`caccb^___aaaaab`bb]iaab___aabebabc[`bb__^__``a`^a`bec`^[)-nhabdbgeceebb`bbbdbbf`b``b`bkdbd`ddb`dbbbhd`aa`abbb`b\`\^`dbd`aecbcccb_XR2Hh_^`dcabb^````dfbdab`b_a``jb```b`b`^fca^aa`__^``^]_\aba_a^b`^``^^`]]``^^`aZV?@R\_\^__`acbaadcfifejhhfiiifimomrtrrwЗЗБ}ГИЗИГЕЖЕЗЕИИГИЖМЛКЗДББВw~А}}}}~~}iЛёщnffaafjklghhcX`i`XYdPZ`[ebahbdhjplqqotИЩ®§£££¶¶®•••Пv{p{wqnrrrrrqrotsqrrirrИФ¶ФБuwstttsvtuzxrrqoqrrrtrqpnqqrqqqoolrqqqsrssqrqsussusuwwsy{}{|{А~ВВББ}|zvvvxxz~~АВАВА~~~}}{||}~А~}|{||}{}~}{~||АА~||||ББВАВА~ВВАБАДДВЕЖБЖЕЕЙЗЗУЙРРТМЛЛКМХЖАzКЗЕГЗДzsrol]SKJGA<8847224.,,((%#""*hГИЗИЙЛЛИННЖЗПКВАИРРТУЧЪЭ°ЬЮ†Ґ¶Ђ¶≠©Ѓ≥Ѓµµ≈∆ƒњЊ≈ Ћ»√Ѕ√њЅƒєЈµ≠≠ЂЫЧЫЩИ~ЗВБГ~wrmrПzЗЙwЙВКНКЖАrpmnpis|ЫЫЯЮЩЂЮЦ•ФЮТЦЫНМКЖБВИxxzoa||iiimr{АzЙВМЛСМСХШЮЦЬҐ£•£ЯШХЙ`A ®”–ѕ„ў„— јЪT:A==<;<:997669:9:<==999999<=97899998888;<<=:799<799<::6;<<9;<993;;9999;89<;<=<;87;;88;:99<<==<<><<:<<;=<>ABB(ЫшсПXilglmokiifkej`/'S^abdbadbca``^YTLA/7Haedbdeeeefdca^^\XXZXXXXUXYUWTSSPKQFBDCAFBCI95\WUVSUWWV\YXZZ[XX[Z[XXVWYXZXWZXWYXWXY[[^`[Z[[Z]b^a`\a`^`_]_^\]\`b_]`a0*\c[[[^eaa_\``___a`^^`Y[\`]\^[[_`baaba`ccbbebhfbaaa\_aca``b\cdc^^_`bbb`^W'>Xa[^c_^ZZ`Z^\ZZ^^a``^__]^a__a^]_`_b__]Z]^``^``Y_bcbffhdjkpppruuuy|{Г{|ЖАКДГТoЬпчКr}{ГСЗЕДw~||~x{}u~{y||{}j{{xyy|uwuswЕХЭЯ¶°£©©≥µЄС`PVhZklghnmrmprlploztt|rvБ†ІµИЗ†°РЖАГxx|УЛ}zxwwvuuwxuvvtrrrrvrsvtuwssuspxtussssssvwy{}|ux{|{|}}~{y{z{{z|{wx{{~Б{~И|{x||{||А~~||~|~~z|{}|}|А~ААВАА~АЕААДАААААДДВАДДАЕЖВЕДЕЖДЗЗЕЕААГЙКМТЛКЯЩЮЫФФРПСППУУСПНМЛЙЗЗЙЖДБ}Б]*"!%#q{~МЛЙЗВВВД|БАА~В~}БДГДИЙГЗЗИЙЙЙЙЙКЙИЖИЙСЧШЮШШЭЭЫЩЫЫЩЮ§¶Ѓ©©Ѓ©ђ≥≥¬µњ µќ»јў«ѕЏџЏ„”ќЌ»√јЇ±•°ЩНЦҐЫЙfZP^hjpsrИЙЛНТССХЭЫФ°Я°°°££•¶І®І©©≠ЂЃѓµ≤∞±Ѓ≤ѓЃ±ѓѓѓЃ≠ЃЂі©©§Э`< І’––’„’”»ЅЮS?C?<<:<;;<99<9;9898:777=987979;;7:95888<;<;<<<<<:;:99;9::9;<99<99;;;::9::;<;89;<<:89888:::9;<;;9<::;<;B>=<<:<<<9;A:<89;99;9:977<:4::948979;:=<99;;;;9::677::8859;99<99979:<;:<:::759;;:77989<<:;<=;<<659:;:;=C9)ЯъсПIkmgggegkijkc^`/"U[ffidddhddea`^`[ZWM3! /]eggeefcbfc^\\XWWSUTUVXXWWQTUPIIHFCCB>CABC1'ZRVVVUUWTSTTTWXTTTWUYYUWYXXTWTXXZYZYZXZXZZ_YYYZZ[[\\[[Z[\YZ^\\\^_[ZZc.VaXY[Z\[\__`_b_\\^[Z]ZZ[Z]_Z\[[^a]]]]_^_a___aafb_\\\__b`Z_\ZZZZZZb^`^]ZS%5j\g`X`a`acbaa`_aabdbb`````fadb`db`kbdbcfcccaa``abbbacaaabbdbddbcecb`ca_[R?MZb_c`bbdb``aa^`b`bb`ffdd`^bbfieabcbcacceb`b`^`ccdb`^bbdb^^^`^`b`aa`bdc`_adXO5.^`^`cb``\\[\^^\^^_a__`^\\\`^______aa`\^^^_^^a_^^^Z^^^d`_[a^_b_^_a_aaca_a`beVP£прpTi]_^htsw|yrrwА{}ГЕЙТДППЙЦЛСЛИЦСДТЙЕУИИДАЛКТЦЧЫЩЭВkl~txyqwxДor{q{qmsjgpceg`gKuљюьвЃ``^f[hhlrr|y}||||yw|}yyzxvywyz|v||xyxx{wyxyyy{xyxw{||~|zzzzx|x{{~~|{|{zzyy{|||z{|||x{{{|z|yyz{x}{}|yy|z{{|ЗА~В~АВВВА~~ВДВВЖДАВГЕГЕЕДЕЗЕЗКЕКЕЕМХЮЩ†\(9Ъц±ФЦРПССУУСЪУУУСПСЙМКЛЛЛВ±Z$'$"%Д{|ЖЖИЖЕКВАА~}ВАААzЕЗДДВЗМДЙИЖЖДБАЕМЕ©≤√∆«¬ѓ£†ЫЧСККЙЙЙЙЙММНУМУУТЦХШЩЪЬЮЮЧЮЯЬЮЫЬЮ†£Ґ£¶©Ѓ≤ЊвсЏјЂ•І©Ђђ®ђЃ≠ђ©ЂЂ≥ЂѓЂђѓђЃѓѓЃѓЃЃ±≤≤≤≤≤≤≤≤∞≤Ѓ≤≤∞∞ѓѓЃЃ≤∞∞ґ≤≤Ѓ±±ҐЫ[1≤”–ѕ÷Џ„” ЅЯT=<<:;;::<99<=9;9:9:9><3:<<:9:9:::;<;?;49;;9:99788979998;7:8849:9:99:78769:::97949;:7<==<<=889:;<<>B9-ҐчмУCjkehidfiilge^g**^`chgeccfdba_aaab_ZVG5#*_egegiiggc__]ZXXTTTVUYYWXWWWTOMMLFDDECBJJ*$WRQSUWSVSTWTUXWTTWWTWVTWSSTTSWYXWVXXUX[[ZY[YZZ[Za\\\Z\[\YZY\Z\[Z]ZZZa4[`UZY[Z[Z[Z[Z\\\Z]ZZZZZZX_]]Z[ZY]^^][\Z[]__a_aea_\_\\\bZ\`_``\\\_Z\^`]dQ.b^_^[`^^^```c`^^`b`bhbbb`adbf]`fd`ddddeffaccebceccfddeegcbfdddaeccb`ac^^R?RZ`a`bb`bbaaaa`cb^^``dbdbb`j`beeeeddbcccdbddb`bcca`_`bdff`^`fh`dbc```ba\_baZR./Z_``ab`b^_[[`]\_^^a_a_\\\^^\__aa`_^`^^^^`aabe``a`\d```^^]]_ad`^`][][^^^a_`bSMҐмлf^dd`aaaeedebdbfaeiijnrruz}xА}|КЙХННЮДЙДВГДЖККНЛКВrkДzД}wЕxz|spВmЖwqstu~o~tpvclзхи£ДZXYrR__OhWWgGfgJl`[l`ltlyrwwuzДuКzvН||ЙwxАzД|}zxzv{~yyyy|А||x{|{yyw{|{{{~~zy{{|~|{}}||{y|~~{|zzy{|В}|}{|Д|~{~ПВАВ~АААД~~ААВА~Д~~АБГГГЕДЕЗЕЕЗЕЕЗМТЯЃ√Х6(SёіРТНСУУХХХЭХУУУУХСПППНПП¬U+%!(}xyГГЕЖГИ|А~}{|{{~~АДДВЗЙЙВЗКЖВБ~~yВКЗі∞њ≈≈ЋЅЂ¶ЬЪТТПМЙИКККЙНННСТСФТТФФЦХУХУХУРРННРКИКПРСИЩ”ра≈≠≠©ђђЂ©ЂђђЃЃЃѓ±ЃЃЃЃ∞ѓѓ±ѓѓ±≤∞∞≤≤∞∞і≤≤≤≤≤±≤µ≤≤µ≤Ѓ∞ЃЃ≤і≤ЃЃЂ©•Ш\* ≤’—––’’“Ћ√ЭT:@=;=@<<<<::98:989;;:;:975;;6<=9:<<::<<:;=><6;<<;=;;8;;@77A;8;:89<:999975776896667999489689<;<<==>4;;<<<<57ЯчмКTlifjkfhkkkifbd/ lcckkgekebbbebeed``]WG7" 3_ebeifgc_[YXWWWUTXXZ[ZZZ[XWSRQOMKIHGEDKK'&aYSUYWTTTWWUUXUNWXTSWUSTQQTTSTTWUXXWVWXXXYYZYYZY\ZZ\Y[[\\ZZVZYYZZZYZ`0&S_Y[ZZ[[]XZgZ[[ZZZZZZXX[Z]X[[ZZ[]\\_ZZZ[]]]]]^^__\_\\Z\Z\__`a`ZZZZZ`a]dQ'be]__b_``a^`bb__`_^`b`^`^abad[_d^bd`bdeccacacccecbdfcceeaadbfd`ffcdfcebePGX`e_`ab`cbbecagcb`^^]``bb``e[_b``bbbdddbg`bbb`gcb^`babdb_b`ccbbbcfcb`b__`bb[K+;X\bab`^`^`]Z`^^]ZZ^^``b`b_^^`^\`^^`_^^^`^abbd``___a^``^^\_a_b_\_]^```b`caadYOТгеZYfea_]]`_a__aacZ^bcffiilnYlqnljorwtutxxxzyz|{|{z~{ЗЙ°ЬЩЦЩЪЦЫЦМЙСИЕЙЕztzxu|bkсщќБ]a[ewrruhrkikiriejiej`bedbh^f_^`aefdnmpwpt{tИ~Аvv|ДzБ~~|{А~{~z}}|||v}|z{}ВБКyu|}ДДАА~|{|{~~||~~zy~|А}{|||А~|~ВЗДВВВВЕДЕББВВВДААДВВВЕЕАЕЕЕЗЕЕДЕЕЙ}ХЃЎнn"*;jЬЙКННМПУХХУХУУСССУМЛМЛЙШ√],% /zxxБГЙИГ}БЕ||{{~~~ВВВВЕГГГГГ~x{{ЕЛЩ±∞ ѕ÷„“ƒіЯЩШТНЛЙИЙЗЖГИИИПТУХХФЦЦФУСТУФСПМКЙЙЛЙЙМРРsЂ»цдƒ©ѓ®ЃЃЂЂђЃЃ≠ѓ∞±±ѓЃ∞Ѓ∞≤ѓ≤ѓ≤±≤∞≤≤≤∞≤∞Ѓ±±≤≤∞ѓ≤∞∞≤∞∞∞∞∞∞µ≤≤ЃЂ®•Ш^"&і“—–’ў÷”ќ≈ЭU<@>==?<<<<:::7978:8<;96898::8<<797997989<<=;79;;8=6<;::;:9;989;;;<<;;77755998B;78999888899;<;<;<=<8<=<;991>ЮхзКZkhijhihkjkkgg`0(p`aiegilgfigeggegdcbaaL7(5`hgddd`ZXSTRRTXY\\\[\[\\ZWSQNMKJIIFFDMM'*[UWWZXXXXTURUUUKXXTWXWWWTWYUTTTUTXXWWXWYYYZZWYYWYWXXXYYZZZ\YVYXVXVWRc*J\XZYZZZ[ZY`Z[[Z[]]Z\[[[[]ZY[[[``^^`\Z[Z[[[[ZZ[[ZZZ]_\\Z\\]]`]Z[Z\Z\c[[T&Z_^^[^`a_`^_`````\__^b`b^`bbd`_`^`b`ddcaa`a`___ab^``b`bbbabbdbbbeddfdf_ZK=c`_^^b_`cc_fb`kd`b`^^`^`bb_`]```bdbbbdd`b`bdb`b`^]`ddba_Zd^ab`h``b``^aaaaba[P%/[aa`````bbb^d^^]^^bbdcdda__\`aZ^]]`Z_`^a^``_c`^^^`b`^``b\_a_a_\_]^^b`aaca`c_MИ—ўY[ddbb__a`_aacac`bfbdedcgechhgefiionoqkolnrppjporpplnrsz}ВВБГЙНСРСЧЧЮ¶ЬФЛЦЙЙЛЖruцщћ|rlmr|}~|tslklpqmrrrrptrpwpppkkmim^_e\`_fi]eiXdf^kfekklorrrsu|}}~xxz{ВДАА~zЄДББСЙШНВБ~|}ВБ~ААВБ|~Б~||||~ВААВВГГБББАЕДЕББГАВЕЕВДВВВЕЕГГЖЖИЛИЕЕЕЙЗЫґгсj*%pХ~ЕКЙКМПСПСУМСПММПППММЛЫєP!,%2wyx{}|}ВuАВ~ААБ~||А~}АААВД~Б}{~~{xr~ИЛЩФЈ”’гпмўЅ•ЩШРКЙДДДЗЗЖЗДДЛРФХТТФФФТСРПТНКЗЙДЗЙИИЙНРx®ѕсж√≥≥ѓѓ±ѓѓѓ±ѓѓ±±∞∞ѓ∞∞ѓ∞ѓѓ±Ѓ±∞∞∞∞≤≤≤≤∞∞≤≤≤≥≤∞∞∞∞ЃЃ∞Ѓ∞≤∞≤≤≤∞ЃЂ§Х`&0є—––”’—–ћƒЩS7@?=<;=<>;<<><:9:=8;::78;<<;=<<:999;79789799769969389888896869:9;;;87995999:9<;;9<<:;;::;;<<<<<:<<<=><<<<<<;;<:;:<;79:78989978869<8:99678899769955;7986;;:58;9;49999<;;<<<><<>@I<;:79:;;;:99;::<=<:766449;;9;<;85;;:::;99;6689;<<;88;?89:9:798;:78:859;899;;998776869:97;899;:?<;;<<=<9:9<;<:99;;;::::686799;998;;858977677797981;;9988;;8798;::9:<:<<799;9:;<=<::977::9:968899;7;;;<;<;<<5/ХчкАSikkmmklmkkhgeh"*Пqhkmkjlinkjiklllloookifbb\C/$ $JQHJDLTW]^^_____^\c[Z[YZWTMKHKJHFOR!*aUWZXWWXXXXUUYZYYYVWZZZWWWXWXWXXZXXXZZXWUUXZYZZYWWWYYYZWVUYWUXVVXVVZN:CbRWSTVVTVXVWYZYUVUXXUXVVXZVVVVUWZZVXXXXYYZYXVYXXXXYYZYZXZVVTVXZVXZYZVXI(]`[\[]^^^Z_b]_^\`\\\\^`b_\`__^^]b`o]^^^_^]`]a^Y__`_^^^^]`\^``b^``\_^__ZZOMf__edcbbdb`d``bbada`df`_^]]b``bbbddddb^`b_```_aa_baaa`__`__```dd```^ja__`abYH,5Z[^`^`bbghdbb`bbb^f``bbfbefdfdZdb`bd`dbdbca`_^``aaea`ba_aa^abdbbbbaa_ba^fcbdHСґ†^^ddbbdeca``^``beefffpgffbbdffdddffd````c^bdddb`^ddbcba`bddbbb`^`baa_`^\``a``WMБччШTZhd]]`dhffhjhjnjmrtruruuuu|ГИЖСПУ†Н£†П®ЪґЄСІ®†ХЫШИИКЖywwkqvrka^rmfmswgytlНlpЗn{mMMhuМhfami`hhgj^jX_j^fhchcarnkpnrx}{~В}~}{~{|{~~~ЗДЕЙЙЙЛЙПСФѓђЮsel||ЗЕИЬМЙЙЗЙПКђєЫЧЖРСТУФФНЂУ-"+! #/Гsx{ВАА~~y~}АВБД}|||y{zxzz{z}}Ж|{wwЕКЙЪЩЙҐ≠іЪzГГ}АВ}~{~~{}~БАВЗЗЙЙВБИЖЙЙИИЖЗИЖИЙИЙКЙТВ§№увЉ≥і≤≥±∞≤∞∞∞∞≤±±≤ѓ±±±і±∞∞∞Ѓ≤Ѓђѓѓѓѓѓ±±±≤∞≤∞Ѓ∞∞±ЃЃ≤≤≤≥≥≤∞ЃЂ±©ЬМ[,SЅ––ѕ”’”“ќ»ЩL7>===:=<<;;;99;999:9;8889;;;9;9;<;;::8::99<76896889884857:886789998;;777=99:;===<9999::979<<<;<;8;;==<<>C==9:=;<<987979::8;789;;;999;9;;;9::;;97=9;9;9;<;<;39<::845869998;;897:79:9<;9899997::77939;<<;:<;=:>>C=5ТчзЗedqmommooonmgir#*Ы{lqooookmmmjlmlolllnomomqoqbC#$>QZcefgjgddecea\^^^_^\ZUUQUNMMKRK0xQUZZZZXZUXXUXXUZZXYXXYXZWWUWYXZZZXZYYZZTZZa^[[\^\Y[ZYZXXXVY[ZXWXUWgX5*MRRVTTVSXXXZXYWVXVVXVVZTUVVSVVVSVXSSSVYYXYZYXZZZZXYYYVVZZXXVTXXX]ZZXZY^C".XUZ[[ZZZYZZZXZZZ[ZZYZZ]ZZZZZZZZZZZ\^\_^_a__`^Z`_`_b_`____\aa_b_ba^`aa__XJJW^^_b`f`b_T`ZZ\[[`^__\__\Z]^]^^^`bbbbb`]`aaccbbaeaaca`\\bfbbkbbbbf``caib``aYN45VZba_`_bbbb```^`^__b````gbbgffbbd`bbbedfddb`fddfefffedeefcdecaba``ab`bb^b`bgSЙјХ`b```___e```^a``__ecegeeid`ddffdbdcffeeaeeeffbbb]ddddhddhfdfhkbda_^_b```da[aaVPРсуzN\caa_a\\\^^adbabbdddjdfhdfhbbdfjljhjjgmoqprrrrx{{|{ДЖИМРХУШЧФР°ФФ£СЬЬС†ЦУЩНРСЗЛГu^@!_~mRK^iШ–ѓrrmksrrsntwrvrpvrrЕqsАuАonpelkendeh]cbXe]eh[cdmspswvswy}|~{|ДyyБ{~ДЖДДЕЕИНЬµХНДМПЕХ∞Є¶≈Д!%'+ГovБ}|~~{{|~}~Г~АБ}xzxx{xz{{{|ВИДДИНЮЬ†Їѓ≠ХГЖДДА}{~БАБ~~~zzz{~|}БГДДГЕЖЙЖДДГДБААДДДИЕСН•гн№µ≥±≠ѓЃЃЃЃЃ∞ѓѓѓѓЃѓѓѓ∞∞∞∞ѓ∞≠ѓ∞∞∞∞ѓ∞±±∞±≤ѓ≤∞∞µ≤≤≤∞≤≤≤≤і≤≤ЃЃ©ЂІАZ&s√ѕѕѕ÷’“ѕЌЋФJ9>==;99=<<<888<9:98799999;;77799:::9:88;97;9;:;:9<:<:69<:996578::;:8;89999:9:;972977976<::968;9;;:8894<>B92УчзГainimmooomnoiqm)0•ҐnrqqqqrrttmjopqoprqruvvvxuАe2_САutqsrnmlkkkfdccccdb_[XNPRQPJ]E?jQUYZ[\]\Z[[ZZZY\YYZZ\[ZZXZWX[[Z[[Z[ZYZZUYZaZZZ\^\WYZZZZZXYYZXYWXUW]]0*RQVVVXXVXXZXXXVVVXVZXVVVVXVVZXSVRVTVVVXVSWXZVSVXVS[XYSVTVVUUSVVXZZZXXSTA/TZYYZZZZYZZ\ZZXZ[[^ZXZ]ZZZZZZZZ]ZZ]ZZZZ^_^__]]]__\_[\Z\\______``^\a``^^ZF?=<:<===?<<<<;=91::<:<:::7779:::997559;999677767777779:997669::;9697:9;9<:;:994;;<<;9;<:;8:<;<;;9;;::=;<2ЮциЙ[oohkomoqopoklk +•Еyqqrqrtuvxvttvtuuwww{{}~АВПУF ИІДzzxyuvutsqupmllkkmmhebZZZZWMOFCsX[\\\^^\\\SYZ\[[[\Z\\\[[ZZZZ[][^^^__^^^\\[[[^^\^^QYZY[ZXVZYXYZXVUWYW;.STYXXYXZXXZXXXVVWWZ[ZZXXZVXX[XVVYZXXXXZXTVVXVVXZXVXUVXZVTVUTVUVVVRVVTSW>1SSYZZZZWWZ[ZZZVYZZ[[XZ]]]Z]ZZZ]\Z[^\Z\\[_^__]]]_]]_\ZZZZ\[]a]\_]]ZZ\][bXDMf__^a]^`_^_a_`b``bbacaa]__]_`_]abga`h`Z`_``aa]abab_abbdd``````aaabdac_\\^ac^XLIT^b_`aa_ab`^b``^dd`^]_````d`bd``befcacc_b`dd`bbbbcdffbaaebbcaacd`gmdbb`bbbbc^И≈Б`^bb``fdbdadeifc_aefedefgffhdgffjfcfcccacacccedf`b`bbbabdhfbb``bdbbajgeaecdfe^YПиеrPddb``\aa\\abbbadbbidb_b_^_f`aaaad^`abcdfddfeeeeefdccchejffgghkkhhikikkhmrrxxuИРРZ.!BУА|Г|ПђЊµ†ШЩРФШПУСЛППЙГЕ|xzrstwwyzvxxwwrx|rxtuxwxЖuxxrysrrrvvsuwsxqstjrjeoqjmgkhjpcpw{|ІЯУqЂщьхУ  3Аv}{~|В~АБ~А~В}{zxu{{{{{wu~~~ВГАИЛРРЙВГ|~~||}}{БВВА|{А{|{}}}Б}}|||}~АВВВБИ~~ААДДИСРЧлпёґµ≥≤±∞∞∞∞∞∞±ѓѓѓѓѓ∞∞∞ѓѓ≠∞ѓѓѓѓѓ∞ѓЃѓ±∞∞±∞≠ѓ∞∞∞±±≤≤∞≤≤≤≤Ѓ≤∞ѓ©†Я}U zќѕ–ѕ””ќћћ√ТM<@>::9:99;<<>>><=;999:<=;;;::9<;<<<9::<>9;;9775469799999:7;866868:9487:;<;;99:9:9<;;<<<:9:<:<<=<<;;;;<<=796†шзХZrqmpqortrrmkpk-%Љ∆jwvtrtrtxwuwxxtyy{{y{АБЕЗЙЮ≤O Йђ{wvvvuutrtrvrnpooqtwwqqxohfbd[QB{`ddcac`a]_Y\\]]^\\Y[[\Z][[[[_]Z[]^__^]a_^__^__^ab_^[[a]Z\[Y^\ZXZZZYZ5#Y_YYZZZ[ZZZZXXYYWTZZXVXYZVXXVYVVYVZX^XXVVZVSUVVXVXXVVVVTUVYXXXXXVSRXZSX=!5SZWXXZVVYYZZXZVVVWXZXXZZ\XZ[[ZYYYWXZZZ[^\\]ZZ]^][_`_\ZZZ\\\e^\\]]ZZ\^^YUDKe^][\\]``\\\^```^^`b__Va_]___]_^_`]^aa^bb`^ababebebbcafmdcaac`baaa`aa^Z^aaa]VPPVZ]]^_aadbb````^^``^]_b``___b`^^aadcacb^``bdbbb`ddgecdacdebiabdffb_`_ab```beYЗєzfidbdgdcccagccfcaceacdcffffhfegghfeiefeceacffeffbdbddbadhdfd``e`c`bbfec^ebbdd^ZФЁЏcLedeb\_ab__baddfcabf``_bcdcmadfddjceaccbdffjb`cccca^Zcifdbdc``eececcceeaaceffdjijeW(%C^ojps{КЦЩФУЧРФ†Ф††Ю£Э≤Ѓ®ҐЮЭШХШЧСЙЕЗБ|tu~xsrvzpppqrsstvsuzvtuvzvz|}zzБy|truy|rqrrpvcqlrЖҐ£xVб€эъЭ CИyw}Аx~zz|z}~}~}~~yА}{yuv{y{{yyy|~~ААwБГГГ{xx|z|||yА~|ВВВА~|~}ААБ~Б{zzzzzz~~}|~ГА~ГАДВГНСЬпоџЇµ∞∞ѓ∞∞∞∞∞∞∞ѓѓѓѓѓ∞∞∞∞∞≠∞±±±∞Ѓ∞∞ЃЃЃ±≤∞±∞∞≤±∞±±±≤≤≤≤≤≤Ђ≤∞Ѓ®•£xOПќѕѕѕ’Ё„– √ТM>@<<::9:999;<;;8:;;:9:==995899:::9<;<:789;<9;:<:779;;<9:<<<19;:799999<9;::8899978<897;=:77:99:<<<;<;9;<=?:5ЮщжУ]ysqsrqttsrpmur%%Ї≥{ywyxyxzxy{yx{{}~А~АДДИЛН°єP Й•xxwvwuurrjnpplnppstwxvwztoniovPBЩpjjhhhgkihbbgdcc```]_][\___aa__aaa_`\^__aa_^_^_ae_^^Z[\\_\Z_\[XZ\\\`1!doY[]]]][\[[ZXYZZZZXXXYXZZYVXYZXTRXZ^VVVXZVVUTXXVX\VVVVXTXXXXVVXTRSXZU]OY]bb^jorvxzxvАДАБКУУУЧЮЮЮЯ°§§®®®§•¶£††°†ЭШЧЩХНЛЛПЖЖББ|v~pm}zuzrlxywrxysvsruxvvxz{yxsjktxzT[у€€щ£ TСwz}}|В|z||||~{~~x|}{ut{wywp{{{|||ywББ{~||{|~|~~~ДДВВ||||~ААБВВБА||x~}~АВВ~АВБ}}ДИЕВЗНҐмфЁЈ≥≥∞≠ѓѓ±∞ѓ∞ѓ≠∞ѓ∞∞∞∞∞Ѓ±Ѓѓѓ∞∞ђЃ∞∞ЃЃЃ±≤∞≤∞±≤∞±±±±≤іі≤∞≤≤∞ЃЃ®ІІuL Чќѕѕ–“”–ѕћ√ПK@@>><<9:;97:<::99;9:99:97847559999:9985:89;899;9477;97;;:<:8;;:;;99;:>::<;99;;;9188?;9976797599:;?;1ЮщеНlyrtvttstsrpo{s%%њ¬}}~~~||||~А~|}~АВЕЕЗЙМРНП¶љK ШЮxxzwxrrrrlrnnpnpprttvvttrrnihtDJЫl`hhghijjhgilfedbeeibcb`cbdgibdidcgdba`bdccab`Z_a]\]\\_]c_R]^[VVZ\\`('kd^[Z][]Z^__][XZY[ZZZXZ[^_ZYXYZZZZVZWYVVVXXVXUVXXV\VVXXXVXXXXVVVTRSVWR[;8SZUZZZVYZ[ZZZX\ZYYZYY[[Z[ZXTZ\ZZZXVVXZVXZXXXZZZZXVYZZZ[ZZZZZ\]]]V\ZZZZVVHBWVXY^Z\\Z][__ZXZZ]Z]`_b^^^[[ZZ[]Z]^^__]_]a\____][__]]]Z^]]^_^aa^^`]ae^``_]\ZRORZ\[]a`bbfb`bbddbb^bb`b_]^]]]```bb``__b```abgb`ddd`abadea`a`db`bddbddbddbffcfaБЭreecfdd^dmgeeecrecaccccdbbd`f``bbbfcaa`^aeffifedfdceiaaadfdceecfa^^b`aacfifbfglZТЌ√Lfhchbabfg_^__aaaabac`aceebceccdcdca\bfecbZbdgdfdfgefbdebbdbcaaeeccadea_^^]bcaac`\bF/%9PRUZZ[]^dfhkeflg`_hpqrnrt}БББИСФЩЩЯЯЬЮ®¶¶¶†®Ђ†І££¶††ЭЩЮЩХЧТУРРНЗЙЙЗГz}suus{vovrrqaekrpSWеэ€шx 4pНtz}|zz|z|z||||}~А}}{{Аtv~y{wy~{{y|zz{ВА~~~~ААА~}|||ВДДВ~А|АВДГВА~}|}z}||~~{~~|А|}БВД}ВС®мхё≥≤≤∞∞≤Ѓ≤±±≤±ѓ≥∞∞∞∞ѓЃЃЃђђЃђЃђЂЃЃ∞Ѓ∞∞≤∞≤∞∞Ѓ∞∞≤≤±≤≤і≤∞≤≤∞ЃІ®©¶sI Эѕѕѕ–””“—ЋњПJ<===<:<==:698899899<:9:9798<5299:9::977@588899995979959:79889;599779999:9;;;;;;<9;9<<=<;::<:<<9:=;==<2FOWXZZ[ZZ]ZZZZZXZZZZ^]^\\\\_ZX]^]]]Z]_^_]eZ_`]^[Z[_\\^ZZZZZ]]]\Z]_\\b]Z][\[ZM@HVZYZ^``bbbbb```ba^```baX^^baacbddb`__`dbfdaebddba_``_bd`ab`b```^bbbb^bb`ee`aezЧiVfchdbbdffefeejaccccaefcdfbjdddbddcdfccceefhfddddbbdbac`aaaccee`]bbbcceacececf]Р“њHhhahfadahcaaba_adadfcddfeceedbfdffdaagdae`b`dddb`ddgbdbbddceaccbabbd`ab]]^aa__aab`H5(AQXYW]^_``acehfhdcbebcgifejjhagoghrrsuxt{ГЕИМПТПЦХШЯЫЭ††®•Я©ҐЯ£Ю•¶†ЮЭЭШЦЦФНММЙЙМИЕЖВА~m`momY^Мгэм\  \Ъ}vxzxxvvv|z|xz{А~y{yzzxux{y{y{{|{yw~~~ДДЖВБВВАА~А}АВВЕДВАВВБВЖЖГА~z{|z|xw{||~}|А}}А}ВББЛ•ор„≤±≤∞∞∞ЃЃѓѓ±±ѓ±ѓЃ∞ЃЃ∞ѓЃ±ѓѓЃ±∞Ѓ∞ЃЃЃ∞Ѓ≤∞∞ѓ∞∞ЃЃ≤≤≤≤∞≤∞≤≤Ѓ∞ЃЂ•®¶oH Ю—––—““——«ЅРK9>>C;;<<<<;<<HUYWZ[`^`````^^_\\\]``d]^^^``cg^b`____^bbdb`adbdb```bdffdfdbdbbd`bbbb_`dZedZaerЙgYcbhdddbffefcccbcdccbeecdfbbfdfbaddceeg`ddffhfhfdddddcecdddcbbdddbdffcc_acacc_XПЌґGjedaddfacdddba_\^adffhheffigefhfggffffdecfddddff`dbb``bdbbaacac__b`b`_b`^_^^^_aa_]J/*AM_ZZ^__`cb`bfcefced_ffhfbeeeeggechhcgdj_ikirodjpqu{wuДННМХЭУШЩ†•®•†ІЪ££Я®Ы°ЮЧЯЫХХТХМt^k~r]`z¶зЋK В£}xzzxzvxvxx|~z|~{zzxtuqvwwyuvw{{{xz~АДИИЙББВВАВВВВВДЖЖЖДДДЕЖЖИИИЖДВ}}~}{wuy||||}|}|}zАБyРЭпн÷≤∞±∞Ѓ≠≠≠Ѓѓѓѓѓ±ЃЃ≤ЃЃ≤ЃЃЃѓЃЃЃ∞∞∞ЃЃЃ∞Ѓ≤±ѓѓ∞∞∞∞≤≤≤і≤≤≤≤ґ≤±≠ЃІҐ°oK °”–——”””—∆јУL;>=>9==;<:;;7968;858<;:;;<;/55578;99999999;79:9998:8;:8:5;989;85766:999797999;7779799:<<99;78<;;;;;;;<<<<=<§шг°YyxwuuyyyxyytДp&»Ѕ|{ЕДДЕЕЕГГЕГЖЗЙЙННСССТФЦЦХ†≠9 ҐС{ywyzwtutrnrrprrtwzwzzwttoojltOhЂqfkhfkje^__^\YZZYYZ[Z_SZZZZX\YYY\Z[\__efiptvtrmhdbefcchhefgiimkjggng$uofedfeda``ad`^\^^`]^^_^^\ZZ][X_]\^_]_]YZXZZZZZ_ZZ[ZZZZXSXZXVXXZVXZZ[YhD"XUZ\[\\\Z^ZZZ]ZZZ]ZZZX]Z]ZZZZZZZZTXZ][[ZZZ[Z]YY[ZZ\\[XZ[[\\[UXZ_`\\]]]^^\\V?9?≥хгҐf~zxxyyy{yywxКj,“љtБЕГЕЕЗЗЖЗИЙДППЖНСУФЩЩЩЩЩЫ¶†+&ѓФ|~zvxvtutrrqqrsuvzz|wwroljhgtG^Ђuhjgdfhc_^[ZYYXZZZ\[[YYY\\[\YYZ\\^^_]]adluzzog_YUTRRRKMPMNMMGRRQNZ["xm[WX\Yad_ececb`rcagfebbccc`aa^```a`\ba`]`__\][]\ZZZZ\Z[[[Z_\XWZZZZ][\bF"Mba\\\^\[\[\^\^_[YZZX\_ZZ^\\]]]Z[[[ZZZZXVZXXZZ[[ZZ[ZYZZXZ[ZY]XXVXXZZZXYX`;'AMQX[[Z\ZYeZSZZZZZ\ZZZX^Z]]]ZZXXXZXZZ][\Z\Z^Z`]ZZ]ZZ\\ZX[\[[]ZX[\ZZ]]ZZ][[YU>2HWZZ^[]_``]]^_]h`__`__`^\^\\]_ZZZZ_\]`bb`dbabbacbabbbbaa`a__a_]^^```fb`bbbdacapza_iaafddbdfddedbdchgbb`bffddddddfdmggugdkhfdffccceedbddddd^bb`bfbbfdddddbefeegZ\ЦЅСT`fddffdfffdddfdbbkgdhdhffeccaddaaddcca`daeefdbffdffbddddb^eedadcaaaaca``_`b_b_b`\YL9;<;:<;88;889;<:9:;<<2?ічкЭey||}}}~А~}wАj.”јБЖЛЗЛЙЛСНЛЛННПННПУНСФЦФШЧФђЫ/Ђxyxvztvssrtrpqrrvy||xrrrqmmlГC_©s^igijhc___YZZZ\^\ZXYZYZZYY_YYYUYZ^_\`bjsz||vof`XYXLRRNNNOPJMOCJMMZO!(ЗuMLOJJLJMGKMQLKNOMOPRVRRUVXZY[^Zbhklmomklcc_\^`^a_]`a]__]Z`^ZZ_]]]_\ZgM)Lte^\\``\``_a]]``ah_^``Y```__^Z[]]]\\ZZZYYZZZZZ[[Y\YVXYZXZZXXZZXZZZZXZZ\e5$AYYYZ[Y[[[a]ZZ[]ZZ]ZZZZ\XY_ZYZZZVXZXZZXXXVZXVZZYXYYYXZZZZY\Z[^[\ZZZY[VZZ[[TP5*HWX[[[]ZZ^]]^[[ZZ\[]_]__]Z[_^[]__ZZZZZZ]\_\^_Z[[__a___bbeeaba`b``bd`bb`Z^`aa]`mm^]e_abbhbb``aace``abbb``db``a`^b``b`bdbbb`bccceggefggfdggegddfddbbddbdfjhijffga`З°{_edfddbbhdd`fd^ffdhbdbdbhc`efifddfhffifeddfhgddfffffdiigjfccddafdbe`bacafceg`a^`_\_C9/<<=<<<8<<9::<::;;8;:5767;:99558678579<;7775978995645579981A;39:::<;=<<9698889;;<ZZZZ][^Z^_]]Z[ZYZZZXVZ[\^`[Y[Z\ZZZXZZZZXXZZZ]YX\YWUYXXZXVZVXZVXXY[ZZQZ^[\VN@'JSX[[[ZZZ]]]\]YZZZZ[Z\]_]][[_\Z\\ZZZ]]ZZZZb\_Z[Z[[\\Z]b_ad`_\^\^]\`_`_`_^_^a\^fa[[_^_``bbdbbdace```dddbd`b_```^`__b`bdbbb`dacceegcdgffbeecee`bcdddjbbqbefeefiec`sЬf`behjjhfjffhhfffmfffdebbdbcffifgdbfbbfebdfggfdddfefgfhffgedecdaed^dbffecjcfgdaaa`_bI3+>::<<:<::<9<:77:7:;:979999;:<59:299999;9;897976874545558643:93899795796616599;<<<<;5<<88A<:<<;<=;=;<<<@A<;≠цеЮrГ}|~АВАБВВБКh'–єБЛЙЙИЙЛНППППППППНПТТУФЦШЩЩѓЛ 8Ѓzzzxxwsrmoqrrttsx{yyxwutqoomjw<bЭkZfdcgeb\Z\SYXZZYZ^\\ZZYYYWZZY[XXY\^`ciowДА||kd^\YURSRKPQQPLNMJLMK\U*ЭКGILJIJJLKGCGIGDEGHGKJJJKLKLONSRZ`gqrojc^URRNLMOPUOQYQRXUWfZYWYa[^`^_sC.VБgaaaZ```bc`_Zdaaca```]`ab``^_`^]f^\`__a^\\]]]b_\_\\[Z\ZZZXZb\[c^^^[][`i1#@ZY[]]]^\^_]ZZYY[Y[Y[ZW[\\^[W^[Z]ZXVXZXZZZZZZ]YY]\YUWZZ_XZ`ZZZXZYYZXZZXZZ]\ZL5FUVWZYZZZXZZZZWXZZ\ZZZ\^Z[ZZ^[[\[ZZ]Z]ZZ]Z`\Z\\\_^^_]_````]]\`]c[Z^\__\_^\a]VZ[[X\^]^a_^bbb`bb__aaa``dbd`b`^a``b`bdddfdbdbdcdaceldffdgbbeaeaaaabbdbbbhbbdbcecb__fma_`eefhhfhdbddffhfffeeefbdddggegjffkffhhfjhgffdgfdegfdhbcffeehbbcdbf`bbcajccecaaaa__I,,>Vb]dfecfeaffeafefda`dhhfdaiiifgdcgifeeecb`d`cbabafc_ea^lefaccigdddfaddaaa`aaaeijjnge_ZbҐЖ]lffhfb^\Y8*}uqvxvztwwsrtuyy~~~БГА~}zzxwxwtutxywyz}ЙИЙИМПМКЕБ~~{|Бzz~~~{}|ДСЛРСРМИГ}}zxzz|v|zzyyy{А|ЖzФЈмз¬Ђ≤Ѓ∞Ѓѓ∞ѓ≠ѓѓЃЃЃђЂђЂђђЃђѓ∞ѓ∞∞ѓ∞Ѓ∞≤≤∞≤≤≤≤±±Ѓґ≤≤≤≤≤≤Ѓ∞≠ѓѓђѓђІҐФd4+±—––ѕ“”“–»јФC;=<;9;;;;:<:9:9788996759:9889;3889;;;<::797<<;;8:99977978988>958837744566447988;;<;;3;<88F999:;;:=<;<;=@?C=іцжЮt|ВАВГДВГГЕДСn*ѕЈЕЛНЛЛЛНЛПСПННПНННРТТУФФФХЩ≠Ж DЪozxzwwsssoooqttuux{{{zvtronqmj~CcЧfdeeeja^\ZZZZZZZYZ]WZ\[XXYYYXXYZY[a\cfltzА|tea]XRTRROPQPPRLPPOONM\Y-ҐХGLLLGGLLIKFGGGEFHDFIJLJLJJJKMPPY^hqsmg]XSLMKGGHHJGDDIIJKJLMNNOUPPRQVb?,[Сe[^\Z]d`d_^_\f_^cehcacfbba`a`bb]h_^d``e`\__^]]^_dZ\_\ZZ]ZZ^^\[`[`a`^`ai3!D[Z`c]__^^e]Z[[\\[\[^]U^ZZ[[Z^YZZZYXZXXZ[[ZZ[ZY[Z\ZWVVYZZZZZXZZZ[[[YTXZZ[]YRI2KRVX[YZX]ZZXXXTXXZZZZZZZXZWY\[\\[Z[ZZZZ[\Z\Z\[\ZZ^^Z\`___[[[__]ea``^^``_`^b^]_c_Y]b^_a]]b_`\``]]^]^`_bb`^_a^aa```abZ`dd`b`bbfaced`fffgebdcbbcbcdddbbbbbbbbcbab_[]eRW^gbdffdfbcccdbddbbdfddbd`ddeeccgdccdfhhhfeefeffjikdbmefifejifdfjddd``a_ccefec`^^]aD(*>=>==<:<=>9;;99;:95577::78:84978899;:;8999;;9:;89:799587859978849;99:;8878<;9<;;;;99888;<::899:<<;<<>@?A=єцвЬr}ГВВАВДВДДГЕПk,ћ≥КЛПСССПППТСПННСССРТФУФШЦХЪ≤}Lѓyururprrroqpprtuux||}ywuronjjjЛ;bЭffgggga\\\\\_]YYY[[RZZYYXXVVUYYZY^bZbggu}А}|rgaZYTUSQPOOOOPGMOMOMKZ[*£ШDKIIKKLMJLLJJGGJJBIIKHHJHJJJMNPY`irrof]VQMHGDDGGGCBEFGDFCFGFGJLDGGJHRE]Ш^QVRSRUWXVYZY^\[ahgdfehefhhlihihhfebb``^````Z\^abZZ]]Z]][^^a^[``g`^Y`^o3PaZ\_^^__]b__aba`_`]^bbd_\]]^]\^[[[ZZZZ[[[Y[YYWXZZZYVVXZXXZXZ]ZZZZZZVZVXZZZSI9HXXZZZZZ]]][YZZZ\ZZZZZZZZZZZ[Z][[Z[ZZ\XXZZZ[ZYZZZZ]ZYb]]]\[Z__]`a^`^^_`\``_^^er\Y[_]^_^^f^__`^^^]]aa`bb^`^ca`a`a`^`^\__``_bedbbb^``^bbcadb`bdbdddffdbbdbdcd`edb]ZWPZbnddhdddbdccddddcddhgb`b_`bceeceececcefffeffeccmbeb_hefifdfdhfdjdffbceecfefeccaaZcD(,>>=<=9:<=;;<;<><;97979:99=99:78898;:<8:788:8999:88:9885769998889999;<;=;9<;<=<:9>9999<<9;<;<=<<<<5<>>>A;ЉцбЯy|ДВВВАВВАДГЗМg.∆ЈЛНПСССПННССНННСППРТТТФЩШШЫ≠r V±yxxytrrsuoqprruwwy{{|wwurpojhdЛ3gШhhgegga^_\\Z\\ZYT[Z[[YYYVVVVYYZ^Z]_Zdhgv~АА~qf_ZXWUSRPOOPORMMMPPNOVR5£СGJHHIHHKMJJJHGDHHIKGCCHHJJKJMMS[`krsne[WSOHCHHOGDGCCFDCCBCFCFGFCDDGHRFP§WGKJJHJMMNRKPPRUVVVY___acmknlqppnmlhjeceddbcbbbcab^a``__`^^`_`a_`][Z\Xm6!XeZ]_______]]bb_aaa\^`b__\Z[_aaa_b][]]]]]]Z\[[ZZZYZZVVZZXXXZZZZ[ZXZZZZXZ[Z[PH4JRRVY[ZZZZZZ[ZZZZZZZZZVZZZZZXXZZ[ZaZZbZZ`ZZXZYZ]\Z^ZW[[Z[ZXVZ\Z[[UZ\\\][^Z\]_em[Z[Z\[^^]^^\Z_^``^\aabbb`a`bbecaaa`a`^`b`bbgbbb``^^b`^bb^bbbbbab```cbbbbbbaa`ba`[YSJYcffggffffbdceedffieefe``_becegeecceaeedhfceefcbgbbd_ffdgdabdffdfgjfcecfeeaccccca\l>.1@Pn_bffjjjnefnfffecc`a`^eedhdfgdgddbdheddb_d_bcbedfceffbedceefedgdfdbd__adcecefeidddfceeКuchdaaa`da^ZXhrvtuywtttrtttxzzzz}|}~~}zxxwtrwuwvzxzy~ЖЙЙЙДЙЙЗДВВ|}З~АА~|~{|БДЙКМНМНЛИ|xxx|zzzxzzz|||{~|Д}С мжЉ∞≤ѓЃѓ≠Ѓѓ≠∞і±±ѓѓѓѓѓѓЃѓѓѓЂђ≠ђ≠ЃЃЃі≤∞∞≤≤ЃЃЃЃЃ≤Ѓ∞∞∞Ѓђђ®©ђѓЃ®ІЫЦd-! ?Є––ѕѕ“””“ њПB9<=>==3<<9<9;;99;<=<:9;79:79=<:=:8:;9;;;:<::798<;::89:998555588878:6849;;=:9;;;;<:9:7985;8<<<99@><<99;<=@C8єцгЂВЕЙЖЖЖЖЕДЖЗЖДМh-√≤РЛПСППЛСПНПСННППППСПРТФУХЬ≠k gҐvx{zwusrroqrrtwuyАА~~}wutsonjiГ5#hРigecegc_^_ZZYYYZXZYYYZXVVPTVVXZZXZ^_ckpyДД~xpi_ZWUUPVUSSRPPMNPSPOSWK!?†УKMJKHHIIKKJIIGDDGFCHDHFGLJKCMMRYcsrrldZUROJHHJHHGDCDGIEFCEFGHGD@CFHJbBZ¶UBGHGDDHJFJGGGHMMGKMLRSXY^_gmsqljhecc`a_ab__bab`bdadcddbdebeehgfhba`^^o5#Yk_`^a_aaa_][aaaba_^__``\\\]__aa]a___]__^][^[]]]]ZZ[WZZZZZZZZZZZXZZZZXZ[[Z\RD><:<:<=;;99<:9:776=77>97;;99979:29:999::9989899899::768889:8;<;8969;;::;;;;;<;79;:;899;;;=9@<:<9:<=8<<-¬хгЂГГЙИЙЗЛИЖИКЖКСl2√іУРТПСПТТРСТТПСППТМППРПУУФЬ¶a lЭwwxwusroqjqrruvuy~~Ж~|wtrqonlhА<#rЭkfeegca_^Z\\ZZYYYYXYYXXYZXXXXXYYXY[]`hqzА}~yrgbZZVVUTVLRRQQLMPLMMOVH)?ЭЩMQQOMLLLLJLJLJGJIDCJFHFGLLOILPRTanqrkcZQLLHGGGDLGCBDFGJDDHGGGDCEGFHJN?QЊTLLLJEIIMJJGGHHJKMKLILQPQTSagtmc`\YWWRRRVVVZZYZZZ\[^^^ja`d`dbdgghgfcaaj5'fidfdcbccacbbbbbebbbcb`ab_aa]__]]]__][[[\\[YY[Z]][ZYZ]ZZ[\Z[XZZZZZ\\ZZZ\]\XN=?STfX[]ZZZZ]Z[`ZXZZZY[ZYZYXZZYXXZZYWXZZZXVVXXXZ[_\ZZ[YYZ[]]ZZZ\Z[[[[^Z^]Zc\`\atrZMY\\^_]ZZ^b`]^^_[Z[[ZZ_ZZ[[``]\\^]]Z]]c]^\\ab_`b```db``^bb_acecebcb`bd``ca``\]ZYZNPZ_abaa__bb`caaabbdfcccceccceebkfbdcccbefieiiegde`bggfhgcgedfffhbddccaacep^`fd_fdd[h8.0BWY^bcfcfecfdefeeeggeefeibbfdfjggdebbfgefddodeeeificefebcfdd^ad\a`aa[fa]cefjfgffccbb`__`Еuehcdfffgeeghs|wwuyuxuuruttsv{vz}~zzywtrtuvtvxyyyx||~ЙИИКИЖЖДВБ{~|{|~~ВА{{|ДДВГЙКСТПКЕА{xxxx|{yz|zВ}|ААБЗВ„пдњ≤≤≠ђ≠≠ѓђђЃѓ∞ѓѓѓ≠≠ђђђ≠≠ѓѓѓѓ≠ѓ∞ѓ±±∞ЃЃ∞ђЃЃ±ЃЃЃЃ≤≤∞Ѓѓѓѓ≠ѓѓ∞ђ≤•Иc*_√ќќѕќ”””“»ЉЙC=?=>>=<<:::<;:9<<999;8<<::95><9;;985445567:979997698689969;9<;98<;99;;<<<<OMKLLMLLMJLLJKKGJJHFIIILLJLRX[djrrocZRMMHHHGGDCBABBACCGGDGFGDGEFGKL:Q•c>DJIJIHHKKKFHHHKLJMMLORRU\fp{pia\TQQPNNOINQSQPPRONQONVUSYXY\[^_ef_`\``1*ytfdbbefcbggfjfgifggffhghceebegd`a`f`^bbba\^[]\\\Y[[[ZYXXVXZZ_]ZZ[\_]ZZ\ZYSM;?PVYY[]]Z]ZZ]Z]ZZ[Z\]][Z[[ZZ^\[[]ZYX[ZZXVXXZZVYYVYVXYYYXXZZZZ\\ZZZZ][]]ZZ^ZZ\_ghXRZ_]_`^ZZZ`]ZZZ\^Z^_]\ZZ][Z_`_][[]Z]ZZ\Y[ZZ\\Z_`_a^f`^`____a^`cdcb``_a``a__`b`[ZYRLZ_bcbabaecbccbbdddeeecddccafbbgddbdc``bdfddgddfdecegffgfhhfffffbbb``cceep_bjb`jbc[Z?/1DW]_bdeceeegdgkeecffeeeeicabedgfdff_bdefhfeeeehfffffiefbfcdfdbfddgfceifefeflggfeff``^[_VЛqhgffgfeeeffhtyyutuuxuurttutvvv|z||xxwrrusuvx{z||{|~АПЙКСЙИИЖЖВ||{{~~А{{y{~ВВДДЖЙСМЛЕБzxxyyws{zzv||z}~ВЖrЕџфвњµ≥ѓЃ≠≠∞Ѓ≠∞∞∞∞ѓѓ∞ѓђ≠ѓ∞ѓ∞∞ѓѓ≠ѓ∞ѓ∞ѓ∞ѓ≠ѓ≠∞ѓ∞≠ѓ≠Ѓ≤∞ЃЃ≠≠ђѓ≠∞∞Ђ®ЂГb) a«–––ѕ”””–«ЉИC;;<>=<;;8;:=;<;<<:9;;8;<9;88A=<::89797977;77998:88;886886996;78666899;<<;:;<988;<9<<7:?=<<=<9<;NTYYZ[ZZZZZ^]ZZ]Z]]]][ZZ[ZV[[]_a][[[]ZZXZZ_ZYWUSYWVVXXXYZZZ[\ZZZZYZZZZXXZZXZ]a]UP[_SZ]ZZ\ZZ\Z]]ZZYY`^ZY]]`_____\ZZ\_\][][\\_]\Z\b\]^`]^\]\Z\[``^^\Z__\``a^\^b_[ZWPMZ_acbeaab``dbb`bddfdccd`bdcj`bjdffdfb``bfbdddbddgdcd``bbdbabbddb`d`Zecccccagbbb`b[^>./DR]acffefeeifdmgffggfeececaaebccdjfeeffffeceeffbcifcffieffdfbafacfceefcfeecgfeffihcda][RНefffhnjfdcjfft~utrtvvvusustxxxvzxzxtttrrusuy{yy|}}}~АИЙМСПМКЖЖДА|y{}|~А|~|~|ВДВДДЖЙКЛЙГ}{ywuuvvvvvxvx|~|Ж|ЁиёЄµѓ≠≠ђ≠≤ѓ≠ѓ∞∞∞∞∞±∞ѓ∞±±∞±±∞ѓ∞ѓ∞∞ѓ≠ѓѓѓ∞±∞∞≤±∞Ѓ∞≤∞ЃЃ≠ѓ≠≠∞ЃЃ®•©Гc, j√ќѕ––”””ѕ∆ЇЖC<;<<898;;<9;9:9::79988;993899:::9789:::75<57;=<<:;<;9><889889978667998;;<8758889958818999;89<::=<<;=;;<;=B1ЌчнІ}НЛЛЛЛНЙЛММККУi7ƒѓЧТФСССФФССПТТСППППФХТФХФФ¶ЃA ЗЯzzzwurrrqqqrqssvx{}}urrrnljji}2uИfhfafc_\]ZYYYVXVVVSRRSUTUMSPWUPUXZ\^ckvВДВ|vcc^\YVTRSSSPRPPQQMMMOPVO2x≠ЖQRLLJIGIFBIIGIILJGIKJJKLMLLMMSV]hnuul_TRMMJJHJDCDGCDGDHGGGGJLGDGGEGJc1jЯPEHHKLGHEGHHHHHDHEHIGIMPRXXdosqicYTVQPPMJJKGLKHHJGHLJKMMLLLKNOOOMDLOQMW*%pRJYZUVXVX[^[^fbibesglprrokllijjieefggedb`a]_^]__`a_````bb_]a^`a]\`\_aba^^J/BPX[[Z\^]ZZ]b][[\ZZZZ[[[[^ZQ^\[]__[][Z]ZXZXZXYYWWYZXYYZZZ[[[]Z\[Z\ZZ]ZXXXXZYZ[[WNSYZXZZZZ_ZZZ]ZZZZYZ`[\ZZ[\\\\[\ZZZZ\\[]_]ZZ][^[^b\\]\^a^`a``__`__Z[\_`_``^Z\^^ZYTQMXZ]__a_aa]``b`Xabdbbbdb_bb`db`d`bbbdbdb_ddfddbfgmeefcaddfb`bddf`bba`dcccc_^c^``de_PB+0DV`bejedfdbffeedffhfdfecfccdcccefkjhhgjhgeeefffbcececgfdffce``d^ceccceZabdbccckeeecc_ZVQГkb`efjfcefiikuzwttyyyyuststxxvtxxxvsrspprrwyuwuz|yy~АДИКППКЙИИЖВ|y{{|~|~~|{zБВВВДЗИЙЙГВА|{{z|vvuzzvx|}{ЖВБўоёЇ±≥≠≠≠≠ѓ≠∞±∞ѓѓѓ∞∞ѓѓ∞ѓ≠≠≠∞∞ѓѓ≠ѓѓ≠ѓ∞∞∞ѓ∞±∞≤і±≤≤≤∞ЃЃѓ∞ЃЃ≤∞∞ђ•©Д_4 ∆ќќѕѕ””—ќ«ЇЖG;>?@<;;<;9:>:979:98;86986487797:97:9987:6<99:=<<<<<<;<;9:;99998899:<<:;8<>;77999;9@;98756775::99979<;;;;A89јфиЃАНМПННПНЛЙММНЪp;Ѕ≤ЩФТУФУШЦУТФФТРССТТФЩТФХФФЂЃ>  ЙЭvxwvurrpooonkpqvx{}}zwrqpqolier2ЗЭficfdf`\^\[\ZYXUVXXVXVXVVTTTSTUSXYZY^kuА{r`b\ZVVRPOPPLPOORQNOMMMUG(°¶БOUHLHJHJIFLJGJILLGJJJJKLMMNMMSX]hnsuk^XQLJJJHHGGGCADDGHCDDBDJIGBGDBGY2f≤GGKKJJGGGIJHJJJJJHHGGJLPRXZiqurkc]VUTOMLLJJGIHFFFHHHHJMMLLJHLMMMMMLMLKU/%ЙШGMOOLMNNMMQNTZYSQ__bglrwuonmkgiofeghhebdc`cdccaaaba`caa`a__`abb`_b_bbbb^fG)B[_``^`^]]^]bb^b`]]`^^^^^]]^_\[[]]V[[[\ZZZZXVXZYY]ZZYZ[[[[ZZ\ZZZZZZZ]ZZXZZ[WZXWPQRZZZZ\_ZbZZZ]ZZZZZ]ZZZZZZXZZYZXZZZZZXZZ[ZZZ[[^Z[]\\]Z]^_`bbb`Z_^\_]```_`db^^^[ZXTTR[^[[^__`^^^^`]]`^`Z^b``bb`````b`\_`bbdd`ddedc``ddcggeacceb`dbbdbcbebfdeeccch`bbb__QC/2DT]`cebbb`cefgbdfffedfdefcabeefefggggfhhfiiiggddbegfegffdbbe`^k`cceeee__bb```aecad`b^ZRRyf^[dddeafdefit~wxwzxxsursstxvxvvzxxtsusutru|yywy||~А~ВДЙППКИЖЖГ~{x{y{~y}}{zz~~~В|ДДЖИЙГВА~{{yywwwxxvvzДВЗ÷наЇ≤∞ѓ∞ѓ≠Ѓ≠∞±≤∞∞∞∞±ЃЃ∞ѓ≠ђ≠ѓ∞ѓ≠ђЃЃђ±Ѓ≠ѓѓѓѓѓЃ∞ЃЃ∞≤∞∞ѓѓ∞ЃЃ∞∞∞ЃЂ§А]- Н«ќѕѕѕ””—ќ∆ЇЗG><====@><:;:;979:98;;9::88::=95999997769;<;899;<:::;9<;7<;:9998976:<:9:<;<;99;89;:@<9995::<:<<<::99;<><<<<<;;9;9::97:99:7:898<<9=5557::97:::9;9;<9:;98?<;;79;997<;8:;69:977;6798698:7:;:79;9;;:<=9><<<;9<<<=;;<<879;899776777388;99<99855899798987::<97::::A<;<9799:999;<<;6:79798989887;8:;859;;<:79<499;<::<<<>JD8 цлЃАРНПТСТСФФФСТЪo AЌѓЩШХХХЦЦЦФУХФТПСПСУУУСФХФТЃЭ7 ЧХuvvwutrrrrorrtry{z{{uttrqmhhr*"ЙФfhggfa\\ZZVWVVVVUUUTVRQTRTRPVVVUY\`^gr|ЕЖБ|s]baZVTTRRSUQSQSRROPPOPU=*ґƒnLPPMJJJHJLJJKHGJLHMHJJLJHKLQMPU]irsoc]WPLKHHJHGGGDDDDHI@HGDGHDHGIIHJ\5t£VGHHFGGHHGHJMJHHJLHMLOMOQY_mrsrkb\UMOOMMMBLJJJHHHGGHHJJLLLJMNNNKOMNOOX^!ЧOSOLNMMMLBOMLMOPTTX[`eosrqicZRUSRRPPRPPNROMMLMPKMQTQQQPSSWYZZZ\^^ada_aagiD)LРjgebefdfbbcfgfdd^gebdd_fead`db``__``a]`[[Z[[_^]ZZ[UX[\ZZ[[\\[^Y[[^\[[Z[]Z\Z[T`PUXYZ\\ZVZXZ[XZZZVXVX[ZZXZZZZXX]ZZZZZ]Z]XZZZZ\ZZ\XZXZ]Z\[\ZZ\Z\\\\]Z\_\ZZ[[Z[ZYQMCFMX[Z[\]ZZ]\[^ZYYZZ]]\__^`^^b```^[^^a^^bb```]``^bbbhbbd``b`cccc`db^`^`a_`__``ac_`a_ZPD897;<;99799:767899999899779;96765569799989559::>:9:9998:<<<99<9:97:988878<9:999:;;<9665678;;;;<<«сж≠ВСННТСТФЦФФСХЬh >ѕ≤ЧШЦШЦЩШЦЦФЦФФУФУФУФФЦЩЩШФ≥Щ2  ЮШxtrrrrrrrrrrrrrxz}}{wurrplljhik+#НЪbgeefc^_\ZXYXYYXQWVUVRUUSRVVWVVZY\b_hr~КЗБ{qca_[YTRPPRPPPNPQPOMNNPX?2√ЇeLQOMLJLJLLJJLHJLJGKKLJLLLMMQSSV]irБqdZVPIHGGHDCDCDCGDIH>GG@DFDD@FHHLd.pЩWGIGGGGIHHLHKJJJMKLOPPQSV]gpssrkc\ZUPMJNJJLLLLLJHIGFDDGJJJJMNMMJJLSSOSW%ХЖMSOMMMMMLGMPOLRPRVW[`jsstqibZUUSSRONPPPQSMLLJJLHJKMKLKKLMNLNMMMRRSQUOYXV^>(VИha]Z^_gcafbfhhhgnmfknhhqieccdddb_\_`b^__^ZZZ[][Z[[UZ]^\^^\\\\]\\[^]\]\^^^aZYPWPSXY\``]Z]Z\][\[[Z[[a[ZZZ\ZZZZXZZZZZZ[WYUYYWXXVZVV^XXZXZ[\[Z[Z[ZZ\ZZZ^^Z^_^[Z\YSLCCKW]]^^]]Z]][^[YYYZ`[[^ZZ\^]]^]]]Z[^^\]]]Z]^]]__aaaba```bbabbdcd``_ba`accb````c`_^^YOH<CѕриЃЛУРПППРФФЦФФЩ†` <—µЧЩШШШШШЦХФЦФФФФУФФФТЦШЩЩЦ≥У*  †Ъxxwutrtstrttttwx{|usnnjjhihhe,"ЧШ_gaba_ZZ\Z_[TVVYUWXVVRSSSPRVVVVYZZcchsАНЗБ|ric\\YTVTRSRQPPPOPOLMMMW>6–±bDPJHHGHHHH>GJHJOHGHHJHJJJMMMORV]iy}og^ZUOLHHHGHJDCGD@GGEDDDDDCCBBCDJ^(kТPDHGGIGGIJHHHJJJLJLMOPRTY]flqwrmc]XWROJMLLMMMMLJKKMJGHJLLKLLMJLJHLNMO[S!!Ф}QRNMNMJKLMMOOMQQPRX]ehrt|mg`ZXXRURSQPPRPOLMLLLMJHHJHQJJJLMJNMKKLMMKKKQPPZ7%fЦbXFRVOXURZZ_`_c_hjlmpnopolhhllmjdffhgdec```^\`_[][][]`Z\\Z\``a]_]^^^^\\_]aZTKMQSYZa^^^Z]Z\]_]_][\^`\_\Z\\\]^Z]Z]][^[YXY[[YZZSZVSVVX[WWYWWW[YYZXXXXZZZV]\ZZZZXTHCEFUZ\^^^\ZZ][^^ZZZZa]]c\\[]Z^^]]][^^[]ZZZZZ]Z\_]]_]____\``]^^`\\_`_``^[`aa_b_`[``^`YMB<5KSZ]caaccabeebdceffddbd```^a^]^_``aceccaceeiccccaabbgecdbbcceeecac_ccbceeadfcaiceea_`R<[rbceebfhekf_ffw{wuvxtrtrpprrwtsrrrrperqoorrrsuw{АА~АА{ДЗЙЗНЕБzvvxvxwwyy}}}{~||z||ВБГБ|wwy{ywwwttvtyzАЖИХёк“≥±≠∞±Ѓ∞±ѓ±±ѓѓ∞Ѓ∞≤≤∞∞∞ѓ≤≤≤ЃЃѓѓ∞ѓѓ≠≠≠ѓѓ∞∞ЃЃ≠±ЃЃЃ≤≤≤≤ЃЃЃЃЃ≠Ђ£°w^:Ъѕќѕ––—–ќ»≈ЇЗJ;>?<;<;;;9:79,1=;;<<89;;<:99575;<:<;9:8:==;9;97799=:9;9;9898987899;7:<<9:;;7977;9;999;9679;<<<;8<<<<;<>’ґФШШШШЦШЦТУФТЦУУФСФУСХШШШЦ≤З%  ЯСyyxutrtssqqttuwzА}ztrrqmligqn* УФhkedg\YYZYYWRRRSVXYTSSPQRMPTTVXVVZZbltГЗЕБypg`ZZYXVWVSRSQPONPOMMPMR?2ƒ≥cBMHHHJJGHGGDHJJMGCGGHHHJJLMLMUW_lxzoe^WMPMJJHHHGGCDGDHIHKIHHGGDEEHDLd'{ҐPAIIIJIGJJIIHIGJHHHLNPPTT]dmqrpj`[TSPQMMLLMMMMKKNMNKHLJMMLMLNOOMMOMOO_`%РuQQOLNOJLMOOOOLPPTTVY`fnrtkc_XXXCQRRRPPPMMLJJJJLLLJJJOLMJJJNMMLLJMMHONNPOX4"oЮbRMKPMPLLPUPUVXV^dlrrqnmhd`_bhgfohcfffggfdffdfd`aaccceb````bcdcaa``ba`cjb_ZRLMRX\Z^]]]Z]ZZ]a_a_\^^^__\Z\\\\]Z]Z]^]^]][[[[ZZZZZZZZZZ_ZYZYYZ^YZ[YXZXXZZZZZZYUXVNF@CHRVYW[ZZXZZ\`YZXZYZ[][]ZZZZ]ZZZ^^^_[]]]]Z]_Z\b\]_[]___Z\[]]`^ZZZ_\Z\ZZ[]\\_Z\Z\\^`WMB;7BYX[`accbbbbbdfgeecebbd`b`b`]^bbbdbde`b`cbbaaaaa]^Z_da_b`_^acbca_^_ab``cd`a``accaa^_ZQ>ao_a_cbeffkeeiis{wtzzttvrrvpsvsurqrppkrppnprrtstxz||||||yДЖЖДДД{tttvtvuuuy~}}|||~~|АВДЕДВА|||zxvДwtvvtzz|ААИХжл–ґЃѓЃЃЃ∞ѓ≠Ѓѓ≠ѓЃЃЃ∞∞ЃЃЃЃ±∞ЃЃЃЃ≠≠ѓ∞ѓѓ≠∞±∞≤∞±Ѓ±±∞≤∞≤≤∞∞≤∞∞∞Ѓ©†ҐvS5$Юѕќќѕѕ“—ќ»∆ЉЙL=><<<<:69874764996999889;;79;98997799=:;8<<;;97779<:<::;:9=;<99:97897?;7::;8977:99:<89667:9:<<:9::;;<<<G∆уиЃНЧТЧЧХЧЧЩЪШШФ©S J“ЇСЩЬЯЪЪЩШЩЪЩШЦЪШХШШФХЦШЦЦФіs# %Цrxxyuurrsrrrqrtz}Б}|xrqojijhhkx±Ю_geee_ZZYUVQQUTSSVSRRQQURRTRTXYXV\^dnzЗРД|uoe][ZUVRRQOOOOMQMMNOLMMKE"yШ^OKKNLLKJHKMLJJJLJMJJLLLJLMMMPU[crzyncZRPNLHHGCACDDCCCDDCDGCGHCCFDFGIc*РЭV>LIHHGHJGHJIILLLLMLOOSST_fputli`XXVPOMMLMJJIIIKKGJJHLLLJMMNPMMNPNMMLXS(ЩrOUMMJMOMOOMOLRRRSVXZanruxpc^ZXXWRUURQOOOMLPLKLJJJMJJJLLLLKMOMLKLLLOPPPMJK5/f¶nLSMOOQOPPQNSVVX]fiqrqjc\YYTSTROQRPMPRVVVTTQTXWVUVWYZ[_cd_`abnbbjdcgigefge`R?P_cdacceaaaba`_^_``iaaa`b_\``b\Z^[]^\[`]_^YZZ^XYZYY`[YZZ[V[b[Z]XZZZZ]ZZZZZZZ\[ZZQHCCKVZZZ[[XXZZZZaZZZXZYZZYY[ZXXZ[ZZZVXYYZXZZZZXXZZXZZXZZ]]Z\\[\ZZZZ\\ZZ\\_Z`__]]Z]Z][\NC<9@_UZ]^`^_`\^\Z^_^__a`^`db`\^^Z^^`^``\\\b`_abceddaca_aecgcca```_\a```a`^ba__aa_aa__^[ZMAZj[^__Z_a`fceiiwxwtrrrstrrsmrtxvtrssurrrsrsrrtxw{yxzzyАА|БГГББ|xxtsrsvststtzvvvxxxxААВ}}АВВ~А~Аz~vvxxzvz|БuК£дд»∞≥±±±≠≤∞≠ѓѓѓЃЃЃ∞ЃЃЃЃЃђ≠ЃЃЃѓЃђЃђђ≠≠ѓѓѓ∞ѓђЃЃѓ∞≤∞∞∞±∞≤∞ЃЃ∞∞ђ†ђrC,%°—––ѕќ“”ѕ»≈єЕI=:;==<:49::;899999<999::;988;;9776775>99676577599997899:99=8668955757943<;:9;;;:97<=<<<;:<9:<:;:4:<<<;;HHGGEDIGIGGIIKLMMMONOST^hrs{rfcYTRRPOQOLLJJJJKJCOJJMLJJLMMOOMNNKLMMTM!)ІuNUOLJLMKKKMMDPOOQUXZdpruxnc^[XWWUWVSSSPPPMPOOQOMMNMMHJKRLJONLOLMMLLMPPPNR-&fЂaPSMOMOPNNNPTXXY]fkqrqhd^XXTSSUQRRQOMLMPONMMOOLKCOONOMPRPSWW[^[\^^_chbdhdhaP?Miijgihifggddddbbbdhdeebadbbabaac`ac``e`^`^\ZZZ\^ZY[[W[YY[Z[[Z[ZZZZZZ\ZZZZZ\[^ZZTICCLUYZZ[\ZZZZ]\_ZZY[[[\[ZXZZZZ\^]`ZYZ^^\ZZZXXXZXXYZZZZZ]ZZZ\Z[ZXVZZZZZZ\ZZZ\Z]ZZ\]ZZYOC<<9278;8777799;997:9987:;;9::9996;:7997799;<;8;98;::::<9977777777988968;899<:;;<;<99961B;77789:<<;<LHGJIGHGHGHHIJIMMMMMOSR^hqstrg`ZWUQQOQMJJHIJJMJHJHHLLLLMLLMOMOMLMLL]S-ШmZSMLOLLLLJLLLPOOPRXZcmrtrid^ZXWWUSUPQPPMOMOOLPPNMMKMLMMOKKNPMONMLOMOPPOOR'qЃZQVOOMOPNNPQSWYY\fkqvqh`ZVRRSSROXRMONLLMMLMMMMJHJPJJJJJLGKNLORPQUUSWXYZ_Z^]TCUuihhhfhjmrjjiijjkomlkkjckhfggceehghbab`^^`^^Z^^^\\\ZWZZ[^`^^\^ZZ^Z^Z__ZZ_\_Z\[VSE@CKSYXZZ\\ZZXZZ]Z[Z[Z[Z]ZXZZZZ\^Z]ZZ[][^[YZXZZZZX\\Z]]Zb]Z\ZZZZZXZZZ][X_ZXZZXZZZ\ZZZWLC/?FMSZ][[^]b[[ZZ]____^__^_a`^^^_`\Z[^``\\^___Z`[^_`e___^^]]\[``^`\\_^][[a]aa_^[^^^^_^[WD;P]^`_]`acaccejmxxwrrssrrptuurrrrrsspnsrrrrrstvvxwu{{yyyyyyvvvvuuvuuzuuzvvxzxzxzxx|~~АА}|}|}}|~zz|z|zx||АБ|И©гк¬Ђѓ≠ЃЃ≠≠≠ђ≠ђЃЃЃђЃЃЃЃЂЃЃЃ∞∞ѓѓЃѓЃЃђЃѓѓ∞±∞∞±∞∞≠ѓ∞ѓ∞∞±±±∞≤∞Ѓ∞ђ≠Ґn@/*®ѕ––ѕќ–ѕќ»≈єВJ<<<;<::899:97769779979:77:68::9:88996685:;99:9<=;6;998::999::95979<;;;:9=98;:;;==<<>;<<;:;;<786879;;<9;9D?CЅуиіУХЦЩЩЩЫЮЪЬЬЬЩ¶P jвєЬЯЭ°°Я°ЯЬЭЪЪЫЫЬЩЩШШЪШЪЩЩЩЄh *•{wwttttrrprtrruwz{|xxwooomjjjhwx!ЊП\_aa__ZYZVXXXRYRRRZTPNRTNNVTYTVWZ\^covИД}yrh`ZZWUUSRROPPNPPNNNMMKMM<R∞ZJKMMMLMLJKLGHDJJHJOKJJJLQMORRR\erw{pb\VLKKHCIGDHGDDDCFCFIIGFGDGKMHKJg,ФЬIHNLJIJGGDGGHIJJKLLMLORVXairwtqh_ZWUSPMQJHJCFGIKIHJHJJLMMMMMOOLLMLJLL`S/≥kRPNLOOMMMOOOOUTQUXY^dmr}qjc\ZWWWROOLMMMLJLLJHMJKKKIJKJKKKMOPMMMONOOORPMRZ"wѓ_OVOOOQPQSRRQXXY^fmrvrjbXSUPSSRRRMLMOOOMMLLMLMKJJKLJLLLIIHJJJMNPQPMLOMRUVVVUGcБa\Z[Z\_dffeefhlmrytsqnookomlkjlplojbhe`^ab`ab`a^^]ZY[][``\\[\^^^X````_\^^b^]a^V5CFNYkZ\]\_[\^XZZZ^\[\]XZZXZ]Z^]]ZZZZZ\[^ZZ[ZZZZZX\ZZZZX^[^ZZZZZZXZZ[a][a\[\\ZZZX\ZZYUJC8O\Z^\Y^aaaaachjtwsqrrqrprrtstrrssrttsrxvtvtvstzzz{{{{wvvvzyususrrrrsvrrsvvxxxzxzxwz}}АА}|}|}}|zzz~z|xz||}Б|Жђее∆≠≥ѓ∞±ѓ∞ѓ≠ѓЃђЃЃЃЃђЃђђЃ∞ѓѓ≠≠≠ЃЃђЂђЂЃѓѓѓ∞±±∞∞ѓѓ∞∞∞∞∞ѓ±≤±∞∞ЃЂђҐl9).Ђѕѕѕѕѕѕѕќ»≈ґG=<<;<<<<==;:777957789@<:<:78996:89<748658888869;99;67557954::95979<<:9;9;;7;:;;;<;;<;<<:;<:<::999:<8<;;∞zxyyywtrtrtytu{{~А}|wvrpnkhiifjp)«МYccaa\YXVSSRRPPRMPQQPKPRRRPRTSVVXZ_fmzВЙВvpf`_ZXSRPSQSPTRNMOPPRPQNQ5]Ѓ^KLJJLLJHHGIJIDGJJJHHLLJJLLDSVY^iquzof^XVQNLJGEGGFDDCCFBFFFDFFCFFFEFJv'ЦМJ@CHGGLIJHGGCJLJJHDLOORY[ejsvskf^XUURQRQLLMMMLLMLLJJLMOVLMLMOMMMOOOOO_F/ЃmPLKIMMLLLMMMMORRVXZ[alsvslbZWUUSKMNOQPPPOMOMMMMOQMLMMJLHMOMQQGLNOMMPRQMPN% q†`PMLOUOMOMRQRUZZbipvyrhaZUTQPTRRWRQQQPOPOPPOONMLLLJMMMPLLJKMKMOMPNPPPLMMNPWP>uЛ]QMLLONNROUYXVYckmok`^ZZ[Z]^a_accjfhojhpgiuorkihicdeobbkgbbadfda\abZb`bbb`b_`ZQ>==:8<99<<:?<97676578<9;;7977978979989769779977778;<<<897898;:<<<<;;;<<7;;7:9599>754788;@;;8;;;<:9<:9;:>F;B удЇМУЬЬЬЫЮЬЮЮЭЭ££Hr№ґ§£••§¶¶¶¶£Я°°ЯЯ°ЯЯ††Я†ЯЬ©¬PSЃuuuuttrrrrqruwz{~}|zwsrnnkkkhsr5ЌП[dca_\YYVTUSRRRSRPUQPRRTRRRUUVXWYZfeqyБВzri`YXWURPORRMMKOMJPPPPNKJM0]Њ]JMMIMPPNNLHGHGIJJMMLLKMOOPRPRV]hrurk`ZTOLIGHGGDGDBFCCMBCFBADDFFFEGGHuЪЦLLHHHIJGDJGHFJLJLLMLMOR[Zeowzspf^WUURRLLJMKLMJMLJLJHJHGDKLJMOJLMLMMPOaD2ƒmLUPMLPOOONRQQRRRXYZ]dot|rlh^ZXURQPRTT[RRPOMLJLMMOMMJJJHHJKMLMMJJMOOMMPOTM!!Д†\NQPOQOSSPVWWYX\dls|vmeaLXTTPSOPMOOPOOMMKJMKJMLHMMLKMJKHDNNIIHJMNPNQPPOOPRTA7uХ[PSPRQQQQRRW^_ehruuoe]YXVXVTPPPPOSSUSSQRQJRRPTL?ЎугљКШЪЬЪЫЬЮЭЭЬЪҐ•@x№ґ§¶£¶§®©¶••°ҐҐЯЯЭЭЭЯЭЯЭЭЬЃґJ N∞zwurrrrortuzxz}}А~~|vvssrnkoidnr;ЋПX_a`]YYZVVTTPRPRSRPTRRPTTTTVYXZZZ_cgq~ЗВzria\YXVTRNUPNMKNNMPPPNNJJV/gЄ]JJJDHKKJKHHKJHHJGKJJJMJOOOOTTV]hs~ym`ZXRMLKMLJJHGCDFINFFGDCCCCCCEHHHi УШLGFGGGJJIIGGEJJCLLMLOQQUZfowxvpg^XUWQQQMOKKMOJLOLKLMLKJJOMLJKMLLLLLNL[C5ЉkJROLKMMKNNPOQUUUWXZ_gpuwskg_[XWWSQVV[`TSPMMJJLLJMLLJLJHLLKNLLMJLMOLLLOMTO #ЗЭVKTQPSPSPSUVTVZ_jovvtkga[XYVVVTUPSPPSOQPLMNKMMJJMOMOLHMFGIGGKJJJNMPPQPOONOR90tЦWPSPRQQQQTUWY_ejtuurj]YXYYVTQTTQRQPSSSQUURUROOMKMORQPONMMLMPRTVXVXZ\^]__eeeec]Q(*Dirlllmojljkiglnllfge^hfffddddcdacbaaa^_\^ZZ`ZXZZ[]]]Z\ZXZ]ZZZZ]][^^[\[]Z]^\\Z\[^]Y_D3;4;;=97D:889?:;9:999;;7:89;8778<995::99399:9997898777;<:;;<<><<<@—фзЉМЪЮЬЮЯЯҐЯЯЮЭЭҐ<бЇ°§£¶•ІІ¶•¶•Ґ†ЭЫЧЧЧЦСТРМКЧМ8G7D†roomorroruwzz|~~ВА~|wwtrppnrmjvpF“ЧMac`^YXYXXXVRPORSRRQRRPNPRTUXXZ[[```o~МБyrfa_XXTTXQSPQQNPNLPNPMLNOZ2 p•]BOOFJJIGHHJJKKHJHGHHHLHJLOPTRWZhr~xjb]WROLJJLKKJJDGFFIGIHGHHFDFGGHHES0ЫФFDHIIJJJJJIJLJIILJKLORRV[doyxrpfZXUPPQPOOJJLLJLLMLJLHJJKOMMLMMLLMOMNMhA:ЇpMPJMMLMPNMMPOQQRUXZYepsxsjb^WUUUQQQRXRRORMMLHJJKLLLLOMJMOPQMMOOQUOLONMMTT!!ЕЦWGPPNPPPPOSTRVZaimtvrjf]VPQPRRVSPOOOSPNNMLMMKNMLMMLMLKTKIKKJMMPMNQPSNNNOPMT2-t}XUQSPRORUUWWR\ajrwtrgZXVYYVUVUTQQQSUWUUUURUUPRQPPQQQRPNQQOOMNOPPTTURPWUWVPZ[ZRI!'B]^cefhlhjkkyqr~urkmqanokkkjjjikcjhff_gd_db`f^\b\_b``[Z`ZZ[[_[\^Z[\\\^\\[[\Z[Z[Z[ZZXA,5=:99955545746733457879855=9;86299:9;;;79779787979:79::99;<<:<<9<;88;;974;<89999;::86797;69;::<9;:<<<<:@?AƒуиЄМЩЬЫЭЯЯ†††ЮЮЫІ@$АдЈ®•¶¶¶©ђ¶¶§•Ь£ПМТИИxГwsuRR5T÷j<З``afinqqtuy{wyВВ~zwtrppnonksfPџМVghec^]]ZZ[YZUTTYWVSVVVURUZWXXYY]]dhs|ВБzpfe_SXTUTTRQQQRRRPNMOOOPOT=*|≤XHKOHKMKJKKLIKJJJHHILGKJKOPRTRW[hs|tne]VOPKJJHHFFDDDCCGFGJGHJHGDGKKJJf%©ЩJELJILJLIGGIJ>GKOLMLOUUXWdqywrmbZWVSOOOKLJHJLHJLLJIHHJJMJLMLMLKLMOMMOb>CЄrMOLMOOQQMKMPRRPOUX[`gqu|rhb^VSQRQQONPONMOMMJHJJHJJJKLMLMOOQOOQQSROMOOOPYP! ПУYQQPPQSPOOPTTZZagltyrja[VPPOOOQRNNMMMMNPLLKNIKKJLGHJJKMLLLMMJKNNONPPNNPPROQ/0|ДZTWSSZSPRRUXXZ_kr|xrg^YVYXXZWWTQPSSUSRRRPPUOPSSNPQPPOPPRSRPOOPPTUTUUYYVZWWZZXZH,O^WZ]_b`_bcekouyuuronjlpllljkoqukopmkhmhaffeda`a``baa\^d``^`c]aa__``\`^`\\Z[][[Z[[[VC16<9788879559679-666899977696865586769;;555566599577339967;;<<<<:<::;:86748<78<;;=:<<:9;;>;<;:9;8:::::;=B@?≈пе≤МЪЫЩЩЫЮЮЮЭЭЬШ¶?ЗўЃ¶£•••••Ґ•ҐЭШjXK]kwxАws~ED1}№Ў %ЕZ[_ckoqot}{yyw}АВВА}{wtrqrpnonrZSўЛcjjhc_]`[\][]ZZXZZZYYYZ\YZ[YZZZ]acfmxБЖЕ|smg_YZXUUURRQQUSSVSPQMMNLM8%ВШ]MMLHLMKHIMLKKLLKGLLJJMNJRRRTTZ_hwГymb[WSPJJLJGFFAHHDDGHFHGFIHFGGJJGKY%®ЧCFKHGLJGHGILJGIMMLMOMRUYZjsz}tof^ZVSPQPMNLJJLJHJJJJJHLJJJKMOMJJJOMMKIh5IЄrMOPMPOQOLLOPQQSRUW\biryzske^WVUUQRQOQOMOQOOLLLHHJJJJJLLLLMMMMPQOPOLMMMWWKЧЩWNRQROPPOOOQTZZaipu{tne]WVSSOPPQQNMOMMPPNMMKKJJJHGHJKHLMIJLLHJKPQJNPMNOOPQX(/}x[WUSSUUUXWW[Z^hqyzvrj_ZZYXYZ[VUSWWVSUSOSOPPQPQPQQOMMMPNPPQROOOPQTQTUVXVYXYZXWWJ,\cX\^_`^^^^ahqvyyuql`ccfccffggeggjmljqwmjkimiljihgeebb`baa`bcbccbaaa]```^`^^``]\_^bUI89>MWT^dZZZZTXZZZZZYYZZZXZ[\ZZXZYZZXXVTXcYYYYZYXYYYYYYWZWVZZYYYWYYXXVQXZZZ\SVXSS[ZXXUZXO:1TTSTVWXUVYYY^_lzzrrtrrqonorpqpqprsruuruv|{{~БЕГДГ~xtrppkprooqrprrpprwpptxywxxwut{~|{zz|{y|zyyyyxyywy}}}|З»ё“≥≠≤∞≤∞ѓЃ≠≠≠ђ≠≠ђђѓЃЃЃ∞ЃЃ≠ђђђ®ђѓ≠ѓѓѓ∞ѓѓѓ≠ѓѓѓѓ≠ђЃЃ≠∞ЃЃ±±ѓ±ЃЂ¶•Йf* n∆ќѕѕѕѕѕ–ѕЌ≈ЈВB5<:9584799559799699998998;8998;976989;9:875656<975775797798998;9:::;<:75767;6999<<9;<<799;<<:9999<<<:<9@G8FЌсж≠ИЩЫЫЩЫЫЫЫЬЭЭЬ©9НЏ•†£ҐҐ££°ЯЮ†ТW*DlqКДЛРХИxЗ№Щ9!Kc__bhlkuvw~xxyx}}АВААЕzxwtrrrsq~TJ„Хfemkeebc`^a`]^\\]\ZZZ[^_\\ZYZ[_aehjl|ДИЕАunia^^ZZZWWURVUUVWURRRPPNP9!Ф≥XJFOKIJIHIKLKKILG9EOUZ\`^`__\_[[^\ZZZZ]a[[[^[[YYZZXXXVXZ_[[ZWZXVXWUWWWWYYXZZZZWWZYYWVTVZXXXVTVRTYUXXUZXQ59UTQTWXZXXZZZ[^jwrrrrrpprkppoojmimpppssuuzzz{БГГББ~xtrrpqptnqrrorrrqqwprttwwx{{|~|А~~{z{|xzwvy{wwuuuwyw{{zГВѕ№„Ѓ≥ѓѓЃЃЃЃ∞≠Ђђѓ≠ђЃЃЃЃЃ≤ЃѓЃЃѓѓђ≠∞≠ѓЃ∞±ѓ∞∞ѓ∞∞±ѓѓЃЃЃЃ∞ЃЃ∞∞±ѓђђ®®Еa& |«ќѕѕ–ѕ–’”–∆ґ@5979795697889;:9447797999986988957;99:8788589;<779::9::::99;87:88>:799727548845899;69;197579999:99:;>>:?C9K”ож©КЬЮЮЬЮЭЫЬЭ†ЮҐђ<ЫќҐ°££Ґ££ЯЭЫЪ`)"QosГГКУЦЧЭШШЮЩЕutxvtwuuwy|{zzzzy~{}А~yuuusrrqИS=еЫkwtwojjjgefddda^`b__\^^_``_[]^bahjln|ЕЙЕГsoic__\ZZWWWWWUXZZYWUVUSOZ0"Ы≥YGRPLLLKKNLNLLMLHGDFGKKLKNLKPRV_iuvtk^XSMLLHJHGGHIKJIIMOUJHGIJLJJJKHKN"(¶РJKHHIOHDGHOKGJKOMNLLQRSY_botwrk`[XRQMOLMKLLMJHJJPJJIJHKIMMMLJLMOMLOOMa4V±fWSMMOOMMLONPOPRRWWY^eqtuwmb]WVPOPPOSPMMOPMMGLLMJMOLJLMNMLMOMLOMPOOLLMORR?ЫЭQSPNPQQQPPPTRXZ\iq}vri^ZUWVRQQTQRSQMPOOLMPNNOMLLLLMLMOMJHJKLOQMNPQPNNOPONVM7~xZTSRSSOUSSSSUY^krysne^ZXXVTVTVUMUPMTSSSTSSSVTTQQPSPOPPOSPSSOPSSRTSTUTQUVXWXW[P9/ZhZZZZ]Z^_^`cnt|ztsjcb`___^^^ZZZ]]^][^_Y_^__`__b^]baceecegffokjrjjtjjjkkmnlkkl`eheZVG<8DQZ_bcbbb```^^^]Z]ZZ]]^__`\]ZZ]ZZZZY__[ZZZZ[YZZXVWWWYWZXXVWYSUUWYYVSVSVSVTWZVVZWUUUWZP>98@D9Lѕнг§ИЩЪЬЬЩЫЬЬЭЭЪЪ§B%З∆††£££°°ЬЪЯБ57]rxАЖИТФЦЬШЩЧЩФПК|tvyx}}~~~{|zy~y{||||zyuuutssrВZUкЯqzvtropqmkkjkjhgfgffafdegij_bacdjkps~ЖЙГАuohdd_\ZZYYYYYZZZZYUSYVVP[,"£≠`KTPOOPNPPNPNPMMMJHKKKKNLNNMPSX_iyИwl_XOMHHGGGJIGDHGFHHJGBDCDHIGHJHGIR %®ВNNIHGMJHHJMKMKMPNNPOOQWZafp{yqg^[VSTONLMLJHMJJLLMHJJGJKIMMKMLLMMMLLLPf2Z≤oMSMMMMMOQSQSUUPQWWZbiqwv{i\]VVVSMSMOSMLOLILGKJMLMLLJJKPLJLOOLONMOOLLMOOOCШЭQQNPOQSSRRTUVZ^clz|wrh]_ZWTPSQSTQSSMMKLJKMKMOOKKKJLLJMMDDLLLMPJPPPQPQRSOOXI7МuZVSSUUUYTVVWX[bmvysle_YVVVVVQUROSOMPRRSPQSQTPQPMPPMMONOPNPPPQSVRVVWUYXWWWVZZST6#4bmZ\^\^^_^Z_gnr||xrhecbaa_^^_^^]]]^^^[ZZ^^ZZ_]\\\Y\Z[]^]]_^]cc`gccpfhijowrypwzk|rl}ZK53K]cnhcaZ]^[YXacb_c``\aa^\`\\ZZ]\Z\[[__ZYYZX[ZXZZZZYWZYZZ\XYZWWUXYXXVVVVVXWUZXWXSSTSUVO=7USUWUTXZWYYWU^jwuqqrrrrrnrpoppnnoooooprrsyАЖБ~{yxtrqqrprppqrqrqopoomrrpsxy|z|}|}БА|~~{xvtvxxy{{{|yy}|}Ж{ќв’ѓіѓЃѓ∞∞ЃЃЃЃЃЃЃЃѓѓѓђѓѓђЃЃЃЃѓЃЃѓЃ∞ѓЃѓ≠≠ѓѓѓ≠≠ЃЃЃЃ∞≤≤≤Ѓ∞≤≤±ѓђђ≥Z'! Й»ќ––ѕќ–—–ѕ«ЈГD<;<;;:979689888866689:78978:8796454;6665655777897<79999:997797797:7998579999989<59969<::::7;99;;9979;;6?D:NЌмв†ИУЦЦЩЩЩЦЧЩШХТ°Gs≤ШЮ°ЬЬЮЫЧСЬh $Hso|ЕЖЖСЧЩЮЬЪЧЫХТРzzxt{ЕГВДЕК~|xxutpvxxtx|xuvprrДZ]оШovvrropqmormmmlijjiighheghgfhhiknort}ГЗЕ~yrmmnc`b]_[]]\][\ZZYYYTXRZ*©ђ`KVSRPUPSSSPOQOMOOPNNMNPLNNNRVYaozИyqeZRLKHJHJKGHHNHFHFHIGECCEGGGDHHSV#%ҐЙAEKAHSLJLHGKLJJKNNPOMUYZait{vqfb\XVTTRPMOJJQMKJLJKIKIIKJMNJMMPMMMKJLM\0\±iCONMMLMOPOQOSPPSUUZbkvxГvg`ZWWWVOPPQRRQOLLLLLJMKRJJLLIMILLLMMOMJLNNMMONRC!ХЗQIMPQQSSRPTPRW_dmv}}ska_[ZVRTWVTUPSQMMMLMNMNMNKKLKMKKMMJGLLLMLJNNNPPORROOgF&7ЛuQTJQUURWWWYZZ`hpxuurjaYYVVXTSVUPWPRRRUSPQSPQNPNMKKJLLMMONNNNNPPPSVVVUWVVVUVZTP5!0aeZ_\Z^_`b^cjrwБЕ|rlhgec__c_af`_^[]]]]]^_ZZ[^^^]ZZ[[WWZW[[ZZZYZYZ[^`cbcdcdfgmkeqmp|eM54Jhv|swvy|vyxkppnikig^egedeZ^^\`\]\[[]^[VVZZ[XZZZYYXZZYZXXXX[[YYVTZZZXZXXZYUYYYZYVXXTSN>>VTWWXTYYUUXUXUkwrrnqpprootkimnrnommmpoortt|}БВ{tsrttrrpssrpppppnppooqorvwy{}||}БА~{{|zywuuuu{y|Аzy}}}}ЗБќё–ѓ≤≠ЃЃЃ∞≠≠Ѓ∞ђѓѓѓ±ѓЃђѓѓЃ∞∞±±ѓЃѓ≥ѓ∞∞ѓѓ∞ѓ∞ѓ∞ѓ≠ЃЃЃЃ∞Ѓ≤≤ЂЃЃ∞ЃЃ©ЯђyY/ М ѕѕѕѕѕѕѕќЋ≈µАA<><99879>88<868686657979:::97999898<8888957957;97756879:97369797978553577899866=89979;99;99;89;<<;;;<<8@H?RЌнгЫЗТФФЦШЧЦЪЩЩЩХҐGV∆ЧШЫЩХЦФНУ†8+QuАММПҐЧЧЪЩШХЦФТЗ}ВsЕИЕЖЙЛЖГ}suurhtsvxzН}u|vtwИVlрХtuurrrprpqpomkjmmljjihjhhhgihhlkqqrs{ГЕЕ~zuokhgcddbbdbbbba_a__\Z]Tc/'≠ЇZU[XUTXUXVRMRRRRRRTPRPRRQPPRSXYeoy|vqe\RNLLMHJJHJINKHIEHIKJGGHGGGGJJPP%*І}LDLMJLIIKDDGGHJOOOOOOVY\aiswurkbXYWVTPPNMLLMMLKLMMNMKKMLLOMOPUNNOLMMPZ/_ђdOOMMOMOOMLOOSPPSUXZ`mvtyphb[VVUUMRPOOPPOOQMLLKNJQMJMNMNNOMMPQQLLOLOOLLKT@%ЪЛNKIPQQSSQPRNPV^alsДtie[YYURTVTMSUSQPOOOPPNNMGKMMJKKKKMGGMMMOOPOOMMOMQROM[I?ВkXMMQPSRVVVVVW]hn~xtpl_ZZXVWTSVWSSSRURWRRPSQSTSQNMMKMLRNPPNNNNPQQSVVSQRSUUUUWSO44]fY\YZ^^^``blry}Аurnigcc_ca__fab]`b``^c`cca`cb`_][eZZZWWZ[ZUZWVWWYZ\\ZZ[^]Z_c`_a]f`[K75L]rmrtu{{zzzztusrwrssooolljfdlfddaZ_aa_][YZY[\ZZZZZXRZZZZZXZXXXV`XXZZ[XWUSWWXZYXZZWTMAJXWYZZYZXUXXX\\kwrnnrprpopmkjlnlmjhlniopsvwz~}xwursusrrprrrrrrorpopooorvwy{}А}z||ААА||~~|{wvssyy{zywzzz}{ЗИѕ÷«і≤≠∞∞Ѓѓѓ≠≠ѓ®ѓѓ±ЃЃЃђѓѓЃ±∞±∞≤ѓЃ±Ѓѓѓѓѓѓѓ∞∞∞±∞≤≤∞∞≤∞≤≤Ѓ∞Ѓ∞∞ЃЂ•ѓxU, РЌќЌЌќЌѕ–ѕќ∆і~<9><:78667779756656477545779668888876=998899957;;;9;8999:9:66:9:778977767888664146688886575796769;9;;9:;@J9KќкаФГМУСФЦЦЦЩЧЧЧЦЮJk∆УМНУММЖЗРК<)4XovЗЛСЧХФХХХФУУТНИЖИСММЛЙЛМЛНЙБxyДwtrntzАВ~||}~РRrсУ{yqsrssssrrrqrsqspllkijhhgiiiikjmqqrw~БАyvrmfhhcbdddfddb^c`cc_^_`\o(±ƒWWa^[[[YYYYYZXUWVVVUVSVTVUVVY[Xfovyvmd_XRQPNIMLLIHLKLIHIGIKIHHGHJHJHWU+©|OCJOJJGGPGDHHHLMLLOQMRVZ_hswumib\XVSPPPOLLJJJJHJLNMKKMJMMJMONPNNJPMOS_2h©fXROOOMPPMLOOOPPSUWZantvyph_YSSRPNRPOPMOPOQQLKLOMPKJNMKKKKMLPPPOOOMQPOONRF!Э~SQPQQSSSQPQSSWZcluД|sib[VVSSSPSLOUSPNMMONLMLMIKMJCJJJJMJJMOMPPPOQMMQOOQPR[@'IЙsZQQQSRSVSWZVW_iqxxsmh^[XWVVVSVPSPSRRRWUUOQPPUSSPMLKMLQPSPPPNNQSSSSSVSSVWWWUUQV4<]hZZZ[[Z^^_`irx~tqlhfc_cfd_^]]``]`]\bca``_cc`]`^^e[ZZZ[]^Z]][Z[Z[^^\^Z[ZZ\^^^\\ZZYSC78NZbdhlnrssrnqnlllhoorrnmppsomjoplmkkmklkleeb`bfcbd``[Z[][[Z\\ZZ[XZVVZRYYVUVXYZXXYZZY]J5ISSXZYZYWUUXX\^p|wqqnssrsrqnpnpqqomjmmmpruvyy|~{usrrqqqqqonopppnommooorpptuwyy}y|zz|А~{|~~|ywwssw{xwts}}zВЙК–ё∆≤≥∞ЃѓЂ∞≠≠ѓѓ±∞∞∞ѓѓ∞Ѓ∞∞≠ѓ∞∞∞ѓѓѓЃђЃѓѓЃ≠ѓѓ∞∞≤∞≤≤≤∞≤∞∞∞ЃЃЃ∞∞ѓђІ≤xR/ФќќќќѕѕќѕЋ √іy>:<<<98667997787539575345775564899775=88868881359::::9877797766979:;999;<;88999899;==<;67857987939999:::BD6K—и’ПАППМРУУФЦЦЦСУТD ІЇРДrnpsuyzsO>@DM]kryВЕЙТЛНШЛЛНЛНЛЛИЗКТНМЛЙКМСПЙД}{Б{ywft|В~|}Г}ГЕНNmлПБxprrtrrssvwyyxswrmmkihgfggegfihkkoqruyywroi`gebbfbddddb\b```^^_^cm*#Љ«WY]][Z\^\\`^]\ZZZYYYZYYX^\\_edfnryДxof_ZXVRQRPNNMIKKJJLKIKLKIHHIJJJJQT(µzOEKJHKIIKHHGGHMLJLOOQRV\_hs}sogb_ZXSQPMONOKOHJJHJKKIKKLLMLLONMMNGNOOUi+!k°dXOMOPLPPOOPMPOPSVZ[envxxrj`ZXVVQQSQOOMPPQOORIMMJMJLMMKKKJLJMJMOOMGMOOOOTH'ҐВPPQQNQQPPQYWXZZeowАsja[YYVUUSSPPSPMPMNPLLJLJJHJGBIJIJMMMPPOOPOOMMMQOOPKRW?'@ЛrSXTQVSVVVVZZ[`is|{mf^]ZWSVVQTSPPPUWUUWSTQQPONNPMNNKJQQQGMNPNNLPSQSVVVTZWZWVTX7!@bd[\]]]^cde`gryБ~trmbc`_aaa_^]\]]\]\Z^^]_``eg``bZ[^\[YZZ]][]\\\ZZ\]_^_c_a_^a_ca`^]ZQ<3@Q^bchhlqsroif^ac`[]^a^`bafefgagggnhjlknkqjjlkglkjjfegaa^^_a_aaaa\^ZZ^ZZ\Z\]\[ZZZY[YSXF&T\WYZZ\ZZb]]`\qvrmnnnrmnmnmqppnqmnollnprvvzv{zwuurrsrssrssrqopqppoppprsrsuuuwyy~{{|zzzy{yupssswsrtssvw{{{СЙ∆дЋЂђ≠≠Ѓѓѓ±ѓѓѓ±±ѓѓѓѓѓ∞∞ѓ≠ѓѓѓѓѓ±±±ѓѓ∞∞ЃЃЃЃ∞≤≤≤∞≤∞∞∞∞∞ЃЃ∞Ѓђ∞ЃЂ•ЃrE$Шѕѕѕѕѕќ»ќќ ¬≤w=5;;888;89/77797668636645757699::79:9799:9;=<85868899789:7789665645424;668868875758988;8987;91997::;99:9?A:XћгЋЖЕИЖКЛПНПССПЧЛД-@≠ИЙcjmf^S>ZEO;R]`cccdgdcb_Xhsurrrspnnpqppnrmmnnpoontsouwwxzvxyurqrqpknlljjojlmmommkmpqqrrtuuuw{}}}zwzzxwwurrsuusrpswyz}}ЙХѕз«Ђ≤Ѓ≠ђЃ≠≠ѓЃЃЃЃѓЃЂЂЂЃ±≠ђѓѓЃ≠ђ≠≠ѓ∞ѓЃЃђЃЃЃѓЃ∞Ѓ∞∞Ѓ∞Ѓѓ±±Ѓ∞≤∞∞Ѓ≤ЂІrA$Эќќќѕ–ѕ ЋЋЋƒ≥u=5<:<;;9=;:8889;9986645597576689646646446644786979B67>7715745525894355269999;<885:898876<;;>77:8667778::@B9Jўлћ|vБ|}ВБВГ~{z=!JЮИЕЖЖЗКЛЕК~R7L[crЖ}ЖГЕГА~}zurrrmb`hYYacaYaV[\W`^\b^`dckfipnommonhpJ]ЋtprprlltzБИЙЛД|tlhdceefdccaaa]^^_cc_]__acd``ccca`cc`bb`_^^__bbcadc[e3!а∆SZba`ffdbbc^[Z]^^_^\Z]]^^cZ_dehoryy|uqfcj_]YZZYYWWWWWZYUXUWVXTTTVXRYkO>ј}MSSPNMPQORPPMOVVRQUUVX[]dmvВtrkb[ZWWQRROMSMMLJJJHJLLMKJKMNLLLKNLNPPPXe)sµ]PNOOOOQQQRUUQRUUZX]dlw~uke`][XWSURPPOQQOLMLLLLLJLLHJLLOONQOJKNMNNMKPNMMO7<ШqYMPOMOOPOUVVXZZfr|Д~rg^ZWVVTTRQOPSUOPRPPONMMMKIKKKHJJLLJJMLKMMMPNRQQUSQQTS?3OЖfZWVYWSVPUUVZ]eowБ}{thc_\\\ZSVWWTRSUWRUUQSVSPPSPPOPOPPNYQNQPMOPNQSRUUVWSSWVWVW['!Fc\\ZZZZZ]bbgqw~ДАyrnccbb`]\]]aZ]ZZ[[[]^^a_\]^\ZZZZ[ZZZ[Z^\\aZR[[ZZ_`^`]`_bbd`bcb`c_PB/Cahdelmsz~ysnfa___\\[]ZZYZZZZ^Z\Z]ZZYWZ\ZXXXWVVWWUSVUURPPRQSYYYWXWRUYYZ\]_Zbcagirpllre<CXknnppnnjkjh_lrvsrrpppolnqnkmmmnnpprrsrrsuuwutvwwssssuqpmllmjnpoopnnpplnqqrsrrrsswyyxtsurrrrrprtvssuusuyztЛЭ’џЅ®≤Ѓ∞ѓЃЃЃЃ∞∞∞Ѓ∞ѓђЃђѓЈ≠ЃѓѓѓЃ≠≠ѓѓ∞∞≤ђђѓђЃЃђѓѓѓ≠ђѓѓѓ±ѓЃЃЃЃЃЃЂ£ҐqB'!†ѕќќќѕќЋќЋЋ≈≥r<8<:9::9::;8898;:;987599::78888977996=6777677799679:;766455554456755552464379889988:686898;9::9;::;79:<cddhkqwzАzuqibb`_^^^\]ZZZZ]^]Z\Z]ZYZYZZZZXXYVVWYWUSQSSPNPOPVWVUTSRSVUVYZZZ\Z\`ageecc^< G`t|zИЕ|trsllrqwztqrnpqoojnmmjjnmmnrnpprsrvtttttusrusrrqpmnooppooppnnpprqrrrsvsrtwwyyxvtusrtrtpnrrssrppprv{Ж£’аґ£Ѓ∞ѓђђЃЃђЃЃЃЃЃЃЃѓ≠≠ѓ∞ѓ±±≤±ѓ∞±∞±іµѓЃ∞ђЃ∞Ѓ∞±±±∞≤ѓѓ±ѓЃЃЃЃЃЃ®•ЭqB#%Яѕќќќќќ Ћ»∆≈≥sA;<75759:7:889588763447997548:8877796777977997796799:955775;75566755552254676:;77558898899939:8899:789;;AE1HвдЊlzvtvzzxtvs{ty8!ZЫБy||{}}АD2iБЗЖЛКПРПТССТСРЗИИЖЖЖЕИНЕН||}}wyxvpojcjl_]\UXTTe`?o»ПundemmqsvzА|{uqolhdeefgeehcadcaa``_b__^_^_`^__bdb____]Z^\__^a^]_^^h,!д≤OZhopvzxplhgdc^]`_a_a^_Z^[]]a`achlxonjea``_\__\\YZZYZZ^Y\Z\Z[][]]`\VgKBёГXUXZXY_YYXXXZXZWXXZZ]Z]`flsywskd]ZXVTTPRQNNQOOHMMPPNLNNRPPMOQRQQOOOORm$%И≥ZMRQQMMXQQRRPQUVXVX[aluwrmd`XVVSUSQQQNMUMOOMPPNMMKOMPOMOMLQMOOOPPQRQPPQNV7<ЫhUWPPONPTQRQQVXZiry|xld\XVTQPPRQOQSQOOPPPMOOMPKKMKMLJKJKMMMMMQNRRPOOQROOOPP>'VДbWSOSSSVUSSWX^fn{|xqf]\YXYVVSSSSVUUUVUTUQSSSSPTPSRQQPNPQSSROMNQQVSVSPQQRSVWVWY"?gdZ[Z^[^aaahnu|~{wojb`_a\\``]_]a`]`^\]^ae_]b`_a_^Z^ZZ[[[[ZZd]V[ZaZZ^]b^]^^``]`]\\[]M>.5accgkru~{yqmjed^a___^^^`^]^^^\^]]ZZZZ\Z]ZYVYYWZYWVTRSQPOPOPTUUTSOSSRVYXWXZZYZZ]caaa`Y>'IjД}Еxsophkmr{{xutrqrqoommmnnoopppnnrprnrsrssrrrorpllkomoopoomloonpqprprrrstsrttuwvytvvwsuttpqrrrtrqrsswyБ©’Ёі£≠∞ђђЂЃЃЂЂ®ЂђЂђЃ≠ѓ≠ђЃѓѓѓ∞ѓѓ∞∞±±∞±∞≠ЃЃђЃЃ∞±±≤≤±±ѓ±ѓЃЃ∞∞ЃЃЃ®ШqD!/§ћЌЌЌќќ ЋЋ «≤sE>=:9997779989377552147554324;9754676466666654663997996579579775899777759796988757899989;898:986669779;7>A/M№нєu_rrrrsttssqnlp>hЙrrvrqrtsssc',IЕ|БЛЕЛНПШССТТНРННПМЛИНПЛПИИММИМЙЖЖЛИДЦССХМАДГЛi?|ЧЦrrNdb[f[hmaeickmlhdnniilioiehehhegceea`b`bb`a___b]__aaY^^^^_``_]^`])(д≤KVmsxБГxpjdcca]]a^`_`b`_`^__ca_abdkkikcdc_^__]ZZZZ\ZYXYXZZZ\[[[ZZ_ZVaMBзВM_]]^[^ZZ\Z[]Z[ZZZ\\````fqu|Вwog_^YXXVSRRRPRQOMMNQPNPPNPOOMMNOOQOOPPOp#ПҐ]RVQQOORQPRPRRQRVXZ]emw|unf`YXVSTRPOPNLOMOOPONLMPRROOLMOOOOMOOOPPSVRPQQLP<<†gRSRPQQPQPVSWZZ]kt~{tleb[XTSPSUTQPOOMLMMLLLLJKJJMHHPLILKLJKLMPOROQQQQQQPQUU7%YБ_WTPSVVYVSXY^_ik}}{wof_ZYYXVVSTQQQSSPRUQQQRQROPXSOOPPNPNOSQOPORPQQSSVWUUSTVYVZZ ;]ZZ[]]]cacgny}}ysld^`]^]_bb^^\_`__\\_]]a]\b_^__^Z^ZZZZ]ZZ^_][][^ZZ]^```^bbb`b`^`\ZOB'MsУВЗБwrllfhjoxЕvrrpmnpqolmmqooomppsnrrststtsssssssromjlmmiommlmoonnpqqoporprrrrpqsrsrpptrsrspprroqrsuvuzoВ∞”÷ґ®∞ЃЃЃЃЃ∞∞ЃђЃђђЂѓ≠ђЃЃ≠ѓѓЃђѓѓѓ∞∞ѓ≠≠≠ђђђђЃЃ≠∞∞∞∞∞∞∞∞∞ЃЃЃ≤∞ЃЃҐЩoD5ЂЌЌѕѕѕѕ» » «≥uF=?<;9:6689766457777595557667A7763666754543433431686486558:57757878787869;97967666897888989;998897979;;;EA/MЏпљghlnojnnlmnhfadB&eЕledfiilbfbkH4"!=Mqw{zДКЙМЙСТПЙЛЙПЦСИЛЛМНППНЦПЛТНЙДИИЕЙНИПСПМСРУМ8QЦxzwvxxvwvurrpmkpombejlhhghheccgfiklkiojhnjjgehbmfdhfbehcb``bca__^cZ%)џѓMVr|БЛ}unha]][[^__^]^a_^^^^aaa_```bcfjdgddbha^^]`^^^]_ZZ\ZZZYZXXVXYTgHGмЙLbZZ][ZZ[\Z_]ZZ[Y[_[^]`fkquz|yoiac`[[YXZYYVURURQPRPPXSRRPRPPPOOPPRPROg$Ш£ZOTSSONMOPRPRPPRRVZ_emuwwqjb_[[WTSQQRRPQQQQRPNNNURRONNLRPQPMOPPPPQUOMPPLO:AЬbJKRPOPPPU[VWZ^\kuБwleb]WWSSUTPSRPPPOPPMPPKLLLJKJJJKIIILIKMMPPOOOQROMOOPVW*%YТ\XJOSSVVVUXZZ_ipyБ~woh`]ZYWWSVUSQVTUSUURQQWQPPPTSONMNNMMNPOKMMONPQQSTVRTSSSTTTP+>ia]]]]_]`bbity|Аzslgbb^^^`^_^`]^^a__^^^]`]]_\\^Z^^^YZZYYY\\[\Z][]ZZZ^_```bbb]aa_b][MGІќЌѕѕѕѕ Ћ  ≈ѓrD;=<989999;85/79044559555999797665459;978438886689;467565567774755577588;968869868867878989;9799;::9;;<E:LЎм≥\cgkjihhhfcca[hGCp\Z]^\\\ZZWVTNJEJCHHCICIHE<,"/BOW\^]dttzzzБЖНРЛНЗЗКПЛДЙЙИМКИНН;N≤УЗЙЛЛЗЗЗЗЛМПСЭРПНМЛЙЗЗДВБ}~{{yw}xrrriqngjejjgjfeeehhffdfhhhcgfigfja+°ТdkzЕКЛztkea^_a____a_^d^^^\[\[[[Z\][]]`a]^_a__^\__`bebbbccc`d`^^^]^^]^B[кУ[nhgb`^^\ZZ][Z\][[[[```cflwwusohaa_^ZYXYYZZZYXXZYZXYZYZYYYZ\ZXXXXXXXY`!•ђ`YUTVXXXVRVTRVVVZZZ`eluwslh^XXVTTTSSRPQPMOOMMKLLONLMNNLNMNPPQTQPPTQOOQSUX4OЩc[W]UURRRWYWXZ[\ju}}sle]YXUSSSRRROPVMOMNMPPQOMKJJMPNMKGJKMLLMMNMOQOPPQOQPSV.&eЕ]ZWTUSQSVSWVW^fqz~}ypd_]ZVVWWVSSQSMSUSSSSPSQOPPLORRRPPMQSPPPQQPMWVQSTVVWVRUTTWO(HmZXZYZ\^^``hpx~Бzuneb`b]\]]]\[^__`af\\_^_]Z_`\]`^^\Z[Z\ZV\[Y]]Z[[]___a`\]`_cb^^a^\aH8+Gecffmsy{~{unhgcbbb]`]ZZZZ[Z\\\\X]]ZZZ\Z\\Z\\ZVVYZZUSOSRRSRSSUVSQSSSSVWYYWW[ZZ^a`]aa_[/']}КАДДАxrjhjkmrvzsrspqqljpnhnmnmlomjpnronponmmlnnporqnmjnjmmlnnnnmjmknnmlpnnnpqrpnprsrrsrusrrprprtsrssutvwxoЇЎб±ЃЃЃЃЃЃЃЃ®≠≠©≠≠ѓђђ≠∞ѓ∞≠±∞ѓµѓѓѓ∞∞ѓ≠©≠ѓѓЃѓ∞∞ѓ∞±∞Ѓ∞∞∞∞±∞≤≤ЃЃЂЂЦq3% NЄЌћћћЌѕЋ”ѕЋ∆±sB9<:9;9::99:99=:7:<.5<58:65555556769;76454542/65775577776<9783=525545877;558999869997779849;889:87775755@E1UЎм≠X]ehffdbbd\^^Xo<99=87555636447;864755552:6354345668:9565B205547767788:<;9879:9777654999;<;;8<;:;8;A>/b„л¶Z^cfdf`_^`\\\Qd;:r`XYZ[ZZXZVRQRQOQQQQPPMNNMY) \JJKIMKGMMQSSUZccd]ddZZcce_ahqy{u3"HЭХ}{||zy}}|БЗКРФЦЧМККЙЛМПЛЛКИЕЖЖИМЙЗКРРКЙХЗУФЗ†ФРФФТМНЙЗЖuuvwrlggo`eZ!3µzpndjmkihheeegfnkjjldbeeeddblddd^ccacceeeffbee_b`add__^dbb^^a^___\[]]c9jжШ{upjhfcc^__`\\_abf__``efijnnoolhde_]]ZZ\ZZY]][XYZZZ\a_\d]]]]\ZZ\\_]\WR)ЂІj[ZXYZ[ZXXOXYY]ZZ\^cjou}yrka][XVXVXWVSURUROPMONMOKLMLHOPONPQNPQOOORPOQQYR/V®VPRUQSUWVVVVZZZaj}А|yolc]ZZWZVV[TRRSROQPQQQPOMLLKMLNKNMLJLJKIMPNMMMOQJNMOKH/.iПZWTSVWWYVVYZZags}А|wneb_YVVVWWSRQSVVVSSVSSRRPMPOOMMLOLNONMNKKPMMNQQPQSTVMQWWVYH#Ji\\\Y]\``cciqyД~{rndegc`]]\]]]c`]]]``]]]b\Z\\\\\ZYZZZYZYY[][ZYZ[[Z^`^_`]]^^^`^`caabE+-GycflpxyГ}vrniiecbc]]_c]Z\\VYXZZYZ]YZZZYYYVYVZZWUVSSSRPNQQQYSUUQQQTVVXZ[[^aa`]\]`ac_`]//aЛРГДЕ~wrogffhnzsokmmrpjhjhjjjlhjhjjpnnnmpnlljnlnnqoolonjmmmnmnjmjjmgnppnpnknnnrqppprppoprpoptpprrmprnprruopґ”–ђ®±≠ЃЃЃ≠Ђђ≠≠∞∞ѓ≠≠ѓѓ∞≠ѓЃ≤ѓЃ∞≤ѓѓЃЃ∞≤±±±≤ѓѓЃѓЃ±±±≤Ѓ∞ЃЃЃЃЃЃЃђІ¶Кj7 aњЌЌЌЌЌќ Ћ »∆Јr<998:;9755556558985577557556555252679:79986774A739744569<5757752455766558;89978678:9669498888;;989;8<<;82779999;77649<644674455598858;<9945776998666699688;;78;98;99;@A0V÷и•\Wb_b^``a__]ZYo:@v[Z[ZYZZ\\\ZXZZZZZZZYRZZX_r, sYVTQQNNQRPRQUXZYYWTPNNLMKKMMMDNMA';hTNIILLMNPUVZ`djnnrxxz~}~}~~ААЗ~ЕДДЖЕЕЕЗЗЗЗЗЕИЗЗЗЙЙИИЙЖЖЕЗЙЙЙИЖЛЖЖЧm$*Бssr}~В~А|z{{vsioprpperp_omkkijfiikikhjljkmijjjjlhgheddeefhba_abbba_`dgClЏЬrtme_^ad__adccb`^\_aabadcddghghmgc`eccaa_bbcdfdcbb_^^^[[[Z[]^^^^\\]][T'∆ЈbZc]`^][ZY\\^____`iglsy{yuohfda]_]^\YZXYXXYSOVRPPPPINRPRRRROPPPQRQORVTSSM/lЃZXTVUUWUTUUWY[[`m{Вxtne]ZWWWVUUSRRRRROQQQPPPNNKONOMPONOMLMMMPPMMOMPSSUUQSVP$5oИXXVSZVVWUUUZZ`kuГАztk`Y[]YYWUUUTRQQTTNQPSOSPPUPOOOMJOMPPPNNPOPMPQQSWVSTWTUSVQ_C *KmYYZ]]ZZ\\cgqy~Еwrod`^b``]Z^]Z[]^]`b``Z``^a^^^_^_^[][[][^]^^]Z]ZZZ]]a`]bb`^aaaa]^`[H07Gkeeinuz|{yqmhebb]`^]^\ZZ]ZZYZZ]\Z\\]\]ZYZZ\\YVUUWUUSTONLSPSRRUUPSSSTXZXVXZ\[ZZZ[]\Z^W/7c}ЙДИИВwrokfhlrxtqqqrqqnlllnlmllljhllnmnnmnjllmnmhjlilrjljmjmjjmjjjjjjjllmppopntrnpprqnoqrssurrrrsuqrprusy|m¬„”•ЃЃЃЂ≠≠Ѓђђ≠≠ђ≠ђђѓ≠≠≠≠≠≠ѓѓѓЃЃђђЃ∞ЂЃ∞∞∞∞ѓ±±∞ЃЃЃЃ∞∞±±Ѓѓѓ±≤∞Ѓ®∞Кh0 }ƒЋћЌЌќќ ЋЋ»∆Јr<<=99999:=799889898455=755576783549996348;735475758777179844881754689877868969:<8;987389::779;8778:;;9:;=Е^Z^\Z\[\[^^\`^``\`aa\a``lВ/  !Гd\]ZVTRTURUUYYZXXXSPPPLKKJKKKKLQF5[GF=A@A;;=??CHCMNMSTXYZ`bbcegq{tuy|ВДВББДЕВВДАВДДЗЕЗЗЗЕЕЗЕЗЗЗЕЗИЖЕБЙa)МЖБДЗНФНКМЖЖЗА~ВЖВА}~{|yvsrnpoprkjpkmikmijnmmrkhhijllilnjfhhghefddah>Y Сrqhc^_aaaaccaccb^^^^`]]`^bbbcdclcce``badccefgmjpfgc`bcac^^^^]^]]_^[[\T!!ћ≈g]c_`Z[[ZY\\^_\\_cfgmsy|zwpjfdaZd`ba`_\[dYZZXZXTVVSRSSRRVVVUVUWRURUWVTUUT%tЦZVVSUUUUUVVXZ]^dkxД~ylb]WVVVWVVTSRTVRRRQQQPNSOMMOOMOMMNKMMNLOONMOKOPPPTRTOH*/{}[WVMSSSVWVVZZ`iuДД|wn[Z[][[^[UVZVSVSSQPQPMPOPSOOMMNMPOPPNJKLMPOOMOPSSRTWVVTTTUC,Kb\YZ`\ZZ^^cir|~~{rngb`cbb]Z]]]^Z_^Z]^ZZZ[[]]]ZZZ\^][[WVYZY\\\Z\ZYZ^^ab`_^^Za`_a^_`^C/1Okffmrt}|}zsmgecb__]\`ZY]^ZZZZZZZZZYYY_\YYYZZYXUSSRRRUROONPSUSSUPSPRVW]ZZZ\[__b`^``fZV08_ЙМГЕЖАymmgcelrutooornnohlorimhgjjhllnmnmjmhfjlnnmkojlqojjkkmjhnmmppjjjlnnmkoopqrommnmkjjpoprporrpsrtrsstyВqЈўћ•ѓЃ≠Ђђђ≠≠≠ѓѓ≠ѓ≠ѓ∞ѓ≠ѓѓ∞ѓ∞ѓ∞ѓѓЃђЃ∞ЃЃ∞∞ЃЂ∞Ѓѓ≠ѓѓЃЃЃЃЃЃЃЃЃѓ±ѓЃЂѓДa,≈ћЌЌЌќќ Ћ«∆≈ґp<9<::99:<:7/8789899777;5557776788::77836897745755>97765486469348879888578169797:8;758299:964688869;<99;;><4Vўг≠W\b`b`^`_^^^\YXCBТ_X^^```b__`_```a``addcggpЗ2  .В`^`]]YXUUTXXZZ][]\USQQQQMMMMNMGPB#5dHGB?<<87;;=<<<>=;5B@=BD?MWQT_chpvvvyyswuux}~БГВДЗДГЗИДЕЖЕЖЖЙЗb0ПМИЖКПЩШЦТРКЖЖ|~ДБЕРЙКЖЗХЙЦТДРВВФ||~r}rrkdlj]riardahbnkfngqpfrgfnijhddn<G®Гklfab``dcccdccddcc``c`^c][``bbbd`a`^_`^bcehffiingihhhgemeeeceeccgh`_fU&Ѕґs[g`^]Z[[Z_\Z_\Z_aadkqxywspjfa`\cc``ba_aa[]]Z\ZWZZYYXYWXZZZYXXZVXUVWWSUQ\%БєWUVSUTVWRXVTXZ]bnv~}ylc^ZWWSUVUTRRRTURUTPQQPWPPMMOOMMNPMMOOLOONQOORSPOSSZPE'0Д{^XVQSSPTUSVWZbit|А}upb[\[Y[ZVVSWVYVVVUTTTUWUSUSPPPPPOPRNKJMMMOMMMOSSOPSRQRTQQN=!0M]ZYWZWZZ__bcs|А~{snec_```a_b]\_]^^^Z^]][[[][]ZZ^]\[YXWVWZYYYWWYZZYZ]^]`_^\`ac`]__d]>1-Udfilry|А~~wojgeeea`a`]\^^]^Z[[YZZY\\YZYWZWYXXVQSROOOOONONOQSRRSPNPPSSWXX\^]``]^]^`b\V19_ПМВЖД|uoqjfijr}vppoqlnmbjjnllkgfjhlmnmnhhpnejlnlnlplllqjjjklmjmmjnjhhjnnmmjpoqqqonnnppkmnpptmmpppqnrprrqw|nЉ’ ®®Ѓ≠Ђђђ≠≠≠≠≠≠≠ѓѓ∞ѓ≠±≠∞∞±∞∞±±±∞∞ЃЃЃ∞ЃЃЂ∞Ѓѓѓѓѓѓ∞∞∞ЃЃЃЃЃ±ѓЃ≠≠ђБ\+Г«ћЌќќќЌЋЋЋ ≈ґq98:::897974.4578797776<6767766788<936868987722576?8677557546941;98849;;8:867777669946799797798986;89:95;=<>>?=A;>@9=AFGPYZ[VPGJCAHC=HMHMQQSS\acfgjkorwrS/~ЙzВДЛМУУУСЕЛВЕЙЕГДГЙЕДЕЕЖИИУЗЗИИКИЖЗЖЕЕБЖИЙККЗЗЗЙЙЕЕЕИЕГ}|yruutppia`IJІƒnMVffedhhehjjhjkljggnhegcghghhhhhffefd^ba]dbbaadcaabda^``b__^``ehkorГZ"5ќЅnlgghhhfgejhhlhgghgikpqqДrrkhhccc^]]\_d][Z[[\Z\ZWYXYYZZ\[ZZ_\_\___Z[[ZYVX)°єc^[][ZZ[YZYZ]_bho}}Вwoib]]^Z]ZYUYXUUUQRRRRTPQOMMPPPNNNNMMPNMOPQPQQSUOQSUUPH"8|{ZVWVYVVWWWZ[_cqxББ{vmc\YZVZYVWSQQQQRRUUVTTTSRXMLPOPOMJPUQQPPOORUWRUUWUUWVVWUSN?!5TqaZYWZ]\`bbjt~Б}yslc^\\Z]]\]_]]\Yc_^[[^a^]]^_Z^^Z^^ZZZZ\Z\\\ZVX`[\\]]Z]_____bbd`^[X@5?Xfcglry|АВzsmdeddb``\]]]^f^ZZ][Z^ZZ[Z\]\ZZXZ\\ZYZXXTWRURQRSSSSISRZROSUVYYZZ\]Z[^^^_abM)2NУДАЕД|vrmgfhirЕyrnqmnnmmorillikjfkjnnnmmmmjhlnlmmjjmmmrjjnhomjhfhjlllimmjnmmllonnloourkoppppqqpnpnpsprrttyv«÷»ѓЃ∞ђђѓђ≠ѓ≠ЃЃЃђѓ≠ђ≠ђ±≠≠ђѓ∞≠ѓѓ≠ѓѓѓѓ∞ђЃђЃЂђЃѓ≠≠≠ЃЃЃ∞Ђђѓѓ≤≤∞Ђ¶ѓ{X+Н ЋћЌЌќЌ    ∆Јr<:<::999;;<8;;989<65744889528796664464333446315578525404527:86<977898899799:89;77:9987<;<88889;;998999;;@C.bад≠EWj^b`__`^^]ZYbBSТidafihfdfhjiknnqoorrttwuХ/CЖfhbb\^]][YZZ\^__^]YUWWXXTTQNMKMO85xPKHC?<=>A?A=<><<<>=@@=AA=@?@=B?CDJKSZ__ZSNJFCB===487A><9>CDFGIKMSSTE$3rvhkoqsy|ВЖЙ|БА~А~А|~ЗВДДГЖЗЗЙЖЕЖЖЖЖЕЖДЗЙЗЙЛЛМЛЙЛКЙЙЖЗИККЛИЗЗКЙЖДДЕЕДР{LCw•bWZnlagbjgkmiimkmkjjmkmkimmlpooonllmlniieehee_cche`bcdcfbbba_`acglryЕ^9Ѕ≠lebgecgffjkffhhhijjlknmnrrponljjiebdderdca```__^Y[ZYZ]]Z[Z\\Z\\\\Z^\Z]ZZZ•≤da^^[]^``a__adgks|Вyqkfbaf]`__ZYZZYZSXWUVUQRQLPRURRPMPNGMLMOPPOPRTTMQSVVVC)9ИЕ\ZVWYVVYYXZ[^gpyБЕ~xpi_\][]\VYWSVVVUUUZYTTVVURROOOPPPMMSOOOPPORRURQRRUPUSVWSSR;(T`ZZXZZ\]babnx|ДД{rlgbca___]_]]c\Y^^^aZ]^[[[\^\_\ZXZXZZZ\ZZ\\YWX\X\\]]\]__e_a```a`][G7=>==@><==<>=>@@A>B;:;;9;<<9;<<<71:5,AA*4gOCNNPY_\`eomsxvytztu|xБ{zАААВВВВДДГДГГЕЗЛЙЛЛММЙЛЙЕЖЕЖЗЙЙККММММЖККМШЖЖХK;Бvwrv}Г}yzxvwttrphghhk[^hhffpjmmmkrrnprplpihjjjljiikgfghjifhhecgjhlrvИСg7¬Ґj_afdbccbdb```caefefehghlpnnmmkkkhhmiinihfdc``ca`_^_^^`]^]_______^^_^_ZUSЈƒi[a^_^`ceeaafehjt|ААzrldecfba___Z\ZZXTZZXYYWYWPRPVXTUQRQOOORSRPRRTVTRUWWW\> 8Кx^VVXVUUYXW[[aeqyЗГ|ume`^[ZZZVYYVWWWWWVXYWVZZWUURPSSURUQRROPPOQRRRRQTQRSSSVWTSU5)S^ZWVXYZ]]adny|ААyqleeec__]Z]\\``\^^^e`^a^]^`^^c\ZYZXYZZZYYZYWSYZV]]\]b]]ae``]^___[RG3?Voeforw~ЕВ~sieedb_a]\``ac\[c]^bVVZZ\bZ\Z\YZ\WWWVWWSUSOSORRPPRTUQQQSQUVYZZZ][\\_]]_`\[I1TЬЛГЗИzvonjjnosАrljhjjhjjmnjmjmjhdefjjjjhhhhnhjmjnrmnppmjhkilkjjnmnoolmjmlnlnnpppnnqoqrrnpnnpmnpnpmhmmoprmwtЊЎ¬ђ¶∞ђђ≠ђђ∞ђ≠©≠≠ѓѓѓ≠©Ђђђѓѓ∞ѓ∞∞ѓ±∞±±±∞ѓѓѓЃЃЃЃ∞ѓѓѓ∞Ѓ∞≤≤∞ЃЃѓЃђ®ѓwW)П ЋћќќќЌ ѕѕ ≈≥m>=;857768765775545165455445996766>7679678<87889:55755557555797766698986557563464486677746573<797898819;<=<*nўз∞Kahbbabedb_c_]d>$RНrhgijlnlnlnnrrstlrtwuvwyЗ(C|daa`^\YZZZ[^[aa^`^\Z\YXXVUTRPMJP99МOMIHCEABA?A@@@@@E==>=<>>>>@?@A@@CGIY\abYOHFCA=<;;<<<;::<;<<<8;::;<=><@?>@DCIMSUMV[[^bfollpqrruyy~~~А}ВАВДЕЖЕЖЙЖЗЗГЕДЕЕЕЖЙКЛЛМЛЖМПППЛЗЧK<ЭРЛКЗЕЗГГЖГБРГИТГПФС|}ИuБ}oerefh_kh[l^eiipjjjljtnlmnllkmnljlllijlhnv~ПЬf:Њ§echhgfdccec`aad`cebb``bfmiiiiiggihglggkfgefgeeededdl`acc_`aad^b`_]\^_[ZSN"њЅoS[_nbbdehecafhnv}БА|slghiaac^____\[[][_[[XYZZXTSXXVXUURRPRVTTVXYZYXWXZZW^?!;Щ|Z[VZXUVZXZ`]^fqw~~{sie_[[ZZZSWWWWVWWWWXXZUXZWWSRQSVSTRRQQRPQMQRRUVUWWUWVWXYWUX04Q\ZYXYZ\`Z^ckuz~{wqlccb`]\]\\\\]]\_^^`a[]][^b_\^ZY\]\]]\ZZ]]Z\\\]\`c`]``bb``]]]^_^^[G1FSmfhorw~АА|ufffea]a\]a`ac\Y]`]^Z[\]]_ZZZ\ZZ\XXZZYXXWWTRSTXRPPRUQOQQSVSXZXZZZXV\[[]\`UK7XЭЗГМЕ{tmdjllnrurplllnjmmnnmmmmmjhhhlljnllmhhhjjjjmjjmmjhhjhjhhjjlljmljhkilhmpppnkknpprpmorprpnnpnppopqrsuИyњж∆ґѓ∞Ѓ≠≠ђЂІЂђђ≠≠≠≠≠ЂҐЂђђ∞ѓ∞∞ѓ±∞±ѓѓѓ∞ѓ≠≠∞ѓЃЃЃ∞ѓѓѓ∞ѓЃ∞∞∞∞±±±ђ•ђwT/УЌЋћЌќЌЌ«»»∆√іm<<:969:8858798;974375554454678;59<7668797;55756<7555750743;:79:6779999799799799678788966996483578654555><7/nџгђS]d```dddb_ha]dBIМrhiinprpppppttvvnsuw{{{xМД% F}a_c_`^ZbZ\Z___caa^[XYXVTQTRQPOKU5=qORMHFECCBB?ABC@BC@@@?@?A@@BABCGDICKVcf_\OJGCC>=<<<=><<:;:<<<;<<97<<<$3dL<<<9;89::;<>????<@CGIDIIRTVYZ^gmrrssuvxzzzА~ВДВГДГАЕВДДДЕЕЕЙЗЙЛЛЛЙКРLAЮ•ФФРМЕГГЕЗЖЖЕЗЛЕЛПМЙКЧЛСУЗДГИИБ}}|xyttnrtqpnhgnlglmglommkjojmimmmpsЗЕЖ]3ЋЪakmjhhfdfgccecbcedcecccgokhkhhiikifmfggeeeegeefegffkfeegcefcgbcfe`acefaXS њЊm\\````bbdd_cfgnry|Еztqmjoeddc`aaa___a`^]_ZY[ZYZYZYYYZXWTTVZYYYXY\\XXXZZWXC<Яt_ZVXZWYZZ^][`gotДА~uneb][[Z`WYYWVVVSSSURUSRSQRPPPRPPRRURQRRPOPPRSWVYYXWVWZWYUU/:O]\]\Z^]j`bgkvАС{wrlccb`]\\]`\]]]Z^ZZ__[[][\]]^^ZZ[Z[_ZV\\]]]][][Z\\\]`bbbcbcc`bfcZXH@Yocgpt{~~zsmikeb`^```]`^\_]\]^[[[^^\ZZX\\ZYXX]]YXWWTWTSSTTPOPSUSUSQ\V\]\]\\\Z[[^^[`aC!>]ЦГ~ЗБysncgegkrrronkkklsnljjhjjmlhjlnpnmjjmmmmjmmjlllnmmmmjhhmjjjjlllmijjhibkijnmjkmoqnmlmronpmnnprrnppqsiИ}«ў«ґЃѓЃ∞≠ЃЃЂђ≠ѓ≠≠≠≠≤ЃђЂђЃѓѓѓ±Ѓ±ѓ±ѓѓѓѓ≠≠≠≠ѓ≠ђЃ±ѓ∞∞±ЃЃЃЃЃЃ∞∞Ѓђ†≠vJ.ХЌћЌЌЌЌћ»»»«ƒ≥h<<9:<:759798977867987975574789>37787685<7755536755357735218957736679986972:967786556;977;;7875888858;57G@B@e’ё¶Z^baaccbbb_e_\g><Нohljlnpprrqosssrrsurw{zxМГ$ Ktc^^_`_\b^^^acecbb`]YYYWUTUTRQULI; <ФLOJICC@AAA?B@@9BB?>@A?>CDCGCHLLMWbge^UNOFFA?>@@@B>==;A'5pM5;99987578;<;;<974;<;<<ҐЭФЧУНКЙИЗЙЙЙИЕЗЗЖЙЖЙККМЙЛЙЙКККККИЗЙЕЕЗ}БГБ}|yvvtopshnnhomkmkmkkmmrrrtmR3–БhbehhiigdfeeddbehhfhffffkkhjhhjikgcgcdhcafdgcddaeefggcfgeehghgfihhkmpokdW"!«јgeeeecbcbd_cedehlrt~trnjdheeddb___aaa_dccjb_^\\g___\_\^ZXXZ[\ZYYYZ\ZYYYZXZ@!>†zeZWZZZ\^`_^_`fnuАА~xpf`[]ZZ\ZZZWYZZZWWWUWUSRRUZSSURQQQTRRRSUOPPPSVSVUUUUSXWWTZ.5Y_Z]]W]]`^`cgt~Й~urkcfcb`]\fd]]]`^\a^_^]]][\]]`_ZYYXX\VU]Z\\Z[[Z[[ZZ\\YZb`cZbb`bbc]X?(0Zhngpx{А~~tjjohbb`aga`]]\^\Z\ZZZZ\\\ZZZZZ[[XX[]XXVSMPOPPPSPPOSUSSSQXX\\]]\]^[_^__`]^@$F_НКЕЛДzsnjigjlryronjkhhmmkmljmhjfeiikkhfeghhjmjmlhhkkknnnpnmmojlljnolommmmmjnhmpmlrnopmlmmmlknjmnnppnpooprГ}»џ¬ѓЃ≠ђђђ≠≠ђ≠ђђђђ≠≠≠≠ЂЂђѓѓЃЃѓ±±≤≤±±ѓ∞∞∞∞ѓ∞ЃЃ∞±±ѓѓѓЃЃЃЃЃЃЃЃЂ®£©vG&УЌћЌќќЌћ«»«≈¬∞i8:<994545459776467776744755785:799766749568754555555875:5455576467778886636644657579<8677;5715959:38;;8>A>8]÷д®T`hfdeebeeeea^lC=БumkinnprrsooqrrrsturruttНА( Qya\Z[\_\^]]_acfeeb`^]ZZZXZWUTRTNI:C~UPMNCCBCECCABBAAC@<<><<@>?DCBCAGGMPU_cr\VNLCFAA@BB@B@=><7>><==>DH&>rM;<::>:7988;88;855777;897<<<=@CLPXZZQAJBIIFCC>IOTNNSY_a`jtpq~zyДЖАЕ}~~<5ЫЬКРТПЛЙЗЖИЙЙЙЗЗИЙКЖЗКЙЙИЛЛМЛМКККЙКЛЛЙЗЕЗИЖЖЖЗДДВ}АА|{yussspomkhhep^ie]N C∆ЈЙh`fjiihehhghhjhlkhjjghgiljjjjlkiffcfffdcecccba_bdfhf_dccegfhhhhlru~Вu{mR!( Єaphiohffec^ghccefkqvqmjgbecddb^___`b```\faa_^ZZ^_\____a_[]]^__\_____\_^_Z^5D•xg][[^[`^b`a_ajqwББ}wlde`c]ZZZZZXWZ\ZYWWUWRRXXVWSURUVRTTRURTXPUSSUWVWWVUUVWW[VY-8dcWWZY^\_abcnv{}{wrohd`cb`_^___]]]_a__``^`^[a]^`\ZZ[Z_ZXk\\][Z[Z[[]aZZZZ`]_\]`]``^[S?%4Wmdfnv~~{{rnjhd]`_\b^`]\]]`]ZZ]\^ZZ]ZY[[ZZZXXXWWVSPSPPOMOPTSSSUSRSRXXXZZZ\\Z[^[^``^V@'MaКДЗЛД{solkiilryrrmlnjkkmooosljhfehhjjebbfffhhhjfdggghklhjmjlhjjnloolklmmmnnrpppolqrornmopomkpnprppnnsqrrt{ЕЋвњІ≠≠ђ©©ђ©©©ђ©©≠≠ђђ≠ђ≠ђЃѓЃђЃ±≤∞∞∞±∞∞≤∞ѓѓѓ∞∞Ѓ∞≤≤≤∞ЃЃ∞≤±ѓѓѓђ®ЯЃzD,!ХќЌќќќЌћ»ќ ∆√±n:5<:954557897466464344485535555259352432585534775998;759967868<977679888776677877589;9897;885785;:5;557;=<1b÷е§Jcfgfhdeafhi`es=6ШsfonrrrtrsrrrrtttwyyvuwsЕ{' Rr^\ZY\\Z[X[__aeccbc][YZWXXUTTTRNF5KЕWQMMHCCFHGKCBABCCA@>A@@>=CGIDDBFHMPX^cc\SNLHHFA@???===><<<96>==C@@CC.FhTA><<><;<<;<988877<89<988<;8859<>888=?<==<<=9<<9<<<:;<<<<<<88>78<88899;=>@AEGNSZZZUJCB=><<9;8996888;9:;5=<<:=>??BAFQ57}^^\bfhllsrtrxА~~АВАДВЕЗКИЖКЙККПРТСУЛЛЛРФЛЛЛРМПМКНКМККЙЖЗЕДЖЗБЙЗИЗЙЛУwN'@ДЫУVfojgfnlhnkeofokmnjkoppqrsrrrrrplorpnnlkkiiljkhhjhljlkdbffbfhefot~А~vnkV4√°`jhgdhgfgfcchhgggfgghgjhiknhie^``cifffccaab_a______\\]`^[^]__a_^___a_c_`bi%jЈzn`dfdceehhjkkqw~ВДГ{rjnhecea]^`Z^Z^`ZXZZXUSWWWXUWRVXUVTRPTRTUUZRUWUWTWZZZ[[ZW`0%2kaZZ\\`bbcfjny~В~wslfd`^```]^^\_\\`^`b\\\^]]]]ZXXZZNY\ZZc\\_^][_`^^]`d`]aaaa_aaccceY7%>Wreirx|~ААvrnhfb]ba_c_`c`]Z^]]ZZZ^]]Z]]][ZUXYWWUUSSSUOQSSROSSRSSRRSUWVXe\Y`]]]`__]\^c>"UrЧГАЕДxonlfdeio~rommhjjfjkkhokkjjfhjlljchhjfhjjlhhhhjmkkhjmhhmknjllmlllmljmjmmmmllmlmmllmgnljjlnjlmmnpppsumУЋ№∆ђ±ЃЃ∞Ђђђ©©©®Ђ≠ѓѓ≠∞ѓ∞≠ѓЃЃѓ±ѓЃ∞ѓѓ∞ѓЃЃ≤Ѓђѓѓѓѓ≠ѓ±∞ЃЃЃЃЃѓѓЃ≠І§¶§w2)-ШћћЌЌЌЌќ»»»«≈≤j889897564555555567676668=85755545664576555554::5599778667453146667876/3679B;98957877999968899;;6:999@@B@@@>@>AEHKiM<<5;:9;8<<;<<<<;<<985898<=:?CGLTZ\ZUMEC@@<;;;8:99889<99799885;<@983DFFGIPUWVZ[ccehlosstyz||~~БГДЗИИЛИИЗЖКНЛКМКМПНПЛНМТНЛНККНЛЙЙСЛМПТ°РN%ЛБjmuwywxwvtvvoukrprpl[klkkmpmnppppppprrrpoqlnpnqqopnlknphhihirjhouДНМwmbV4дЭUce`_^a_aa^Zba_a`__cegghehhgge`bffgggfffcgecd`_ccaa^__aa^^^]a_aa^^_a^`^_`d%}Єzhcbd`accjhhlkqx|ВВАrllh`dfbcdc`caad___\^Z][ZZ^ZZZXXXXRTRRRTRSUOUUUWVVVUVZWUU_0!/c_YYZWa`^cgjpw}Б}usmfd`bbaa^^Z^a__bbbg``^^^e^]^ZZZ\ZY\WY\\\^ZZZ^^\]\\c]]```aaa]``a_Q5!AVffkrw~ВВ~wsojhcefcbg_`m```^]]ZZZ^]]]]]]ZZYZYVYUSURRSNNORSQRURRSRRUSUWYYZY\Z`]```a__[;%V{ФГГЗД{iplfdglp~ojrmhhhjhhhjmhhihfhhjfh`fhjhhfhjffhhjmjjhjmhhkkjhiimlmlnmjjlomlnmmpmmooqnlnnlljqljlnnnnpsfkЧ»÷ЅЃ∞ђ≠ђђђЂЂђђђ©ђђ≠ѓѓѓ∞ѓ±∞ѓЃѓѓѓѓѓЃ±ЃЃѓ±ѓѓ∞∞ѓ∞±∞≤±ѓѓѓѓЃѓѓЃЃ®§•Ъs=&8ХћћЌЌЌЌќ««∆«≈≤n57956336555444435655634685-4245456446885455649999;967697877545587885545568998886755575574346688'988;<::@@@AABBCEDDGIMMX_fif_YSLHGDDCCC?@@B>>@BABA><<>BHEDyRC>8;<<<<<<>><<<<<<;;898;<>=?ABNUZZZVOGBB<<<;:::99:99:<95856;788;:97=>><>@BDG?@HJJOSSWY]cfmmqqqqrrvvy~yyЕГАБГЕИИМЕДЗНЛКЛКЙКЛЛЛМЛННФ•ҐN"-ЗШЗВГБГ}}}}БГ~{Аyuvpjmkb`a_^[nbmocmkhrljpknpnroonnrklklknlpu|ИТЛ~togS9–Л^ffbaac_`aa[__[]\\^^`eccaab]b__cabedffddbbZek_`eebcaacac^aa^aadd``bdbegehf)М xagbi`cdcgccggns{~~}|skiibdffbbcbdacfaaaa`_^Z\^]ZZZZZZZZZVXYYWZ\\X[ZYYW[WW^ZVZZ*3^cYYY\^Za``fmrz}}urlffdb`b`^`Y^_^_aabe`b^]]a^^__Z^^\ZZW]^^^]\]\^^`]]\b``c]]`]ZZc`[cM7=XkfouwАВА}vrohfeefecac``^^^]]]]]]^]^^ZZ]\Z\ZUZZUVYUTSPNNOQQQQTRPSPRRSVXYXY\\]`a]]_^^Z1$XyЙГЕЛДzpnlfbgjrxnhnimmjmhjljlmkhommjhfhhffhfffhlffhljjhhhdhfhkjhdegmjnlomkjnnmlnmjpogonnnlqnnqqnmkpnpqqnrrqЫ»ЁЉЃ∞≠≠ЂЂЂЂ®©®©©≠ђђ≠≠ѓ≠≠≠ѓ∞∞ѓ∞ѓђЃЃЃ∞∞Ѓ∞∞∞±∞ѓ±≤∞±∞ѓѓ≤±±±±≠ѓЂ¶®ЦsB' BЭЌћЌЌЌќЌ«»»»«∞o47=976667765454322346222521322226534476655121569986676778955579:597555998688;9;8<;77855<44666688:77598;;==:kўгЬ]ghffhfgggikfhx>3§sntrtrurrrrrwwwwwtuxzxxvКp YБ]^][\^`\\\^``ceec^\ZYXWUSVTTROQ_2@|ZNLLHHEBBBAFDCCDCCCBBDGDCBGFDJMKMRT]egc^XQJDDCBACC><>@==>@?AA@==??CABwNC<<<<=<<<<><<><<<<><<=<<>AAABMRXZ\`XLDC@7;<89<:969939;85;:985992773>N8#@>AAACDFKKRY_ca_]ZZ^\_aachkoqrsx{}А}АДЗЕЕЕЕЕИЖЖЖЗЙНХЮL$0|ЯЗЖДЕЕЕЖГЕГГБГЖЖЙЕЗИРЕЕРЖВМ}ЙСЙВ~vykpr[mh`pgbjbllenmnpqrnlnnnnnpt{ВДyqjgP/аГffheedddccccccbda_aabeecbcd`caa_^^__a`^`^`[\a]]`_^__accemhcadfdddeghilkjfe(Яјz^heicfefidcbjpty~||xsoiiddfgcceefcacaafdaa_Z^____Z[\[]][ZZ\\\\\]Z^]_]Z]\ZZZZ[[)7^e\\]^a`jbehntБzurjffcb``[`]]^\ZY_aeg``]][^``^_^^^\YZY`]^[^]^\Z\``]]b`]c`bgb^becc`M<*CZohpru~АА}yrnhge]cb]\]\]]^`]`\\]]`\]^\Z]]Z\ZZYYVYWVVURPOPRSSSWSQRSRTVXXZXYZZ\`a``_^^^.!Z{МГДЕ~tpjgdddhp}nhhfjmmnfhjffjhhlhmjjikiijjhhhlrfhjhjljgnfffhhhjddjhhjhkihhikmmnllnnlqljnnqjnqqnnnqkorpnrvj†«’ґђ∞Ѓ≠Ѓ≠≠ђђ≠ђђѓѓ≠ѓѓ≠≠ѓѓѓ∞∞∞±∞ѓ∞ђЃ∞∞Ѓ≠ѓѓ≠ѓѓѓ±≤±≤±±ѓ±ѓѓ±ђЃђ®І§Шy2* K°ќЌЌЌЌќќ∆∆«««∞n59=:8777966642541446554413<435445535586652533448843343367644479:4544679986879795;99;;548688688988995:7;<>?>lўгЩYjhfhffhihhihhw<6ЫrmprrrruuoqruwwwsuwxzxxxЙr ZБ_^]^^]^\Z\```eeec^[ZXXWURSSSROMZ0@zWNNHDCCBBBBDDAABCDDDCCGDCDGGGGKKORWdgigbZRNLDFBABCBABA>?>>>BBA@>@@B<<{L?<><<=<;<<<<<<;8<<><>><>>=BACJOX_b`WMHDC@=@=<<:99<>::99;::=97997;99AS9CeB;859;58;8:<<<<<<>>AACGJLLXZYTRNMKFMJMJMPQTVYY^bcdfikmsztw{{z~|||ВЕИЙH'0{ЩЕДДДЕДЖГГЕДВВДЕВДДЕЕЕЖИЖДЗЕЕЖЗЖИЗВВБАДА}yyywvtqqjmdpohmlhlllnmtstuqirdK8“Жrmigiihhgheeehhffcegegeeeffddcaa___a_b`b_b^^__^b`^`_`^`a_ca_cbbehhilnsusee%!†÷r_pffcdffacgchkqtyy{wuqliecchfffgifccfegdadddaaaa__\___^]`_^__\\^[][[Z^_\ZZZ\ZZ&7lf_a__`_dbgkr|ДБ|xslihfab`]bbc``_^_bcc]]]]W]]``^^ZZYYZY\\ZZ]\ZZZYba^]b`]bbb]c`ceafeM<*@hmknrx~ГГ~{rljigcc__a]^_`^^\]Z\]\]\ZZY\]\YZZ\YVUVVVUVRRTRRRRSURRQSUSYVVZYZ\Z\]`aaa_ef/"]ВТЕДЕЕvrlhfbdgqxlhhdfhflhfheeffffhjjilighhhfhfgjhjjjfilgjiijhhnqjmshhmjkljijjnnnlnnllnjjlljklllonqrkltplruh†ћ”≤®∞Ѓ≠≠≠≠ђ≠≠≠ѓѓѓ≠∞∞≠≠ѓѓѓѓѓѓ∞±∞∞∞ѓ∞∞∞ѓѓ∞∞і±∞≤≤±≤≤ѓ≤±±ѓ∞Ѓђђ®Ђ£Ш|. R≠ќЌЌћЋћћ∆∆∆∆∆≠h69<775644345044234886645397334553456689;87<7886886456556:5554575252157889897765/998886556786889889757:;<>EAnўгЪ]jhiiihijjmmijА:;ЦroortttutrruuwustuuwuxwyКu W}``\_]][^ZZ`ceeefb`YZWYVVSUUSRNLX2;БWNNGCCCBBBABDA?BCDGCCCCBBDGHIGJKMRM]ehf_YRKLIFBBBBCACB?BBDBECCB@@?MB9kJAA<=B<<<<<<<<988::<<<<><<<::=>==<9::;><<<<:==5AX4"EeF<989<;<<<9<<:<;?=CFGGGMNQQ[Y[afdgjlnrtx|tL'/sШВВ{zА~Е~~~БГБАВАЕГГГВВДЕГЖЕЕЕЕЕЕЕДДЕЖЖЖДЕЕЕББГГГГГЕuyyrxrprnrrhrlfnmim^F`ћђ}lmjlplnikiikimhehhhinjhgggggfcbca_aadaabbba__ac`^c_a`aaac`ccacfejrsyzyrpc*#£ўskkccbbddeeegjgkrxvvvqliigcgccfgghgfiiggeeeeeedadaade_a_adc_bh_\__^]_\_b^^^_^XV#DkeacbbddfcglrББ{ukifhccc^_``b`bb`abe^`a^]b`]`^^ZZZ\]\]]\Y\ZYZYYZZ]\Z]_bab\bacb]ffM5j„бҐcghilihiiloojkq<CФsorruxwywwuwwuwuwuwywzz|Кo!  Z}`^Z_[YY\Z[_cccec]]YZYWUUUURSSPO]3!5vYNJGCCDACDCDCCCBECGCCCCBBDHHIGKMOMR]cgf^YRIGGDDCDBCCB>>@@CCCBA@BC@G@"/ГL@@>=@>=@<<>>@=<=:9<>@>=AB>D@CFMX_`\OJGAA<<=><:<<<<<<<@;:9;<<<<<;;<;9;;<>>@<><===?>>BCBCEKRXZZRMHHA?=>A?><<<@>>>=>>9=BCCDGGFJGMPPSXWZZeE)/mЖqswsxxГywy{|||~АА~ВДББЕЕГЖГЕИЕЖДГЕЗДЗБЕЕЖЕЕГГГЕЕЕБЕГ~}}ДВББББ~{zvvwtphZJUнЏ†Snfgxltllprunnnnjvnotkilhhgghfeeeedbeccdccca_acdch_aeb`bcaffdbhjr{}}}wpmZ*#µЏriifeecceffeefcjlnnppniihhhhecbcccecikjhddecbded`de_a_daddcb`fc_adddadejddffbZX)&Lolgfcgfgigimi|}yqlighcecc`_bcbc``_bb^_b_^``]]]\ZZZXY\\\\\^]\]\Z\\]\]nacecn`_bc_^`RH5@giikqy|АЕДyreiggecbbcaaa_]b\]]_`_\]]_]a`\ZXZZZZZZX\UUUSSSPSTWUUUVTTTWVUXYVYZ]\Z[^\ZYS4$XТУГГД~sjpljhhnrrpnnjljjkokmjfghihjighjjhnhjhhhefghhjfhddedbeffhhhjjhjpllojhmnmnmelmmmjmhnnmqomljnrqvqrrruymђќЏє≥≠ђЂѓ∞∞≠ђ≠≠®ђ≠Ђ≠≠≠ђђђЂЃ∞Ѓ∞Ѓѓ∞ѓѓ≠ѓѓ≠ѓѓ≠ѓ±∞≤≤∞≤∞≤≤≤≤ѓЃђЂђђ®•Чs4 ]ЄЌ ћќќЌћ∆∆∆∆∆ѓg79:97566586521213664643.46646644455158786468666674448987677755477885754899::5978=:58809998697877:::9645:<85c„÷І`ekilljijjnjhhs<HФrorrwzwzzwuwwruuwwyzw{z|Нo  jz^^^^ZY[\ZY[`cbbb^[XXWUWYUTRUTPJY/5oWKGGCABDABDCCDGGDEDCEGCDGCGIIHJJMJT]djh_XRLIGDDEFCBD:?@>>BB@@?>>@"0pGB@@>=8<@<<>>BAA>?>>@@@@BAAGDFIOV]^ZRHGCD@==<;=<;;97;;<<<999<9:<:9:=C_*!OtG;;9;;<=?B>>>@>A???BHFHGMS[Z_UOLJFCAABAH@>@A<=?>>==<==?@@?@C?BA>AA:2Ю±sSqjhlepmfpofjjnilunnxppromonolnkkjkihfeheieecaccdhbae_^aa_cfhfjr|КББ}toe\ !ƒ„mcicdacccbccadbffihmpmjlhhkhhfegigkdigggcbcbceaa_cg__^_aeac^`cc_^bdihehkhehidcV%,Mzrihhjhhklqru|ЛГГ}tqlkjehheebfgbcb`bb```a````^^_]Z[]YZ^^^\\^]ZZYZ\Z\Z]cbdb`i_^abaaZXLHJcjlltx|АДАxrnhegcbcb^^]^a\cY```]`]`\\dc_\ZZZYZYZVWSXUUUUSSVTTTVUVUTVUVVZYZ]Z\]\]^^^\V2(PНЙБДД|smkggigmrrqlojjjhgkkjhhiimiliehjhhjhjjjjfhhkjjhjgghefjhfnmjhjjjlolljjjjjjjgjllmjjjljjnliljlqqrrsrqutkђ ”љЂѓ≠Ђ≠≠ѓѓ≠ѓѓ≠ѓ≠≠∞ѓѓ∞ѓЂђѓѓѓ±ѓѓ∞∞∞∞≠ѓѓѓ≠ѓѓѓѓѓѓ±≤±≤±∞≠≠Ђ©ђЂ©І£Шs2 iЊћћЌќќЌћ∆∆∆∆¬Ѓc59578966696510125646866/66444864977357691468466656466755687555345785555799:979888;87558;98:<:93797:9949>@B>C>$0rECBB@>:<>><;<>=>>@@@?ADCDGOV\b\XPLHDC@><<<><9<3<<<<<;99::<<<:9A<<<==C>A;?QFHKMSWZXXUMLHDBBDCDCAA><>B><@>>>>@D<;@@?@@>>>??ABBBDCCBCCHDFGLRR\cfaRYUPMIDCDDBBC>AG@@BBDFCCCDBI>!2hHCABBA>>>><;<>=>8@>B=@><==ACCDEMZ^c\XPJFCA><<;<<;<<<<<<<=CP2 TИEB><<<@>>:<<<>AA?AAAGCDJLPUZYYWMJHDAAAA@@@@>>>@><@>><@AA<;C@@@@><@>BBC?//]KBCC@AAAAAA@@GBCFCNQWZ_]_Z^^_aafeimmmoxxwz~ВД|{|}ББГГБВГЕЕЕЕЖЕЕИМРРЦФЦМРC/yС{x{~~}БВЕАБ}y{{xvvqrrnekepohjjnnhqpooqmnnrroppmmmmiijijlnrwБЛЧПВzvokX%% ƒh^e_a`^a_aa_]_]^]`fffeegefaa__ceeefdeghhfffcahfefeecggegeccdbdecge^dfgiigfibb`M'ZttmlijkhimmquwТАВГ}xqqpkmlkeifijjjhhgghhkiigehehhecc^^a__^`_\^\\Z^^a``ca`a^`ba`_`]`M8;LhicntzБГВАxogllkfdcaca``a^cbbb`ba^^`_^^_ZYYYVYYYVWWTRONNQQVSRSSPRUVWVVXZZZ^\^_]^abaZ]'%CФН~ГГxpkkgfimssromhffigjijjhhhiegefbjfhgdacccfddcdffffegghhffjjmlmnjlhfjjfjjmllomlmmmjlnlnnlhklpuutsurqzgґќ“є®≠ђ©Іђ©ђђ©ђђ≠≠ѓѓѓђђђ≠ђ≠ѓѓѓ≠≠∞∞±≤∞≠ѓѓ≠±±∞∞±ѓ∞ѓ±∞≤∞≠ѓ≠≠ђ©®•°Пi1 Ж¬ЋћЌќќЌћ∆»∆≈√Ѓe875557663434554255586444311434411225736604433655777998889899779965555589788667657857885455655675997:977;<;6rбў†lsifmmklnrqpphs8BШ{suwxzxxwwwywuuwutwvАzwuУg _o\Z\\ZZYYZZ_aaacb^^[YYUUUUTTQSPMR<KxWPJGGHIFCCBCCDCBCCGDECEBCCABFBFKMOU[bcaZUROIIC@B@@CB>>>3@BBBCAACCFJA%0yHDBB?C@>@><<@?@>5@@G?@<><=ACCCJRZbc\XOHDC?@<<:<@<<<<:<;<<<8;=<<<;==>?`%b|B>=<=<>?<=<>>@ACFCABCDDLMRYZdZWOHGC@AA@@?=><<><>>>=<;>?@:7LBB?@?AB?BBB?)/bKCB@<@@@@@B>BCAACCGOUXYZYTTPNGMNPPPQTUXZZ^afjjkkoqtwywyzz||~~ГГИБЕЛТЦСУЖB'ЗЖ{АГБАБДБВКГЖЖЖЖЕ~БД~А}Б|}|xuvvsnrpigki_\j`\kghhfhheljfrlppnpru|ЗТЗ||smrX#∆ґnjgfcdceeffdccfibdfghfegffe`````a`c^__cbbaca^acbcbbbegegeeadbcehhhcfiikollmjhaO$)z†rlmljikoolqttААААyrmpmfljgfiiliikjghhhhiiikjkjhhcbcb_b``bcc_`acbcccfffcfgcglccccc`L54Vfegntz~Д~{uohjbcbca_a]\\`^_^`b```^^a__\]ZXZ\ZZ]ZZYYTUUSSVVWVUUSSTVYYVYXWZY\\\_]\]]^\R&!AЫЙ|ГГ{tkgfgdilqqomjhfiggilllgffihjhhfjjfhhffddhffefefheegiefdfgieglhfjhfjllllmhllgiopsjjlqnllkllprvuuvuvyВrґў„Ј©Ѓ≠©Іђђ≠ђ©≠ђ≠ђ≠ЃЃђ≠≠≠≠ѓ≠≠≠©ђѓ∞∞±ѓђђЂђ≠ѓѓѓ∞ѓѓ≠ѓѓіѓ≠ђђЂђђѓҐ°Кf1Б¬ћЋћћћЌЌ»»∆∆ƒѓf855475686645457495779866533543420211474430232334656588338895447777565345689769<5887;992578;57778A9899789<<@?@EBAA@@@>>CIC4fMCB>@A2=@>===@BB@>>@BA>@@>ABBGKR^fg\XRJGG:A=<<@@B<<:<=;<=<9<><<<<<>=?<>@?@BDCCBDGJMOX]d^ZWQLJHGHHDFC@A@>@@@@>>=@?>@>>B>@>?AACABA><%2^ICBB>@A@>@BABACECCGJPXZZWVMHGABCDEFJFGGGHEEEMNCNWY\_gcgronnouwwyА~ГЖПМЛ|9$}ЛВБВББГДВББВЕЖЗЕЕБГГГДВДЗГЗЙББЖЕЖЗГЖЙt{w|tntnfnfeg]gcXjfgjjlknrsuutrmh}M%¬§rkjihhfhiiihfikjiijiniiikknfcrccccbcaa__a_a_Z_^Y\^^^ab`bb``bbcbcehfikmuwqnnsieO$/СЯsikfjgimlhqss}|ААyrrppmmkgkkknlmljgggiljjjklkkkjfggheehcfgigcfgfdfeigddghhkkbgghjaJ./Zjgjmt{ДЛА{tnjhccbcc^a`Z]]ZZ]]\]]]\Z\\^^ZZWX\ZZ\Y\YVWUVSUSVVVSSSRRPSUY\Z\]\]\`fda]`]fO-$EЫЗ~БГ{rifccefnorkchhhggegggfeedjkjhhgkjfhjffdhghjfhfefeceeiilglg_iljhlhhljlnjmmkhjlmjnjejnjjkilnprrvvxxy{Зmіё÷≠•ЃђЂ®ђђђђ≠ђђђ≠ЃЃЃ≠∞ѓѓ±∞≠∞∞≠ѓ∞∞∞ѓѓђђЂЃЃ≠ѓѓѓ∞∞∞≠ђ∞≠ђЂ≠©ЂЂђ°ЮИa3∆ћЋћЌќЌћ∆∆∆≈√Ѓf756654436884457555559977555555522443796664553>3475256<46466426878855846648876885577566577;779999<;<;;;<<@C>BD98iPB@>>@>=>><><<><<<<>>>?@B@@<@DDV^cg]XSJDC>C=<<>??=<;>><===<=><<@<9ACCP,!^rDA>==<<<>?>@@BAACBB@CFGMPZ_b[ZUDLLHGJDDGDCBA>@>@@CAC@??@?>>A?K<5pMAAC@@>>=>@@@@DECEIDPX[ZWRMHGB>@B>@CB>>@@>A>@B;ACCGFGMLNQRSVWZ\^bfjnryx|q</uЕtwy|{|А}~|~~БЕГЖГЕГГЕЖДЕЕЕЖЕЖЕГЕГГВЖЙД}ЖЖИЙИГББ||wusnqppiqplgfghjnggikL7єІЕrjnomnpmmmkhljllljmniiilkjieiggehhehihfheheefcdebbcc_a_c_b_bbabcehmosw{rnhoheJ8££rnfdgefhjgmoqwxywusrqqmmljnnjnmmoolmklollklollkihhejhjkfgfdc^cfcffglkggjllljjkchl^M!0Xpjnpu|ВДЕ~xpkjggeceaccaa]]]g`\`b]^^\\^^ZZXXZZZZWZWQQSSRSSSQSUQUSPPPSVZ]\ZZ]]]`\\`aaaO*GШЛАГЕАtljdellosrjfkhffgehdehdeegkgeggkghjjffbeefjfjjefeceegiigggeghhhkhjjjkmpmlljlmrinnjlnlnllnnpsnrrxАyweЈ“—®¶ђ©Іђ©ђђѓ∞ЃЂЂђђђЃЃ≠≠ѓѓѓѓ±∞ѓ∞∞∞∞ѓЃ∞ЃЃЃЃЃЃѓ∞±±±∞≠∞ЂђЃЃЂЂЂЂҐЮГ[/Г»ћЋћќќЌЋ∆»∆∆¬ѓf93;955464664554544445555555029532433794688445;5555246;68648889988956777669635:857758645445542456688A;;9;4<:qџЏ®ewrnnnmqqorrrl}*RЖysvuwz{zwyuwutvwvvzzyyyqА]icZ][\\ZY\Z\\cffeaX_\YZWUUTWXURNJ_3V|VKJGFDFFFFCCFCBCB@BB>@?@@CCCGEECJMY^fhc^ZQHDCCDDCBCCC@@A@@A@>>>ABAC<;pMFB@>??@@B@B=<<<<<<;@@CAABCBCGJR[_]YWRJCB<:<7:<>==<::=><<>>=<><;=>A>@BDAACCCCDIIMT\_a^ZWJLHGDGBBCBB@@A@AB@C:B@??>A=DDABDCBCBBEM<5~MFBGB@@@<@CCDJDGGDGMS[_^ZUMJGDB@C>@C@><>>BA<=>;<<>==;>>>>CCBC@DGJLMNQTUZY91hufiklqsrq~s|ww|~~ВВББВВАВЕВЖДЖДАДЖЕГДИДГГЕЖЕЕЖГЖЕЗЕЙЖЗЕИБГ}}vssqrkjofR#G©ЌЧg[llllrplnllplipnpppnknnnnjhhhjhfjkhililhighichhhhgeddbbbgddfhhikrw{АyuskghekDRі°rncafccffgjmdqqrqrqnqqolnlmpmnlloolomnqolkllkkkgigghjjjhigggcfgfggimkhikkkookmlknaE*6XnlrvxБДДХД{urqljgggccccda^_`^```b`__\^[Z]ZZ]ZZZZYZSQRRSTSSVVVVTUVQRRWYZZZY\ZY]\Z]a\hO'IТЕАТДАvnjfelnqurkhmmmhkjljfsgkghrkhkkkhhjhdddcdbdefhbfebecegeeggjjhhkkgjhjknnmlljmhlhjmmnnmnonnnrwrsyzИy|Жkє÷–ђ≠ђЂ®©©©©ђђђ®ЂЂЂђђ≠≠ѓ≠ѓђ≠≠ѓ≠ђѓѓѓђЃЃ∞ЃЃ∞Ѓ∞∞∞±±∞ѓђЃЃЃ∞∞ђђђЃ®©ВZ/З»ЋЋћќќћћ»∆∆≈¬≠a;897774445755845454545225221274355245534666355555754686864899968795566767;;48935886984655574134686499;898B:o„„£]sonljlnollpnoБ+S}utuuy{{{{wtwuvzzwwzzxxxpАfre[\\\ZYYYZ\^`dec`Z^ZYYUUUQTSURQLU/MАZMIGGFFFGFCFFHFFHCDD=CBCCGIGDCGJMRV]ggc\UMGCDA@B@>@@@>>>???=>>>@ECH9"=iGDC@===>@BB@=><><=><@ABAAAABDGMV^c^ZTOJDB<8:<<<@?;<<<:>@;<<><><::<@B@F*`lB>@@=<:=>@@@@CDDGDGJGJJOY_ada]WUNKHDGCCEAB@@A@B@>@=BB@>?AAFBAAA?@CCBCO;8yLGC>A@@ABBBBBHHJJEIQX_`a\UMLGDDCC@@@==C@<<<:<=<;;<;;:8:95>><<>>>A>A>>ACCJ4,XVRSSQX]]\cciikoqswxz~x{{{~~~АББА~ДДВГЕБВББЕДДАВБГБГЙЕЕЕГЕДЕЕЕЗЖЖЗДЖМДЕА|{M4z•ЗZ[feh]kn[jgeqhhuirnjprptprplqllpfpnllohokkhhihhhhjifgffefhgfhdjorzГБВ|urkigakCZ≈Ґphgkefgfffihejlntniloqlklmlnlponlilljlnmkhjklkjgiggfhgihighgcccfgggkiklloolqonqqxf?/5^nqwxyБЖИЙЕzsrqnmkmjgffdfdgbbccacb``^]\^^]aZYZYY]ZYWWUWTSVVWWVWX[VVVZ\ZZ]\]ZY^\Z]^\dK%"FШБ|ЛГ|rnjhfggnАrhgkkkkifihgmkmkhkhkmkhhffffhhghgghhjhjjfigeeeehdhnhjiihhhhhjimkjfhjjllnjmnmnkmomrrpsy{Ж~~tЈ—ћѓ±®Ђ®©©©©ђђЂЂђђђЃЃЃ∞ѓѓѓ≠ѓђѓ≠ђ≠≠©≠ђ©≠Ѓђѓѓ±≤∞ЃЃЃѓ≠ѓЂЃ∞Ѓђ®ЂІ¶ђБY/И ћЋћЌЌћЋ»∆∆∆≈©[:79974565999557766687422;5622577553221366464852525468886867766444572647668988856786696888885578998899929<7;kЏџ†[smommjnonnjlk|/Ivtsruvyxywruvttxwwzzz{{xtУisr\_b_\ZYZ\^^`cfd`^\ZYYUWWTTQQQPPZ.DrVMGFFBDDDDBCCFFFFCDDB=CCDFJKGGILMTZaadfZQMJHDCC@B@@CB>?=@>=?B@@@CDI5"@pBCB><9<<===<:<<><<@@@>@AABABDIOY^bdZUPHCA>>=<<<;<;=?9>;;<<;V#ZcC>><<>?B=>@@@ACAJG>HIJLKVZadf`XSPNKGHGGG>@CCB@B@@BABBB@BAADBAA@@CCCBBK5<АMFC?CCCBCBAA@CGHJHJPX_`d\VOLJHDCCBCBA>DB?>><=>><<;=>88@<<<;;;<:??;FKGD>BBCCBBBCCB@FDEGGGGIDJJRY_cbbYRMDGG:=::==<=<:<<<<<=>===>?BABGGNS^c`ZUOHCA>@<<<<<<@<<><<<<;;<<;9><=@@=M)Xx=><<>@@C>>DBCA@ACCACDHJJRZ]`^ZXRPMJGGGGCCCFFDBCBCCABBCCA@ADDFDCCGDFEBU2D{PGCACDDCCCBCBADGIJLPX_bc^WPLHHDDC@BCB??@=?@>@B>>=>@><<>>?<=>><>?=?<;<@:DDGNRX^\MQRFMXZY\]ac`cejlnvrrtuyz|zДЕВГББЕГГЕЕЕЗЕЕИЕКНРЩШФУКДQ/tЙ}z|~}~~{~ЕГ}}|y|xxtqrpeqpajhflefghmkkkmqspppprrqlpppmmqmnnjknry{АРМ}spmmgfkEQЈЮ_fhfadfdcdgggfjdhhikihcfgiijhhjfhhfhhiigjihgmqlllhhjhkkihifnfdffjhllionlkkhllmmoi`=%8]rqrwyВДКИМГ{usrqqqqqmnonnpnmooohlljjgmmkiggecc]]]\\\XUVWYWWWVTZWVTVZZZZ]]]_]]XY^e__hA0SЮЕАГБ{tnnjfilo~oijhhhhfhmfefgiiffefhfeeedebegegjgfffegefihhjhdfhjmjmjjljqmekkkomkijhjnnnppmnpntopqorВy{|v{qЉ–∆Ђ¶®≠ЂЂђ©®®®І®ЂЂЂђЃЃђЃђѓ≠ѓ∞ѓ∞ѓЃ∞ѓѓ≠≠≠ђ≠±ѓ±±≤≤∞∞∞∞±∞ѓѓЂђЃЃЂ§®T.К ЋЋћћћћЋ∆»«∆≈©`<7985356566221222656533333454575533<5546656477442568846646775752:;916446848688558866776755757:;87;99;8<;=@=hЏџ°`issrsqqqrtrqqД7Ivyutzz{{{{wwwwwxyy{{{y{{uМf~s[^b`^ZZXRZ\_``^__]ZQWYUWWXRQSRRY,KБULGGFEGHDDBFDCFGEEGGEGGDJJPX_icbZULGIH:CB@AABCG>>ABBBBBCECGI>HwNEA=>A=B@>=>:<><<<>B@===>BAC>GLR[^^ZUOC@CA@><;9:>@<>GDDCB@CCDCGILPV[b`^YXRRLGDDDAFDBCCEAA>BCADCCAAABBDGCDDGDGCBG5!<ЖOHCDCGGDDDCFDDHHKLNSX_gc_ZPLIKFFDBBBAA@B>@@@@@==@A@><<>><>AA@>4>@@<>H+JZD>@A>@JDGMOUXXQKGDBCC=IGIJAJMNQSUXY[\`agkztrvsrsx{{В~~ААВЖДЖИЙТХСРТАM.{МЙВЕЙДДЗББГЖЕЖЖДЖЕДБББ}ББyvvrxorqnrfamdim_nf^mhllqpnrtprvrrrrrxx}ЛВ}|rqrojkp>O≤Щrkjfdhjggfhgdiiigihhjgdghffjddfehgfhhgigggeffjiikgehjijijlkriiklsnrsrsxrsqmrnmnpqb=2=_rprtvАБГЕД|yssrqqqnqnnqnnqnnqqqjtnkkimnmmkkjhhccbb_a_^^^[Z\^^_ZZ^WX]Z\]\\\_ac_\Zgb[j?5SР~~Аznnnlfhnrupjhfffhefiiggkikjgghjnlhfhfefhegjffffehfffgegh^fhhjhjjhjhjgfkkkkmkkjhjjjmppmnnmoqqsrv{|~ДДјб«ѓЃ®ЂђЂѓ≠ђЃЂІЂЂ®®ђђЂЂЃ≠≠ђ≠≠≠≠ђ©ђђ≠ђ©Ђ≠ђіѓѓ∞∞∞ѓ±∞ѓѓ∞ѓѓЃђЃЂ®§ҐАP.!ПћЋЋЋћћЌћ√≈∆∆≈ђb:9:985886993355564553355534545543037444445445411246443443874554156986466887777557788774599;757889:79;8;8=DA@?@AABBABL?J~QE?====@>>@><<>?@>B@@C>?>BCGBLQQ\c_ZSMDCBAA>;8858<;1;<:<<<9;3;><<<><>>@BDC@DDHJLLRX^ccb\VPNLJGGDCG?CFCFDC@@CC@@A@CBC@@DDB@BCD>AJ1>DA@===>>BB@@@9@?><>>??>>,$I[D;>>>>@@@A@BCCGMQXXXRMJD@AABCBABA>A@;DD=BCDBGJNQOYZZ\^afiomkoor{zz|~ДЙЙЗЙГF(uЕВЕЗЕЕЖЕЖЕЕЗЕЛМЙЙЙКЕЕЖЕЕЕЕЕЖГЕААЕААЖ~zzzzxutplplkgfe`fhakmllpqqsrxx|wyotvnmnp;OЭМxkomnjkkliillpmkmmmkkhgiigeeeeedeefffgidfffeefgegfegehhhjghoikmmorw{xvtrroorrpoor`NC\bВosuty|АЧАyurusqqnnqqlnnlnqljqqnzlmkkmkmommligogfead`_^^_^bbbb__b^^c^`bccafgecd`ej^^B9VХ~z~wrnmifijqunjjhfhfbbeghhjhjhhhhijlhfhebeedjihhhhffhlkhggndmhhjhljhhhhfegkghhhhhefhjjjmjjjhjoqsst{{|ЕЖњ№«®ђ®®ђђ≠≠ѓЃ≠ђЃЃЂЂЃЃђЂђѓѓ≠ѓѓѓ≠≠ђђ≠ѓ©®ЂЂђѓ≠≠≠ђ≠≠ѓ∞ѓѓ∞ѓ≠ЃђЃІ¶®ЮВI/%СћЋЋЋЋћћЋ∆∆∆∆¬ѓa;87853989687588563355586856755545325546434466511113843443542242/54466688997575478755268477=574469998:78:=H9pааШdqtrrroqrqwrqq{/]wrttwww||}||||zwwv{zyz{v~^|q_]`^\^Z^[[[_ecb^_[[YUWXWUXUQSPOW'AWLKHFCBBCDDCCBCC@BCCBCCDGIHEGGDJNSX^fe`[VNLJGCCBAA@CBB@ACB?@A?ABAB[<GЖLC<><<:<<>>@><=<<>>===<<<>>@>>><5?B?=>?=AP$R`GB><<<>@>@BCC<@@@CCGJLLOX^bcc[VNHIGIHGGGBDDEGFGCCCBCCDDDBCCBGGB@BCECCI/;ГP>CCCCDGDDC?CFGFGBKRZ_ib^_UPOOFGHGGGFDGGDDCBAA@AAGCB=>>A>GA?@@A>@@>>@BAAJ*#JZG?@>==<=@@>@CCHLRZbZUMHD>C@><>9AA<=@=>@;;<=>@>BCDFDFGGJGNNMTVZZZa_gmlsАВГБB&mБА~ДБ~ВВЕДЕЖЕЙЙЙЙИКИЕЕИЗИЙЙЙИИЕДДААЖАЗББЙДДДВГy}НzБsp|risirfcpWedTjZ^nXgqfprj-iћђПkqrqloonllprrrlprmplklilhhhhhhhiliihhhhghgeheegieeedhgegfckfimosv|Вyurponnnrolje_XXUhiprrrrw{Е}{xtxuqqpprqqrrrqqqlollnlkkkimmokkmkgqfcgbc`\``aabbgg``b`_dcfgffgfigigffkb`?!<`ХВВДД}xrnkhllqwkhkjlfeb`eghkkghhfecefhfffbbeeeefhhhfjgjjhggihhmjlljjlhhjhffhojjjfghfhhlpmmhhfhhlorruzy|~ywКіџ £•®ЂІЂ≠≠ЃЃ≠ЂђђЂЂЂ®ђђђђ≠≠ѓѓѓЃЃЃђ≠∞ђђЃ≠∞≤≤±ѓѓ∞ґ∞ѓЃѓѓ≠ђ∞Ђђ®©•ШАH/'СЋЋЋЋЋЋћЌ≈∆∆≈ЅЂ^9688447777774646645=3276458511556535:46445579733514=634464464553846966899664244765553587555*75189:988888=@8uўбЪortrrrrrqr|urmЕ3*XЕwrwwxz|z|}zz|zww{zzw{zyuБYqi[[]YZ^[_Z[ZZcc^]_]\[XXYWYYWQTPRZ,JXMJHGFDCCDBDB@BDCABBBBBCFCBCGDIHMQW^ffaZSNLBDF<@A?BBBCCBABBB@?B>@CY0DВOB@>>><<<>>@><=<<<>====@B@@B@DNTZ\]WTNF@@:><<<<58;79<=<<<<@@<@@@<>>BEO*UqJCBB@>@@>@C@?AA@ACDDJKJOX\abbYRMGGDGGEECFGILV\bfbZZOMMMFHHDGDDDCCCCB=AB@ABBBB>AABAC@@@AB@ABBBBBBBM*'KaJCC@>>?@@ABBDAFMS]b\UOJGCBAA;A==<;<><>=::<<<<=><@<>>;8>=;A?ABFFBABJJBOVY\g<+orotqqrwuwz~АББДДВДГЕДВВДВЕЖЗЗИИБГГААЙАБГГБГЖДЖЕЕБЛГИВКААЙ|ВЖ}y{Вvxtw}mrpgln`5И уВzkmriljknlrrttrryrrqptpnrnjlnjjllhjikimhkigknlnrhhhiikhhihehirt{ЖВ~yrolmljjjhjff[QTM\ejlllnortuvvsrsqqrqrrqsqrrqrqnnrrqqlnoqqvqoommigggbgb`f`__`cgb``bcafegighiggkiijipil7!JgУДДКЙА{sqllnorwogkhlhhffjghmmhjhfmecefheecdffbdfbhfgigfefgkmedhfffffmjghfffhjjhhfhfhjflnnnmjhjmpqxwv{|А~zyНѓЁЋ¶ђ®ЂЂЂЂ©©ђђ©ЂЂЂ®ђЂђ≠ђ≠ѓ≠ђ≠ђЂђђЃЂ≠ЂЂѓЃ∞±≤∞∞ѓЃЃ®ЃЃЃЃђЃ∞ђ≠≠®ЂЬВJ/0ШЋЋЋЋЋЋЋћ∆»∆∆√ђZ78:9976779976666664755446466345555565264364346447555441346655578867<7889977745787547568645527256998766778?7r’„ЬeprrrrrrrrrsqkЙ2PЗАuxz~~z{~{{xtyw{www{tzyS qr][[Y[Y]Z[^[Zccb`_[[YXWWXYYWTTPUW/MrXJKHGHHGDDCFB@BCCCCACABCJCBFHDEGLRY_ic^XQKNHHC?A=;???BDBB>F+C|M@B?@@>>><<@>>=<=>=@@???@>AACDNSZ\[WTNHBB===<<;78;7;;78;;;<<<<>C><>ACH%RcK@BCBB@CBCBC@CEBDDDFJJMRW_a_^YTOLJGDDDGC@@@??ACBAA=<>@@AABABA>@@DDBCCBJ/%N^JFFCBCCCBDEEEBFRY`^^VRJGCBBBBAA>;<<=<<<<:<<<<;<;<8<;::;:;?=<<;<>>;A?=>@@@@>=>==>M/@pH<==@@>>><29<<<<<<>@AAAGMT\__ZTNICC@>>==;;8<8;;8;<;;<<<<<@<<>>HK%O^G@@>BB@@B@;B@@AACDDDJGMTZ_cbZYWOMMJGGDGHBCB@CCDEDABECDACDDGCCCC@CG=CFM*HfLGBFDDDDDGHHJGHJMLPXYbbb^ZZLLMJHHIIGDDCBDCC?B@=CC@B@>=ABA@AABC@AAABCA>@@A4JdC8GEBCCBBDEGGIHQY`b`YSLGCFB@CBAAA@>A@?>>>>><=;;;<89;<<;;<<=<<<;;<<==<9=><>40^E=ED;FIMNIPPTY]^ekkorrqpsqrruАА|{|||~А~{~АВГЕЕЖДЖДДДВЕЖГДББЕЖКЗЖЖЛПХСППЛЗЖДЙp5&:klotswuqtrrqjptttrtrrmnnpnppqrrnpqrrxrtwrorrrrqqpjnjpnnpollnnrt{ЙЛЛВ~xrplbjnjjgjg`VKJV_jffhiimlololnokhllinlnrnnnnnnmnknllmkkjjmllmlmjklhfgbeeeceegbccefffgfkljkromooqooujc;%@kПЖИЙЕА{tssirsszhghddfdefeeggfehfdcfchdefhgfhhfhhfjjllgjjhhcggfjhfhjhohggfnhfjhfe`eb_fhjliomkmlqrr{uszzzАВ{ТЄ№¬®∞®ЂђЂђЂђЃЃЃЃђђђЃ≠≠≠©≠ѓђ≠ђЃђђђѓђ≠ѓђђ≠ђѓ≠ѓ≤ЃЃЃЃЂђЂЂђЂ©ђ≠Ђ®•ЭyA$8£ЋЋЋЋЋЋћЌ∆∆∆∆√®]<77978962A9246555421344444;656469233535541324422292552234653343131346455568555597577664677555777878;87<<CBBAA@BB@BB@?D?@@H0=>>>@>><;<<<<<<<<<<:<>>>A@7IMT\^\YPLIEC??@>><<<<<><<>>=<<<<<@@>>?;=>>=>>>FCBDGGDHGGHJHLLPVX``b^WUMJJJHGGIIGGGFDDC@CDCDDBBC@BCBBBCBBCACCADDBAACD/I_HDEECECBBFCCHHHPY^g^XRL;HF?CKBBCDCBECBBAC@><><;<@><==C=<=?=<;H0CCB@B@BB>><=>><<>><>>A@@BJLS_ZYVPLHEBA<=<;<<;8;<8;=??=<<<<<>DM'ZnG=<===>@@@@BB@>@CCCDGKMORZ^\ZXPKJIGCDGDDCBB@@@?BABCEDDCDCBCEEFFGDFCECS,%NfMFFGGDGDGDGDGGGQNMPV\bcf`XRLJGJHIGGIDGHFBCA@ADGBB=BCDCFBBBBBBCBDCCCFCECCN/ MhMFGEACCCCFCEEGKPZ^_^XQKDGGCCFBABB@@A>@@BCA@<<=<<@?9>>=<;>>><>>>>@@@@@A@?>H5&AVECCAD<>AACFLMIISIQUUU]]]gjopqrsy~~y||{~|~~АВЕЕЖЗИКЛШХЬТРЛИЗНq-=ЗДБАБИГБЕ||}Б}yБ}xБ{ЕtУ|xyyЕyrvrtrpnfrlcrhjtfrqfwnpqnqrrwuvtt{АВ{zvvrtqpppmnmlgkWH9Qhkcffgikkmpooilikmhjkjhkjlnkmnjjjljjjlhjhllliihhjjljlmjjohgijjkkigjjmkhnjlnllmkmllpg^<.9~ШЖИЛЛЕ~xxsvyyzxrkkjhpijjkskkfgkkhhfdcfefddjffhjddffcdcbcgjgfdfgdffnhehhhjlgiljhhhhjjmmmomkljollrqrustvx}{uЭЈ„ЈІ≠ђђЂ®©І¶®©©ђђ≠≠ђђђ©ђђђ≠≠іђђ≠≠ђ©ђђђђЂђѓ≠∞∞∞ѓЃЃ≠ѓ≠≠ђ≠ѓ≠ЃЃЃђЩy?%O•ћЋЋЋћћЋћ∆»∆ƒ√Ђa9868888;997578866/1112577212213563444424223554314225545556444667<75354548698=61863554579797878;;;6:87655;@;ЖЏѕІetvrrtrurrruuyА#_С}xw{|~||||yyuuzzz{{xtИQ xpZ\^\^XYYY[[]^^_^]][]UXWSUSTTQNMO2PhNMLHGGGDHCBDFDDFC@DDGGCCGDDIIGKMRT\bki`XRKHGDDCCB@>>==>@>>@>>>B@@B>>@@BB>@>>>><>>>>@?DCDKLS]]\XQKJGCA>=9:<<<<<<8;<<<;;<><<><<7<@D$]p=@@=<=>@AAA>AA@CDDDGJKMQP^``^XUMLCBEDDDDCCC>>?>@BC@CCDDAABABBCCCBCCCBM2*PoM@ACDDHHJHHGFGJLLMSY^dgkeZUQLLLGJJJIGIGCABB@AA>B@@DEDBCBAA@@@BBCCCCGDFFCN2 OfJCEDBBDCDBDGGHNT^babZPNBHFEDFBCBCB@B<>@@>@?<>=>><;:<=<@9>>;<><>@>@BB@BBC@P0!>OGDABC>@B@@JCCGLOWZZUO?@A>>@B@@>:9BCAAB:BGCKKMQTUUXZ\]cekomoqusw{А~БВДИМХРЛЗЖКЗp1%9АМЛДИРЖЖЦДДЕЕЙДВПВ|АБА~rВБ}ГГББГЗДДБА~|||yuurttprpeerqmrrorqsrtvqrrrtvtttztrztwuXCAM}vllnjlppmpomllllikjmjjmmpqrnnhjhfffchhhghhjjhfbhhjhjlllrnhjinprrttwsolnjlnlmmkomlkkd8/6zР~ВИЗД|xtrtwuwtnhiihhgfjhlikiilijhfefhbbddhffmnffhhdffgllrhhdggmfffdeeggehehjhjhhhhhjjhjhjjjnlnqqssstuuzvr†Њ—ґҐ≠ђ≠ђ®Ђ©©ђ≠©≠ђ≠ѓ≠≠≠ђ≠≠∞≠ђђ≠©ђ©≠©©©©©ЂЂ≠≠≠ѓ≠ђ≠≠ђ≠≠≠≠≠ѓ≠≠≤Ђ•Ыu8$ YђЋЋЋЋЋЋЋЋ∆∆¬јј©b8455;99<;9559987426535634421233;<664775332144431335668664544345555455555669886664377297999969999:69999;8?>9@@@?@@>>>@<<<<@><@><<<><<><>>=DDBJPW\b^[ULGECC><;<><==:<<=<<@A@:@>@@@BBCGJPRS^`b`YRMLHFGGGGDDDC@@CBDB@BDCFDAABABBCCCCCCBAH3LiMCACCCDDGGGDAFGJJGRW\afbcZRRPMMJLJJJIGIDDDEEB>AB@=ID@ACBBB>@@BCCDEFCCDCCO2 MdF@CBCCCCDBCFIJOV\cbbYSPHHGHGFDEDDBBCCCDBCAB@A=>><<;>A?A?AA??<<@>@B><<>>@BH1&8]GEACJ@@@BCBDEMMPY^ZXOGDCCCCAA??9AAB>>=<>B?BA@BCBAC@CGEKMSSVXZ\acggkorx{Е}{}~Дg56mЕВВГЕЕДЕЕЖЖДДДЖЙЖИЖЖИЕЖЖЙЖЛВВЕЕЗДДЕВДЕЕБГББЕ}Е{}Б|yxsxwrqmrkhs[orjqprtrrrvztuXH8|Мtrqprtssrrropopprorllulqurmodlndhbdheefbcdggf^hfigkkkhgikooprr|||Гtploknnmponllliqm4&7zЖyАЖЖ~zxtstuxuskffgeeeeffhghggiegfhffb`cdd^cffghhfeeffghhhfjffflbjhfjghkhhljjljjkjkjhhfhfhhhjhmnnrpstsuzvjҐј„і•ђ©Ѓђ®©©©ђ≠©©®≠≠ђ≠ѓѓ≠≠ѓ≠ђ≠ђѓ≠ђђ≠Ђђ≠≠≠ђѓѓѓ∞≠ђ≠ђ≠∞≠ђѓђ≠ђђЃЂ©Чr8$ Zі»ЋЋ»»»Ћ»»Ћ»≈Ѕ≠c7358;99865725575334643344110244398886855545665334466884446443334433555;8446646864345-78888879978879997<;BB@ABBB@@@>@/>mIE@>><<@?>?><:>>@>><;=<<<=@CBMSZ^`\\SLDACB><<<><==<<<<5<=;;<<<<<<<<"a`BA=>@><>>ACDGGOSS\_`\VOKKIGCCBBBBCC@@CCGCAADDFDBACBBDDCFGCFECH4"HoKCCCCCDDDFGGFGFJHGMU\`b]^YSPOJIHJGGJ:GGGDCCECACC@>BCBACCGDCCCDECC@HDBCBLF5HpKECBBHCDFFDGGKMU\b`_YVOLJHLFD@HGCBCCDDC@BCB>A@>A===AA>>@BB@><<>@BCBB?A@@DF/7ZGAABBBACCCCFGNMQW]YUQLGDDFBBB??A=>==<>@<>@?>=9CBBBC=G/C]DD>=>@BBA@A?>;<<>>>==?>>@?@CGLSZ^^\YPJDBB>=<;<<<<<:::<8<9;<<><<<><<;H@!"^i>>=>><>@>BAACCA@ADGGGGLRS__\\XRJJGGDGAAA@@@>>@@@@BADBDFCACA@DCCGHBGECZ,PlLCCCBDFCFGIHJGGOLLHU^ce_^YVLKIFGIDFIBIGGGCAA@@AC?<@BC@AACCGGGBCCB@DDEBBBJ0*GgNHFCBOHIHJGHJMOVcccb[VPMJGGEDDGGCCDCCCB@@B@;@A@A=@AB@><@<>>@BCCCAABCM-;[LGCCCDCDCDDFFKNMX^ZXRMKGGFCBAAB=AA?BA<<==>>@@@>><><>=<<<<4<;<>>?=>BA=BA>>DKMMOQ2$2PZ^ckjjnrrxy{y||zА}{|ББДГДВВДДЖВДЕИЖЕЖЖЖЗЕДГЕГГЖББЕЕЕЖЖВВЗЖГУЖМСНЬМДПВАА{Т{qЙvВZXB+vЎПpZcdRof`ugjommmprquqrtoswroqrspqrooopolnollllilkriliinhfnpouЖМАurihggfdggfdgdfcdc`/,PZjmnsuuttrpqsxxsgkhgehf]dfhfgggfehihfgfegfcfdcgghghffjdffffffhhhfefefffhghjljjlllkkkkohkkmmjionnnnqrtuvxz}o≤ƒ÷≥®®®≠ЃЃЃѓ≠≠©©©©®ђђђђ®®®Ѓђ©ђ≠¶®ђ®ѓЂђ≠ђђђ≠ѓ≠∞ђ≠Ѓ≠ђ≠ђ≠≠ђ≠ѓ≠ЂҐ¶Рm5! rЇ» »ЋЋЋЋ»»»∆≈јђb<889889975689998656554214321442256462431255866645554454/4667997/75844336646779678744766667455513337669:8<@-ЙёўҐirrrtruttvwrtqv)fЙwvwxy{|~{{zzz{zwz{}}}{t{ЕM vmZU`_\ZZ[[]Z^`_b_Y][XXU\VVVUVUMPO%[kJJFCFCCBDDBFFFFCDFFFFDDDFIJIJGKJMSY^mg`YQMIGBABBBCCEFBBBBAC@@@@?>=G/C`DA:==@@>?==<<;;<>@@>>@@ACAADGMS]ac^YSDGBA>><=<<<<=::;;7;;::<<<<>><=;H>"_c>:;<<;D??@A>AA@@CCFGHHKRX_d^\YRNMKJGCCACBBAAAABBBAAC@ACBCACAAB@BDABC@T!#UdJE>ACDFFECGIJGDJJLQX]bg^_WVMJHGFGHHIGIGGDE@@B@@FB@@BB@AA@ADGGCDCBACFEBCCA,*IoBCCCAGFKJLCLLLOX`ffc^YPMMHGHGFGGCDDGGGGGCDA@A@>B>@B@@B>@<@CC@>BB@@@ADCACBF)?_MHCCBDCDDGDDGKQT[`\XSMJJHDFCBCC@ABC@@@>@?>@B@@>>@@<;@>=<;;;<;?<>7<9@<>A?A>EGJMMPSY[_bejpqp{xrsqД|{yw}z{~АВВДЕГДЕЕДЖЖЖЖВДЖЖМИИМЙЙЗЕДЕЖЖЖККЛФТФМГДВБ}wДААКГМЦmY8*$rДnvunloofifhghcklfkohrrrrsrrrswrususprssrrpppppompprplklfrtuyГЛМБxrpnljkmolgeggnfeif&+Lhhjjmpmoplllrsupdfgfelfcfffdddbfhhjcdjfegebb`eihhfghhjcffhhjjhkjjefffhhhgfhhgimlighjknkkkkiigjjlnjnjuuuvzВp∞≈–µ••І≠ЃЃЃђђ≠≠ђ≠ђ©≠≠ђ≠ЂЂ±≤ѓѓ≠±ђ®ђ©≤Ђ©ђ©ђ©©≠ђ≠≠ђ≠©©ђђђѓђ≠ѓ≠®§ІЙo/% sњ   ЋЋЋ»»»«∆ƒјђb>:7625985458998855855753555255557742742436686664434354435466785/55556464486777798546668768788645899:9:<;@E7Н÷”•ourvwu{vtwwwwuu%VЕ{vxwy{|{yzwwwwvwwz{z}zu|ЕO |f^Z`_`\]]]\]^``_^]]Y[YVZVZXTVSPR]%StJIHECFCBDBADABCB?CFFBDBDFGIGGHJIJRZ_ie^YRMJHDCCCDDCGAB@CCCD@@@@B@?E.EiHA=<@@;>@;<<;;;;<>><;?>?A>?CEKR[`aZXRKJ@>=<>@<;9;<;;;<;:<<<<<@><<<=>LH%Pk:<<==@<@@>>CABFFIMSZ_e_\ZTNMJGFDDDDDCBCCCBCB@?AACCGHCDCCDAABCCF@P#!RaJEBCBCBBB@CBE@>GHKPT[\b`\VRMLJHHGGHGGIDDDCCACBBGDA@BBCDCCCDGGCDIBBDEFCDGG%'I_E>CCCDDHJL>JLHQX^cc_\ZRMJHGJJCHHGGGGIIFFDDC@CACC@AC@CCDCC@BCCBDDCAAADDCB@H ?`MFCB@DCGGHGGGKSX^b\XSMJJGDEEBCE@@CCABB@BCCBDBB@@BA@>@>><7>A<;<><>=>>===<@>><3'55>@@AA=FGCJMMVZ`\^^\^bgfgggmkorrvx{Б~ДАВЗВДДВВДЕЕЗЗЛЗЙЛЗЗИИЗИЙКМФУЦУКЖЕГБВЖВБЕВ{xT3)FsБwy|yy||Вz|xu|mvvdpoPsl]lTii]qjktrtrmsuutrrsttxtsrrrrpprlsuw|ЕНИxrpomonpooeliioiei`)/Fxhnmppmnqprnrrzuqgcfccfcddfee`beggfacigggfeeb`eeefeffebdeefjkghhhffjhjjhhffigioliijgorkkkkimhhjlljlnquuuxjѓј”ґ£ІЂЂђ≠≠©©≠ђђ≠ђђ©ђђђђђ≠ѓѓ∞≠ѓѓ≠ђ≠≤ѓ≠ѓ≠ѓ±ѓѓѓѓ∞ѓѓ≠ђѓ≠≠ѓ≠ђЃЃЂ®¶Иh5" xј  « ЋЋ «»Ћ»∆ЅІa=;653545544233355566441.2444524754445554154886335343545568655433555544666686:9665464675796669635579998;5<>/П„№£ityxzwywvzwusrr/EДДvx|{{}{zzwvvvwwwuwwzxtzЕG z^^`^_`\\Y[[]^^^^^^\[[YXYUZYXYSRSV"OxJLJJEFDFDABBBACECBCBDBDADCCGDEIGIO[_le\XRMIDCCDCCAAB@B@CBB@@A@BCBAL-MoDB>@A>><;<<<<><<=>>=>=@BDKRY^\YVPGB===<<<<98;<<;<<:<:<:<<<><<<>@C>!'MZ@?<>===?=>@>>@<>DBBBFKOU\acaZXTMKGFDBBBAACAACBA@A>>?@CCDGDDGGDDCCEFGBY% RdHCCB?FCBFG@CGCCGGGORZ_a`^XRMMJJJJGEDDGGEECBA@AACCBB@@BFDCGCCDFGGFBBFDFFFD/'OfJBCBCDCCJLCHLMSYcec[VYQMHHGGG@FDCCEFDFJG?CC?A@ACA@BCEEDCBABCDCGADA@@ACCEB>&EmMD>EEDCIHLHHJLQW\_\ZXMLJEDFDCCCB@BAABB@BDGEDBB@>@@B@@@@@?>@A>A@@@@??BB?>=<=BACCABGJNSYXVR@KLLMK=RVNMWY^`bfqpqry{{ДГ~{АДЕВЕДДЙЗЗЖЖЖЗЙЛЛРСХШПЙЗЕЕДГЗЗЕЖБ}yS/"Jqz}Б}}Б|}А}|А}Е}Бyywytrtrprqlrmkkdegohjknr|{qrsyБvrrslrpt{ВА{wsqrnpmlromugirmiqY4/F~qprrrporrprrtzwqmhhgeehhhded^dghgfgfgghofeb``b`ebbb]edbeeeeebghjhhhfeffhhfjeigiehgjmokmjmkojjhjmjnnqrssv|gѓ≈”≥•ђЂЂЂ©ђЂђЂ©®ђђ©©©©ђђ©ђђђ≠≠ђ≠≠ђ≠ѓѓ≠≠≠≠ѓѓѓ≠ѓђђѓ≠¶≠≠≠∞ѓѓ≤ѓЂЂђМd;А¬   ЋЋЋЋ»∆»√√ј•d>;88532255545554455531001424220333512245224663225332447388433363555544489;99=763446566569836;96664777785;?.Н“ў£fuwtutwvtwwwtqx5;Й}{w|~~~~{{zxzxzz{z{w{{xyЕG !xe]``b_][YX]]`]]\[[Z[YXYXVXXWXUNSVM|LMKHEFFFECDBA?ACDCCCGDFDFCDDEGMILRZaicZXRLGDCCBAAAAB@B@B@><?@BE,RgHD=BA><@B@>@<>><==<@?@@B@@CEHKRYc_YVPGCA?><<;<;9=;;;:9:::<7?==;;<<<=A=!!Sd@B><<=@@<=@>@@@ACDCFHKSV\acg\YRLJDFFFAA@>AA@?>>@@>>>@BBCBCCFFCCACCFG=M,OjHGCCDBCCFHBGGFFGGITV_ae`_XPMPJHHJHEECEEECC@>BAA>ABBA?BBCABACDDC>DCDDC?FLL+SeJGFCCDBBHHDHLMSZggg[WXNJHHFGGFFCBBGFCCDCAC@@@?@>>?B@BB@BACCBCACACCBBBDCEGC#HtQHAFJHGJJJJHKMRZ`b_]XJMMHHHECEEECBB?@@BBDBDCBBBBB@@@@>@A@BBBABB>D@ACACDDBBDCCBB7/5AB@7CE?FFGDHLPVXWUMIHCCGGADGBCCGHIEDNNQPOQ\[Zeimqrttvxz{~ААВВДЖИЖЙКПУПЙИЕЗИИИЖЖЖЕЗАZ/!FDFFDFBA?BCDCCCBCCCGGHGGIJKMTZaie^ZRKJIDDCBBBBBCB>BB>BC,KaG@9==;<=<<<>=H==I=8==?BC@CDFJMX]`l\XQJDA@>><<@<9D;;::4<<<<<=<;<;<=<<<<=?=A@<<>CAABCGLLMV]acc^XQMLHGFGBA@@CC@>@>BB@AA=BBC>AAEFBAAFFFDBBB@?ACA>AACDCCAABCCF@DHC*Zr>FCCBCDFFC>JMORZceebZXPMKIGKKGGFCFGCCCDDCCBC@>A>>?B@BB@@ABCCCACCCBCCDFCCC>'MsNHEEGJFGFHJLMQX_ccb^ZONMLMLHHJGECFFCDCGCCACHCD@@BB>>>>>>>@AA=AB>H@@ACADDBBDBCB?3.5EEECGICJJJHKMVXZ[WOKIFCEDCDD=CCEEFGGDACCFGAGGILNSQJUZ[[]blgikqzzz|АДДЕИЗБДГГДЕЕЕГЙ^*&9АГЕДЖЗЛЕЕКГГЖДБВГГЕБББББuxЕ}yБxВЕ}ЖКЕАБywzrrrlolhrlljgfjfkhljoqoqqts{vvrr~tsuwtwS"?OГ}Бsvxsruqmrruywomgeeg`cfdaeedfcecegggeegebfeeggehhhfefeffefffohgkhggefefffffhjhefhkjhhfhhfjjhjhefhhhjnqvpr≠’÷•І®Ђ¶©ђ≠≠ђђ©©≠ђ©ѓЂЂѓЃ©ђ®®ђђѓ≠ѓЃ≠ѓ≠≠Ѓ≠≠Ђђђђ©ђ©≠≠ђђ©ђЃ∞ЃЃђ¶ЂЂД`0Дƒ   «   ∆≈∆∆≈¬¶_6286456>85/553355566331/144223/122555775456444342294356554444432322524440/46644444<643448864777669888788>E8Т—ЏЯozvuuuwu}wwwtq8<Иstvwwzxzuxxxxzwwww{{zwvu|Q ЕhZ^^b^\\\\^``cbba`]]][[YVUUXUURZfXmSNF=BDCCCCCDBADCBCCBBCACDFEFFGCGLUZafc^YRIIHGDCCAAACBCBCC@@BC@BB@CD/%OgHA><<9<<;:=>=B>>D>:<==AB<=BEGMSZ^e[XQHDA@<><;<<<@><<<7<<<<:=><>>@?>=C?##Te>@>>><=??A>>=ACAACCIJLKS\_b`_XOJHJHDDBBCCDCBBBB@CCCEACBCCADCDDBCFFCDBC*PjGCCCBBCCCFBFCCFGHIPV]jf^ZWPLIFHEHDDDCGG@DFDDC@A@AAAA@BCBACBCBBCC@BBCCCCAA*%`fHGE@@BCHHGCHJMPY`bb`ZQGIMGGKJIGFFDGCDDDDDDCB@??B?>@>BB@AAABCDBCDCCCCDDCBDB%%KmJIEEGHEFFGHGJMW`cb`[WPLKJLMFHHHGGKHHHDEFDDDHCFBCDC@B@CBCDCDB>A@@B@@ACACCDDCC@C<)*9EEGIIIBIKMLMOXY\]WOLKIHHHDDGDDEFFGIFFFFGGJGIFDFFHJCHJLJJKIQQRUXY\_eglqsutvsuwwwz|МpX"$7Д}|ДДДЕДДЖЖЗ}ЕЕЕЗЖЗИЖЖДДЕЕЕЕБГ}Б}БГБББ|}|||yzywyz{ysrrqvqnrlrrgraemRmh`miprn||qX2FЄѕЕrsuusyrrtuuЙumihdbfced``ddddbb`bcceccgdbfeege`febbefeffeffffhfhedeefhhhhhhghfjmllljhhjjhmhjkiigihjhjnlxmЂ ќ•Ю©Ђ¶©©©©®¶©©ђ≠ђ≠ђЃђђЂ©®Ђђђѓ≠ђђЂ≠ђ≠ѓ∞∞ѓѓђ≠ђ≠≠≠ѓ≠≠Ѓѓ∞∞Ѓ∞ђЂІ§Нc2З«« « ««  ∆∆∆∆Ѕ®\53:75477464343348764221,24235405219544554433343355944444464456654525255555663466414455768955886545488575?E;П„ёЩiuwwuuyy{yxurr8DМvvwxy}{|zz|zwuwzwz{{zxxuuU ~`Y]^]YZ\\Z[^bcbbb^[[[ZYUTTTSWWPV[YrRNH?FC@BFFFFFFKCDDDCDDCCC@BBCCHJMUY_c`^ZTFDCBBACBAAA?BCBBB@B@@CB@KH*.MfJD=<=:?=<>>@>@>>>B@>@@;<;<<<<99::<<::<>><=<>?@@>>><>@BBCCDECCIJLNS\dabZXOJHHDCBABCCCACABB@BBDDBAACBBC@@>@BBAHA&SbHC<<<@@=@B>@@>ABBABAEMRZddaYRJ@AAA@<;;;<<;;99:<;;<<<;<<<<<;@JM&hVC>>>?>>><>@B@BBADDGHJLOT\jc`[WQKKHDGCBCDCCBCAB@@@@BA@<@CDCCCB?=BBAAB@T#XcHGCDBCCGEGBDGGHHJOQX^`g]ZUOOMHGG@CLDGGGDCCB@B@@C@AA@>>@>@BBA@BBBAAAACCCB>((`dHFDCCDDHHHIMMMRZ^fb`XUOJKJIGFCGFCCFGDDCCC@@@@AAA==ABB@?AAABBBBBFCGDCCCFFHH&OaNJGHHHHKHKLLOOU[kgffXRMLHHJGHHHGGDDLDBGHDDHDCDCAA@BBBBCCCCDBABBBCFFHDCBCDHDEDI<2,BBBBFDCCGGCDBAHHKNMRUZeec_[VLJJDDGEEGCCCBCECBBC@BBA@BC!QdG><;;:>:=>><>>=@@>=@@BBBEMRZ_a_ZRLCDCA>==<<:<<<<<<><;@?<<>><=>>>@@#h[>>@>>A<<<<>>@BBAAADHGIPQZ_fc^XQLUHGMGFFFFCFBCB@@CBCCC@CCDCCC>A?BBCCB@J%JdJGDDBBBDBBBACBGHDLOWZ_d\WUPMJKGGDDGDCDDDCDCB@@BB@ACCC@@(.`^GCBBCCCDDGGIJNQX_ca^XUOJHHFFCBCGFFGGCDDDCAACBB?B=ABBBBBBBBBAABBFBDDCACGDGC$O\LHFJHEGFAHJMORU\bgf_YTMMLLJHJHKHHDGRDBDHHHJGFGDACACCBBCCCCD@@BCBCCCHGDCGHHGEFE;0.'%7IORRZ[aaccdfbhjllnqrruwzzz}{{ВА~ВББББГВЕДДБЖДЖД~ЕЕБДИЙДДЖГЕЖЙМРФНКДВ}|}v||y|}~ГnВВw~O*1\Ґ°Йrxwxuurtuwu}rdb`[^``^___a`^c`]_cbeab__]^````ebefc^bbbeb`ehegejfgfcekegffeffhdbhfffdejfddbbhfgcgggjljlnrx°ўЋђђЂЂ®ђ©≠©ѓ©ђ©©ђ©ђЂ©ђђђђ©ђђ©ђЃЃЃ≠≠ђђЃЃ≠≠≠≠ѓ≠ѓђђ≠≠≠≠Ѓ∞ЃђЃЃЂІ•БY/Й««∆««ЋћћЋ≈∆≈≈Ѕ¶d4359599745433465545543664736565523526664464655557885577444346446434222522213344954/555556976766788687<55BFDEBEECCCBCACBCCABDOSaCA=><;><>=<9<<<=>=>@@BACEMPY_\ZUOJBA@<<=>=>;<<=<<<>>>@>=><<><><<@C!`T@<@??A><>>@@BCDDCADHGJKPZ_b^\VNLJHFDCCFBCBCABDBCDCCDDDCAAGGG@CDCDFFDAG'GlHEDDBBCDDCB?BBDHHJNUZ^^^ZSMJJJGHGDDCCCACACCB@>>C@B?BEBICCAACCCBBBAB>CFCA>*,PYFGFCCCCCDGFIJMQW_b_ZWRMKGDDFDCFFIGGDBCDDBAABABBGABCCDBBABBBCCFCCDHGDDGHFD<%'NZJIGKGGHDDFHJLPWZ`db]XSMKIHHGHIGGJFGGDDGIGJGGFIGEGDIECDDDBCC>DDGCDCCGHDDHHFGFFK9/*7MJJIJGDJNNMSV^^_`ZWRPOMMMJJLJLLLLJJINNKMNMJMMKLBHIGFGGIGGGGHFHFGHHHGHHBGJIJJJKHCJLA:''4FJMMRRUWUUUWMNUWWW\^^^bbfjlllsvsvyz}{{~~АГБГБГА|АГ|ГГЕЕДЕДГЖИЛНТУНЗЗД~ББ}}}}x}|vuL&8aЧР|yy||yxyxx}Бlab`^bd^_bcb``^f`_ccbb``^`]``^`^``b```]^_e`beeegeddeeaccdgfgeecgfjjjgigckgdhjfhheeiiiqllllryЯё ••Іђ®©®©¶ђ®®І©©®®ІІ®©Ђ©©ђђ≠ђђђЃђ≠ђђ≠≠≠≤ђђ∞±±±ѓ≠≠∞±±≤≤ЃЃЂЂЃ®БY,З « ЋЋЋћћЋ∆»∆≈¬¶`5569699645433668434313443332353434432441;8/6455558856764343344445747555486844669653655344764763787788<77>?5А№„Эqnvtwzzxxvuws~r+JНzuyz}}}}zzz{z{wuwvwwzxuw}H  ВbYY[]][YYZ\\`eadb^^]YXUXWTWSQTQTZ]nRKHHHHIHGECC=HFGCC@@>BCCDBDCCIMMOX[`dg_SOKGDB>BDDB=@BCCBBB=CC@A@AEH!MvB>=?A?A>@?=<@>>==@@BB@BBCCDGJMR\_\ZTODB@<:=;<<<;<<<::;<<<<==>=<><;<<@?#`XB>B@@>A<@@@AABDFDDGHCKPV\gc^\WNMJJHCDDCFCBA?ABCCB@AB?DD@ADCDACCACDEDFX G^LHFDCDGGHFCBFFHJLLPZ_`^\aULJJHGGDCDCDCB@@BBB@>>??@AA@;C@DA@CBBAACACCCFCM<#0YgGFGFFGDGGHIMJLRX_`^ZWPHLHGDDDCFFGFCA@ACDDA?AABC@>AAAGDB?BABCCDBBDGGGGJIHK<%RaJGJNIIJHGHKIMRW_gfa^WPMMIKHGGIIMIFCFDCGGBGIIFGGEGCFBBDJDBDDCDGGFFFFIKIJLHDIGHL8-*7MKKKPGFQNNQUV_``_ZUSPOMMMKLMLKJJJLJJMNKMNKIKKLNKLKJJHHJIKKKKKNKMLLLHKJJMJJJJDKHHKIA7%*5CGPPSTVUVSPPMCJJMMNQK>FLRMQYWVZZ\cffgiorvyy{y}|{|{|~ВАДЕГГВДЕИЛСХЦНКД~ДДДЖВБГБББz@"D\~y~~А}||||}toca```b`_bcec_bfccecc``^^^]`c^``^`h``c`^^cb`eeded^eedccdfefdeccceedeciggeegefhjjhfgeajjnrsq|†ёћђђђ±Ђђ≠ђ©©©Ђђ©©®®®¶ђ®®ђ®®ђђ≠ђђ≠≠≠ђ≠ѓ≠≠Јђ≠ѓѓѓѓѓђ≠∞±±±≤ЃЃЃЃ®©ЗZ'$ЙЋ«∆«»ЋЋ  ≈∆≈√≈®^558966833433476:4461184.433213344344/24/42/4355545533562344443461545555598866636666856884668989;57;98886A@DCDCACA>@@BBG""NbC<;?@=?@?===>==?ABCCCGDBBBEJKMTaa_ZRLDECA:==<<<8:;<;<<<;;<<===:=<9<<><"ZOB@@AA@CDDGJJGLRX_jkb^XNLJHFGKDAJDDDBCCDDB=ABBA@@@CCCAACCADDDGI!Oj?@BCB>>B@CAAAAAA>B>BBBBCCC'gYBEEDCG?GGHJJHLRZbc^ZWPJHLJHGFCIGJFC>@AD>?CA>@@B@B?A??BBCDGCABGCGK<"YeKGJGFJJJJIMMOSW_fffbWQMMMLLJHKHKCIGGGFGGGCGGFIFBECACDDHDBDCADCBCBDCCGGKHFEJHJQ9(,5VIJJMHJQPPVWX_bbf`UUSSNNMNNOMLKJLMMJNPJJMIIJIMKKKLLJJJGGJKIKMKMVKLMJLMIMLLPMKKMLNMC9%/>>>=<===?A@@@B@BCBEKJMR__^YQOJGDCBB=;@<<<<<=><<<<>><@@=A@;>JD;!!hPA@BB>=<:>>AA@BBDFFGGHLQX^egbZWMJJHFGIC@EBCDFFECCB>A@CCDAC@CCADDD?=DDDH%P`JCA@CCBEGDDDFGGJJMSW^Z_ZUUOJHHGEFGDGGDGHGGCCDCACBBC@BCBACCDADGCBAABCBBCAE!hU@BBBCC=DCDDJDHQX^a^ZRO>HIHHIJFIFDDGBDGFCCBBABCGB@KBAACDCC>@@@A=====?>>@@@=BCDEEGJSY__YRLIC>=>><<=7;<;<<<<<<<>@>A?=A>>>CGC#`MC@@@>>>>>@>AACCCDDDGHMQY_cb]YQNLKGDGFBCDBBDDJCBCA@@>CAC@A@CDDCFFA>FDJL(SbJDC@CBCEGFGCDDHJLNRZ^c^Z[SOJDGDFCCCECCCDDCBBBBACCC@@BCCACCCCGGGFDEIFCDCDC#gVBCBBCBACCDGJKMRX^a\\VPDHHDFHHAFBAACBCFF?@@@@BAB??A@CDDDCC@BCBCDDCDGGFD6MS4!![VHHGGCCJHKIIKMSY^b__]VSMLJIHHHGFFFGKKIGGCDFGGGGGFGCEGGHFDHGDCGGDDEGKSIKKKIKKKKE9,%:SMKLNNNMNKNQY\cfd^ZVRPNGOOON>MOOMNIJNNMMMNNNNLNLMKKLKKJLLMMMMMMMKMKMNLPLPPQPPPPMKII9'%>LPPRXZ\\a_ZTRQMMPMKJJGJJHHFGHJFFCCFKJIHHDEECEEGDGEFJGFAGFGNPQTUY`dbjhgklkqssuxzАwАs5*IdyzГДДГДДЗЗЗЗЖГ}hccb``^``b``][]_^]^]]``]^^[^```__cc`^`\\^abbcb^^`be`ddc^^eb`ebbbbeebheeehfhfgifgfebedhhjssmВ¶÷љ•Ђ®Ђ©©©©©©©©ЂЂІІ©©®©®ІЂЂЂ≠≠ђ®≠ѓђ≠≠≠≠≠ѓ≤ѓѓ≠≠ѓ∞ѓЃЃ∞ѓѓѓѓ≠ѓ≠©®†ЙH# >Ь≈∆≈≈∆»»»«∆ »»«£X855224331334656744664441133343411123443534443132355455775335888854778:443444698926676431;5577<7855577;88??<№–§xrxxzy|zzxz|w~x'^Е|u{}~}}z|zxvytwwvwxwzstЙ< ${\\^b_^][[^][_aa`__[ZYXY[XTNPTWSX^h_OJBACFFGECCCAGCCBCBFCBDCFDIGEEHHMS[dec^VRNHFBCBCGCHADAAJ,"?cCABCABC@ACA>>=<<>>CBBB=BCGDEJMUZ_\ZRLICA>=>>><;:=<<<;<<<;<<<><;;:>>@@BCBAA@BCFEECFGJDMRY`cc^YOLLIGGDBCCBA@CADCCCA>><>>@>@ACCBABF@BFDLK%XbCDCDCBBCGGGDGDHJLQVZ`l_\^UOJGHGGEEFCADCDCBBBB>>BB@B@@@A@ABCBCDDDFFIFCDBCB(eaCCCCGFCFGHKLMLTZ_e\ZTOLJHCDGB?CCCCABDFC?B?>C@@@=>@@?BB@@@;@BBCBEDDGGDFBEH5)][IJIKGFKLHIIMRVXbgb_\VRMLJJGHGGGFCGGKGFHEBEFGIHGGFBCEEFEGGGCCFGGGGHKKMKMNKMNMKL;,#>WPKMPNPPNMPTY_ckd^ZWQQPOPOOOJMMNMNGIPPNNQQMNPOOOLLJMKMKPJMNNNNNPNPNPPNORQQPQPPQMMHN5&%C?/#=_BAAD@CBB@>><=>5=@BCBCBADCHCFJOY_a_\XLDDB@>@@@>@<<:<;<<<;;=>=<<<<<<<"iT<9?@?C=BDABCCFGJFLSWamgaZUOMLGGHFGGCCCDDDCCDCAA>@@@@@CAACBCDBACFLG&!`f@CCGCDDFDDGBDDHJLQVZ`b]\ZSOJJJJJHHGDDFGABCC@@>>BB>@?@A>>?CDCC@BBBCDDAA@J>#$fPDCB?FCCFGFJJMKUZ__ZYVQLJOGDHCCCCHDGDFFFCBABF@>A@@B@>@@@CCCBCCCACDDCBF2&aRFEHJGIJHCHJOTVZ`debZVQMJIJIIIJIIIIIKFGKIGJGGHGGGFCBFFCFHDDDCCFGFGGDCKIKMKIKMFH7)"AVJKMMMPPMNSVZagmieZZUUTROOOONNOMMNQMPPMNOONNNMOOMLJMMKMSGINMMKNPNNNPSQRSNSSQQPQNMLI4%#=WNTWZ\gb``ZVUSQPMMLLKLOIHJJKKJGKKJIGIGGHFGGGFCADCC@IJDCCA;BC?EAA?B>>=>A<<>==BC@BEFKDGJOY___\VMGIC@@B@@>><<:<<<<<;<@@>>>=>>%jMA@=?>B@ACBFBCFFFHLRU]dbaYVMKJGDGFGGBFDBDDCCGCGDC@CDGGDCDFDHHKF?FGC%ic@>BBCCC@CBCDDDDDG@'(bRECBCFFFCFCDMNPUYa_]ZUOLLLDDGDDCDGGGDFCFECBAB>?BBCCBBBCFC@>@==BBBBBFFDJJLY_daZUMGB====<=>=<<9<<>>>=>>>@@>B>G<&oMDA<@>>?AAB@BECCBFFGFHKSX^cd`ZSLLJGDFFFD@BCA@CDDHCCCA@CCCDCCDFGHGFEDCPD%)ogCFFDDDGGGEDCGEIJLNRZb`]YVTOJHCDHDDGDFGC@@BA@@>BB@@A@AA>@@;@CCBBBABDFFDDFA'.^WFFCBCCIFFFFKMQXZ_d\WQONLJHCCGDGDCCCCCCBCCCBB<>?ABA>ACC@BCBAFCCFEFFHGHJIDC5+YWGBHGIGIFEHJMPSV_c_^ZVSOJGJKGIGIIHFCGFFGGGGFFDDDGC>DCDGFCFCCGDFFGGJHHGHHHHHHICD7!'>QNKNOONQTPSRZbcgffZUQSQTQMNOPOOMOPPQPQQQQPPPPMPOMMMNNMPPPPNMPPPMMQPSSSQSYVVRPSPPSPF4#.IZQVZZ^a``][RQSQPNYQPPPQQQOMHLOJNNLNPNNMMKMLJGJJJJHFFBBB>ABCACBBCA??B@@BCBB@@BBBBB>ED5$=WUXYYYOEMMMIPMbfa^^_^^`]^^]][][][Z_c^V```^^[][[]_]^\[`\\^`]`]^]^^]``bc__baeccbbbdhh`c`^``eeggeececeedfdemuoХ∞ЁЇ®Ѓ≠ђђђ≠®©≠≠≠≠І©ЂђЂ©®©©ђ©ІЂЂЂђЂђ≠ђ§©ђ≠ѓ∞ѓѓ≤Ѓѓ≠ЃѓЃЃЃ≠ѓѓѓ∞ѓЂ≠ЫЖ< ^≤∆»»≈∆»Ћ»»≈∆∆≈ј†V5896898414334498.452241133131133222224/24436444334436933555775414348888655556668697346743555556676=9779;@?5Хё”©lzА~|||{{}z{Ж%[Пux}}~А~}z{{zwxvvwwzwwurlАC waZ__^^^\[YZ^^^]^`[]]]YYTXXWXWUQPRdfNNAGGGDC@ACFGHIFHLGDFGGFEEGDDPKKRYahga`\VNNLKJJEABCFD=@ACCGDBBDDCB?''MfB=??@@ABABB?@?>@@>=ABCBCEHFJKQY_d^ZVOIC?>==<=@>==?<9<<=<;<9<>=<>A@A@@@HGDCGGIGMOSY_ffbZUQMKGFFCCCBBBA@CDDA@@A@>AB@CDCCICFEDBB?JD#ug5JGGFDDGIHFGGGJQLMV]ffb]VRNNJGHHHGHHGE@ABBB@A>BC@@>@?==AB;@BB@ABADCCBBBCD5]XJECBCCFFCFFINTY\gc\XRPMLLJGCDFGDCDGFBCBCFBB><@A>CB?A@@?>>??ACBCBBBDGDHIF>4%.Q`GGKKKKMGGJMMRVZaca_ZUSOLJMKINGBHGEDCCCFFFEFFBBBAB>CDDCCCCCDDONMLJJJMMKJMKKKJEFCADCFEDDFECFEBBEEEEJFFECECEHCBCD3$DYTWZXWMGICECIEYe_\^Z[^]^^]]][Z[[[[^^^]\`_]]]b]]^`^]]^d]]^]Xhcc^b_[^]]__]^^```_^``ed]]]]^^bdecceegeeeefefoonЩіёЇ®ђЂ≠ѓѓ≠©ђ≠ђ©ђ©ђ≠ѓ≠≠ђ©ђ≠ђЂЂ≠≠Ѓђђђђ©©©≠≠≠ЃЃѓЃѓѓ≠≠ѓ≠≠ѓѓ≠ѓ≠≠І®ЪГC aґ∆«∆≈∆»»»»¬≈≈ƒј°W697666//46454466234213/13453566432125:+155343431133336223315344342665864335:41686644466555544555556777:9B@6Цё„¶nЕВАВ~~~y{zzЙ'[Еwy|zy|y{{}zwvvvtvvwwtrru|M  !xd^caaa__]YY]`^`aa_c^YXYTWXWWWUSPKc`LJCDDDCAACDBDCB?CF?CDDDCBCEGIJJLQW`eeb`ZVNMJJJGGEGC>BCCCCCGDCCCCBA?-#Zj>?A?><@@@@>>@@<<>===>@BCEGDGJQX_e\[VQJGA??=<>B>=@@<9?<9=<<<=A>>><<@A@CBCDDGKORP`dba[VRMKGGGFCCCBA?ABDBBAACAACCACDCCIADDCA@>LC'vc@LGFCDCAFEEEFFJLLOUfda_[WMMMMHBDDJHDEC@DDB@?ABDDBABBBABFJ7AACBCBBCBBBAA>;"5aXHFDBBCBFFGACJRX\f^]XROKKJHDDCCFDDDFGCBCCCFFD@CE@>=BBBBA>@DHDDDCA/#*NZHFFGBISIIGKLPV[ac``ZVQOLJMKKMKCGGEFFFGGFGGIGFCCACCDDDCCCDGCD@@@FCFHGGGHJJHCEID5*BKKKPPMMMOPUXZ`ghf_ZWSPPVVUSVSSSQPPMNNOMOPSPPOOPMMUMMJLOONOONOQPNNQQSRSRURVRYQSSSRML4*5BZVWY\behgb]ZXUUSQQQQMPQPPOMMPNINOMOJLJJKHLLJIFGGGIGDCCECECCCEDFGGCEGHJJLJIJJKGHJEGFI,.Hd[[]\\PLKFHKIQ^na\^ZZ[Z[][[\ZZXZYZ]Z[^Z[Z[[[_^]][[\^\]^]^]\^``c`^^]]^^``c_^bbb`b`fd^^`]^```a[bccee`beeegomnЩЄЁґ®ЂІЂђђ≠®ђђІ©©©ђ≠≠≠≠ђ®©≠≠ђ≠≠≠≠ЃЃ≠ђђ≠≠≠∞ѓ∞∞ѓ∞∞∞ѓѓ∞ѓ∞∞ѓѓ∞≠ђЂҐХА> lЇ≈∆∆≈«««»»ƒ≈∆≈ј°T997546//31242233530301+1=24/348643224515411346433973463342253331216436426436326464334664254344555457795;CC7ЦЏЎ§sЖВАВВВВВ~~zyЖ-$_П|В~||}{{z}zwvvsssvvttqqtyN  "wb]___^[[]ZZ]^`bcb__^ZYXTXXTTWWUXVghPKCFFCBAACDDCBA?BB?CCC@ECBCCEJMMRX[ed`\YTLJIGIIJIIGDFDHHHHGGDIFGECG))f^G5BA@>>AA<<<===@BCDGFECHOS\_ZYUPKDA@A>=>B>=@>>=<==<>@BBH<%rIA?A?>@BBA>???BB@A@ACACDGGGGEG@DDCABBFD't`CJGGDEDCEGEEDFJJMOV__b\ZVMKHHFAGDJGCCC2DC<>B@@BDCBCBBABBE>CBCACDCGGGCDDA<(8^VJEFCGFCFGFCFJPW[g^_RPLHHGDBCBDDGDDCGDBCCCFCCB>B>B@@@?CB@B@CECFDDB@DDGFGCE0"'XVFCDFCFIGGIJKORZ_``]ZWRPMJMKK9GDDFFIGFIGGIIIIGGGCGCGDCCCDGHDDC@$.bdDACCBBABBBCACB>=@>>@BA>?=:=7==5;?@A????>@BC?>.qM?A@>@ABBCCAACCGIDFHHKORS^d`[WSNNIIDEBDDDAAA>A>>AA@@>ACDDCDCGDBBBACDCII-j]HKHJJJIHGHIFCFKKMRY_ed`YUPJHJGGGCDDCBB=AB=>B@?@@BBAABBBBBBBBCCABC-8iUIFDFFFDGHJGHMQWWbb_WOMJJGCDFCCFGCGDCCBBBBB@>B<>>>?>>26IUVW^cfb``_^ZYWPVVVTSQQPPOMPOPPMOPOPOPPPOPPNMLKKLJIGHHGDHGHHFFECCEEFEADGEGHJHJHHJMJKN"0Jbb___[ZTMMMOPHrqZ_\XZZZ[^]]]V]]]ZZ[\\\ZZZZ[]]^^]Z[[]Z[][[[\]]Z][[^]][]][]_^^`\^`^_^```^^`^afbbeecbc`eeefhmpШЅџ±¶ЃЂ≠≠ђђђђђ®©ђ©©ђ©©©¶¶®®©©ђ≠ЂЂ©ђђ≠Ђђ≠≠≠∞∞ѓѓѓѓѓѓ∞∞∞ѓѓѓѓѓѓЃІђСu9 zј∆»∆»»««»«≈∆≈∆√°Q97867:9/643231353651/2444235311131331233313111321223132102234343164464255436666376646313447754554?99<;;=@;<Э“—£tВГГЕЖВВАБАВvВ5!j|z~~~~~~}{}|zzywsvwwyxvtuvF#Вc[]`a^_^[][`_`a_][ZYZXUUVTWTZWT^WkkRLGEDABA@BBCDCBCCCCFCFFFFCFIGDGJMR[`ff\XQOMKFHHGCDDBDDGGFFGBEEABBD?$*]ZCBBB@@@CBBBBAB??CDBA>ACDGGIKRSU_l[XSLHHBBA@?CBB=B><==:>>@>=>>=@@>@=4jM?@@>>?BA@DCABBGGGIIHKLVZaibZZSPNKJCDFGHDCCC?A>=AAAA@AC@ACDBCCB@ABCCCSF%aUCKGHGHDHG@HIHJJMMRY_ga_ZVOJLMJJIDCCCBDC=>ABA@AB@AB>>?ABBBB@CFEA@BD<>>>@>>=>@>><>CABCCCDDDGBBGC2(SOGJECFIJGGJJORW_fkf`ZPPMLMJJGGIGJJHJJJDBDDEBFFGDDA?@@@@CCBBBCCFD?GGGHHHGGGIGNG>6!)NRMMMJLOSPSRXZadfk^TSPMLKKNQPNNNNKNNMMMMMLMQPPPOPNPMIKMOMNMMLMPPNMNQUTUUWUSUUUVSVUVI<,4GSTY^ac`bb__\\WVVWVVUQQQOOMMOPSOOMMOMPOOMNPNLHKIIJJEGHGGJGIIGGGFEGFGGCEIGHLJJLJLLMJJP5Je``a__ZUSNMMOMds\\YVVYWZ[\Z[Z[[[ZZZ\[[Y[[\][[]]^[[]]]]^][]]_^]^]]]^`]]`]^^^^]^``__]^^]^`^]`e]]`a_aa_aeehjokЩ√Џ®•≠≠≠≠≠ђђ©ђђђ©®®ЂЃђђ©®©Ђђ©ђ≤≠ѓѓѓѓЂЂЂђѓ≠±∞ѓѓ≠ђ≠≠≠ѓ≠≠ЃђЃђЃЃІІП3}Ѕ≈∆∆∆»»»∆«≈≈≈≈√†P4681464234336536825322388546484343453322334112321234333221131061143332113246646336634314668584588<;;;9:=C;<ЫЎ÷ЃzЗЙЗЗЗЖЕЕВВГ||Б5 kЕААВАА~}}~|||wtptttwvxtqxF#АaY^^^^^^_`]abacea_^ZZZXWYXZXXUWaUg`PKGCBBCDA?ABACCBCC@ACCFFFDGDFIHHMR\akb^[UMMMJLKJIJGFGGIGGGDCDHBCCC@$'WXDBBB=?>CACCCBA?ACBB@A>DDC==?B@<<=@><=>>A@>?>>B<7bOB@B><>@@@B@@@AADFIKGHISZ_gb^\NPMKJHGGGHBDDCCD@@CCCAAA@>@CCDGDCAB>DCAOD#i[BFAAAGDDDACHIIIJLOVX`_ZYUGLKKJKHFDDCCCA>ACCCACBBAC@>@@BBBBADCFDDBCDBBCFC2"0nMFDDAABACGGJLMQZ`ccbYUOMCHJHGIGDDGGDCBDGCDBB@C>BBAA<>=>A>CABCCECCCCCDDDCGE, (YPIKFDDHHGGHHLRY`bgb_ZROLKLJJHGHGMHHGJJGDDGFFGGFGBDBCCBADDCCBCCCACGGGGHJGGDGGGF>4)IIJNKJJOPOSRZ^cgge^WSPLPMOQPPQQPQMPPNQMQOMNPPQWPPMPKMMNMNSMMLLOOMMMQTRRPSSUVSSSVUSOO/)/OTW\__fggmfd\ZYYZXVZWSSXUSSOOSSSSOMOMOLPMMQQMKGIGIIEGHGHHHIGEGCCBDGFHJGJIILJJLJJKMMHS"5Mecbee_YVSPNQPOjo\[YXWZYY[XVXXXZ[Z[X[\XXZZZYYZZ[[[]]]]]]]][]^[]][][^^]^`]]^^`^_bbaab`]]^`bb^_]]^__aa_abegkrbЪ«ЎІЯђ®®©©®©ђ®ђ©©¶®©ђђђ©®©®®ђђ≠≠≠ѓ≠ѓЃЂ≠≠≠≠±±∞±ѓ≠∞∞ѓ±∞±±ЃѓЃђђѓ¶ФБ5√≈∆∆≈∆» Ћ ≈∆≈≈√°M53542433342223559/35533464444543043333324314336434464443386623A2343/63113344535246446333444273358798987;A9@Щ÷ёЃxБМЙМЙЙЙИКЗЖДЖ2'vФВЕЕГЙЕ~||xtvvsttttsuzB "}_Z`]]Z[Z[___bacf^^\ZZZZYYYYX[XW`W!ecSNIEECCCAABCCFCBCCAABAFCFDBCCFFIMQZ^c`\XRMLMLKIIJGHIJJGGJJFDCFDGDCC%`ZGDCD=;@@AA@>@>><=ACACCCCA@A@@CCDGDGDDAADDBGG!k_GFDDDFCDFDCGGIIMMRW]___ZTOLHFDCDGGDDAB?BB@@B@@<8=B><@@?A@AACCDCDCFGFFGHA67dJFDFBA>ADGGJLMRY`cb^XPMIDGJGGGFDDGGDCADD<@@A@>@CBCBBCCCFFGGHDCDCGGPA1".ZNKIHGGHHDHJKMRX^bkb]XRRNKGIJIEGFPGEFHJHGAGHFHFCDFECBDDDADGDCDEBFFFGFDFGHJJIJID<2*HHHKOHJMMMLWZZbdgdZSOMFPRSPNNPQQQQQPPVPPQPPQPPVRQMQMNNPNNYPPOMMMNQPQSPPPPSPSOSXVSVMM*".UQXZaaffciebZYYYZYVWUUUUSSSPSSSMOTSSSSORQQPNMLIJJJJJJJGGGHJECGCBCCGHGHIJJJJJJMHJLLNHQ&/L_ccee`XVSPQPSWio]ZZXVZYX[XZZZXZXZ[Z[[ZVXZYXVZXZZZ\Z\[][XZYZ[[[[[]]][^][`b[]]cbbc^___^c`^a`^^^`^`bccbebegksbЬ ’ђ£≠Ђ®®©©ђђ®®¶®®¶©ІЂ©®¶®¶®ђђђђђ≠ѓіЃ≠≠≠Ѓ≠∞∞ѓ±ѓѓѓ≠≠ѓ∞∞∞≤±ѓѓЃЃђХy>Зƒ≈∆∆∆»ЋЋЋ ≈≈ƒ≈√£V54533334333701368351543131131231/32252212139434323464454698877:4244274154555459446449466446:74468643677A<==?>?>@AA?A>>=A>@<>>>??."@jP<@<<@>BB?=A@=>@BBACCCCBCFCCCCC9=B>>>@@><>B@@?CCCCCCFFFDACDDFHG1"5gSMIHJHHKGKKMQTY^eec]ZYQNMGGIHGGEGIEGGHDCCHHDCDACDCD@CDGCADDCDCCGGFGGEGHJMKIKHH>0!(LJLMSMLOOOUWZ^dcceZVQMMPQVPPNQPPMNNPNNNPNMNPKPQQPLPLLPLPPPPQMMNPQUUTVVSSSQTUOUVPVZTP(#,ZUZ\acffigf`Y\XWYWVVUWUUSPQPPPSSPSTPPPPPKPPOONNLLJJJHFGJHLKGILGEFGHJHHJLNLLNMKJMMMTJK#*Gkdbab^VUSPOOVWqhZYZXVXZXZTVVVYVXZZ[[Z[XVXZ[Z[\\[[\\^_^[Z[a\[[Z]][^^[[^^__][]^]]`]a`]]bb_]b_a^``^`cbbe`beankЬћ—®І≠≠≠©ђђ≠ђ©®®©©©ђ®©©©®ђ®¶ђђђђ≠≠ѓѓЂЂ≠≠ЃЃ≠ѓ≠≠ѓѓ∞ѓђ∞ѓѓѓ±±ѓѓ∞•©Нl;Жƒ≈≈∆∆∆∆∆»»≈∆≈∆ƒ£U3552011331154545554154434112/023243253/2200330111331224519/47754264664355555436635448888643;969;8722979CFHFGCGLLMRU\cfffZUPOMKLKKHKIJJLKIDIGGFEDDEHJ'wU@CA@CBDD?@=@BAABDA:B@>?AB>>=B<>D<<=>D0@]M<@@ABCB@@C?ACCCCHHIILRX\ai`ZXOONMJJGGGCDDDFDFDCC?A@B@CB@BBAA?@<58hFA?CBBAABFHGJMKX]ffaZVPMLJGGGCCDCDIEGGEFDDC=B>C?@@><@B@>@?CB@ABCCFFBCDCCB<2 7]LIAIHBGHHJKIPVY_cee_ZUQPNKKGGIJHFIIJJLHHHGDGDDCDCAGGDDDDCBCDGBBBFCCGEFGKKGIIHH>-'MHLKVNLNMPUWZ^hffe`ZVUPOPWPOLMNPNPOPQPPPQQQRQPPPMMMKLMMNNMNPMMNNPQPQSTSSSSUVUVXSSVSM(%/^[Z\_aefogdb]]ZZYVVVUVUUSRQTTPRSSPPPOPPPLNPPOOMMLLJIGFHHCHGGIJGGHHDHJLMONOPPPNNPPRRMH"%H{fdcc`TTPSOSQVfgXVVVUXZZZQSUVYVZZZZ]ZYVXZY[[[[\[ZZ[\\[][_c^\[]]]^]][[\\^\]]]^\[^^ga[[^^_`[[[\Z]][^^^b``djsiЭћ–Ґ≠ЂЂ≠ђђђЂЂЂ®¶®®ђђ©ђ≠≠ђ≠≠®ѓ≠≠≠∞ѓ∞±≠≠ѓѓЃ±ђ≠ѓ≠ѓѓ∞ѓђ∞∞ѓѓѓѓѓѓЃ§¶Л^9З≈≈∆∆≈≈∆»««ƒ≈ƒ¬Ѕ•T5552220121454441044254434211004435545315522572113344533524.65345373244237325568556116648642697:<5555777:A99ЬЏЎіЛТТСТТРНПППЙЕЕЛ&ЫЙДКИИККЕЗГВВВВ~|~|~~}yzzГD1x^]]^[W^^[\Z^`aabb[[YUX\\ZWPSQPRjN ykPLIECAACCBBBCBC@ACBCA=CCCCF=FGHKOUYfccaZUQPLKMJJHKIJJLNLGJGGIIHHJHH%iZCDDDDBDCABBA>>B8>L<<@@B/#CjPE@A@ACA@CA>BCCCFFFHILRVZ_fc[VMJKKIG>DGDDCCFFGDDGAEDCBCCCDGDDGGDGDDDBB=[XGCCBBCCEGGHGDGHKLPV_ed_WUMMNKIGGGD>>FCHHLMLW^gb_ZWOKKHGFFFDC@DJGGEDGGGGDB@C@@@C?BBB>B@BBBBEDDGFCCCCFCFFCEBCGMRU`a\\USPNILJDGDGFHHKLLHJHFIJHHKIH%nVGDFGDCCCBCDDCEDFDBECCGGDGDDDLRY_e\YRMIDC@CA?B?>=?@B>>==?BBB@?ABB@BBAP5>tSFCDDCEBBDA@DDDDHFFHILNVZ_caZXPLLJHCBGCCBBACDB@BCACBA?ACCDHDDCACDGGGGV<"%eaJGCBGEGDGHJHGJKNPUY^ad^XRJJMIFFGGGBB>BDBCD@BCBACC@<@M@?BC@B@CDJCDGDGGGML,7hCEDDGGDCJCGGLNSZadc_WQOJJGDDGFECDFCDDFABCBCB@>@@BBBBBAA>C>CCA?CECGCFFFFGJA,$A^JHJGGGGGFGJMNVY`gea\UQNMJHHDGHIEEGKGGFIIFGGDGHCDDGFGDCGGFGCGFFFGGIIGGKIIFIKIJG<,*BPKJMNNMMOPUXZccca]YVRPNPPPOOMPMOMPPQNNQQNQQSQQPNMKHLMMNNNNNPPNOOOOQQSQSRSVQSWVRTPSD&/hZVZ\_aggfbb\XUUJWVNSUVVWWWTTQOSTSRSSQORUPPSPOMMKMMMIGKMMNMIGIGGKGIKKLKJKNNONOONORPVE&+Likegec]ZWOSWQU`^WXXXUVVU[[ZZ[YZXZ][]][XXX[[[XVUVXVXXXZZXXXVXVVXXYZ[[[[^[[[[[Z]c^]]^\^\\\^][]^Wb`]^^^`][bi_qЪ÷ƒ§Ѓ®Ђ©©ђ©©ђ©¶©®®©®®¶©¶©©©ђђ≠≠ѓѓђ≠ѓ≠ѓѓѓ≠ѓѓѓ±ѓЃЃѓѓ∞±∞∞±±≤±∞ѓІІХj.П∆∆∆≈≈∆»««∆≈≈ƒ√ƒ¶R25544544411212423=422444012112510135602231/1333313314331554541124443952424666554665666666677&4663544756:@<8ЦЏ”ѓКСФФТФФФЦХФНКЙХ*ЫђПСПРНУУТПНЛИККИЖЗГЕЕЕЖДГC)y]^^Z[[Z[ZZZ]\^`^][YXUX[ZWWUTTQS\F#iPLEFCBFBBCBA>ACCCCBCC@DD@DFCCFHJMTY\a`\YSMLLIHGJGGBECGGHDFCDDIGHDBH *eOIGCGDDCCBCFECCDFDBFFCGGGIHGIOTY_ca[UNJGD@BC@>?@AC@@<:;<@?@ABC2 3yOADFCCECBDDDGGGGIIIKKMMT\ckaZWUMJHJHJHCCCCAACAABCBC@BAD?=ACABBCCG>DDCEBCEI+3bCCDDDGGDGDDGJNS^cfc_XOLLLHHGJHFFCDCGDDCCDBB@A>@>CBB=<@"4OukeedbZXRQSVTYgcUZZVVVURRUXXVVVXXZXZXZZ[ZZXXWZXXYXZZXZXZ\ZZXVXZ][[[Z[[[[ZZ[ZZZ][Z]]]^^\\\]Z[ZZ^^]]^^\]^bijsЫ“Ѕ•®ЂЂЂ®©©©©©®©©©ђђђ©ђ®©®ђ≠≠≠ђѓѓђ≠ѓђѓ∞ђ≠≠∞≠ѓѓ∞∞ЃЃђ±±≤±∞∞≤ѓЃЂ©Рc*$Н«∆≈≈∆∆»««∆≈∆≈ƒ√£Q267532212105224549447522411114@20124=32230146344///25122552322242243520554465544665566744653-4666756789Ыџ’ѓФЦЦХЦШЧЧЩЧФТЛТР"†•ПТУРТТППНРНМНЛИЙКЗИЙИИЖЖШE&Жhbc`a_\a]][```cc``][ZZYXWWUTTQQTA%z_LIHCA?CCAAACACABCAACA?FBAABAACIKMPX`gb_\YQMLJJHJLLFJJIDGFIFCGHBJDID"$w[IGDCCCBCBHFEEECEECCFFCDBIGIIOSY___YTNLIFBCCC@@>CCCB?=>mICBACCBBBBBBCCDCDDGJKOUV^`g`ZWSOJJHHJHGGGDCACDCBCBBBCACDDDDACBADGDCCGM@!'fVGDCCJFFGDGJHHJMLPV[`cc`XRMJHHJHHHJDDDCGEEDCDB@BCBB@AC>=CCBCBBBDBCBCDCDBD/3nBDCB@DGGHDCJKPR\ce`ZXQLLKHGDIIHHCCDDBGCCBBCBA=>@BBB?A@?<>>B@BFFGDFCDBFB>E<, AoFFFGGGHGEIKIMRXccfd_YVPPOOMLJLKMKKMJJGJKHGGEEFDDGCCCBBCCDFFFDCDDDGGHHHHHFEGFKP:*,HWBKOONNPJPRXbfefe^[WSQPPOMQRSTMMOPPQPMROQRNMKKMMMKIIIKMMIKJMKJOOMPRRORRRRPSSTRTSSKJ*.ZXU\_afelfa\ZZZXWYWYWWTSOOSPSSSRSOPOOPNNPPPNONKKKNKIIIIIGKKIMMIJGGIIHGOLMSPRROOOOPTU7"51010100122111352344346446;6465:22555232453354222255215431234346663455447466766789=A:8ЬёџђШЭШШШЩШЩЭЫЫЧТШП$ѓЈТЦШЫЦФУТТФТУТНКККЛККИИД~Ю>*ufb`^^^^aaa]eaacgcc`[][[ZYYYWUWSVC&ЛdMMJJABEC?AACACCCC>ABC?C??=B?ABGGKLU\^^^YVNLIJGEGKGGIMIIJIGIIKGCGCHI'*s`GGDFCFFCCHCDECCDFCCCCBBBDFHJNRZaa_YQJJGFAB@@@?>BBCBCA>>?@CBBDCCCAABBX3#@CBB@BB@CCBCFDIJLLPUY^cc^\YUOMMBGJJGDGGB@>>BDACB@AB@CBBGFGFFFFEGCCA9.BeIGINGCGEEGMIKQX\fib^YSPMLMLJHJ7GIGKJKIBIFHGGGDDCDGGGCCFDFGGFHECBDHIIIHHIGFGIFL;++FIDHLMKMOHOWXbcghe^ZVSQOOOMOMLMLMPPSTRRSVSSRQQMMNPNMMNMMMKPMMNOMOORPPPSSPRQPOPQRPSJC*4MSVZ\_iecd`\ZZXXTTUWWWTUTTVRSUSSSTTSPPPQPQPLMMJKNMMKGGKIGKIIIGGFGGFGIJPMLPNNPOMOPOTZ4%EQojkgec]XWTSWW]}iR[VOVTTUUTTUUTRXVXXTVVVVTXXXSRUXWVVXZXXYWPZXXXXUTgZYZZYZ]]][]^][[^]]]^[[[[ZZ[[]YZ][[]]^fjd~ЧЁ¬ЯІЃЂ®ђђђ©©®¶¶®¶¶¶®©®®®®ђЂђ≠≠≠∞≠≠ѓѓђ≠≠ѓѓѓ≠∞ѓ∞∞±≠Ђ±∞±ѓ∞∞∞ѓ≠§≠СZ'/Пƒ≈≈≈∆∆∆∆≈≈∆»∆≈√¶U8::7334321242133353472140111132102011234436531244665452553432464433143375435222013343444456666367777755:=71ЯаЏѓТЭЩЫЩЮЪЪЬЫЫШХЪХ&ґљШЩЪЬЪШЩЧЧЩЩХЧФРРРСТФРЛСНЫ; 0~h_^^_aa_aaaeacecca]Z[[]ZZZZUWUY\C)vjROMKHFFBBCCCAAACD>BCBBCBBAC?HHEILOUYZ\ZRQMGGGECCCECCCFDGFCFGGDCDCAF'+z^?AFHFECCDFFHIGGGDCHCCBB?HGAJNSY`a_ZQLJFBA@?Z+BB@BBBBBDDGGHHHILKMOU\cf`^YROMKJIIHGGHCB@@CDDC@@ABDC<;CCACB@AB?BBCGEEEEEFBFCC@:.IaKIGMGGJHHJMKMRZ^cfb^UPOLIOJJHLFHDGEGGGAGCGECBCDDCDDDCECFGAFHHC@@DFHHIHHHJIKKGI9/!.LHJLMLLLOOPW[fggge_WUPOMOOMOLLLLJMMOVNQQPPPPPONPMNMMNPMNNNPMPPSQVSSRQSSUQSVSSVVWSTO=(5_UVYZ_eaaab\ZVTTSPSWVTSRTWUSRRRPPPTSPPPQPQQLMNLLMMKKFGJLKLMMKIGKMIGIILMNMNMNOPMMOOPW5EUijjhf`ZWWPPWT]}dYZVUVRTUXURTTTTXVZXVXXVXVX[[UVUZXZVXZYXVV[ZYXXXXY]YWYZZZZ[YZZZYZ[\XX[][ZZXZXXZ]Z[]]]]]^cijБЬЏ¬ҐЂЃЃ≠≠ѓ≠Ђ§©ђђ©¶©®¶®©©®®Ђ®©ђѓѓ≠Ѓ≠ђђ≠ђђ≠≠≠≠∞∞∞ѓ∞≠Ѓ∞∞±∞∞∞∞≠Ѓ¶¶ФT'3Хƒ≈∆∆«∆≈≈ƒ≈ƒ≈¬Ѕ¬¶T3;:76343733241543334431:3113231212112332434331122122120231;6.642222133457666436133446966867779779977545:>81°ё№∞ФСЩЫШЭЭЭЭЫЫШЧЭЧ"ЈЊЪЬЫЪЪЩЪЪЪЩЪЪЧХФУУХЦЦХТФЭФ: -Нjdbbeijiffejgjjggea`Z_^^^\ZZZUW^C*СlSQMKJHDDBBCACACCA@CCBACCDBBBHHGJMPUY\\ZRMJIEGEBAACCEDECBBCBDFCCAA@I!(Б]@@DCCB@ACCCCAGEECCCFFCDFHKGIPU^hg_YUPMKFDBBADFCAB@@>@CACACCDCBBA@@C<[)8mF@CBB>AFB@ACCHHHIHHJJLMU^cc`\XPMMMLMJKHGFGGFHFDCDAABDFDCACCDDDBFHKCGGJ>1`KHMIKLJGIIIJHHHLMPU\cif_ZVOMMJJMFKJJGGDDCDB@A@HFBBBCBCDBBCBBBBB@@CDDCDDDG.<^JGCCCDHGHJLMLOTY]abZXQMOJGEIEGFGDGFCBCBFGGCBBB@@=BAACDABA?=ABFCCCCCC?CCCC<%M_KLICGGLJJJMLOU[^ffc]VPOMHNLKLMKJFJGIIGFFHIFDDGHGDC@AADFCFAFBDF=CDCFDGIIIGIKLEL=/5JJHLMLLMPOUZ^gkiggcZWSPOPOONLLNMKNKNPNPNPPNNNNMMKMLMKMNPMKOOOOOPQQQSQPQQSVWVVWUWWVJA'#5_TWZ_akccfc]ZYTVRRRTXVPOOOOROOOMOOPPONOQPQPLMNKLLMKKFGIJLLLMIMKMMKKKKPLLNNNNPSNPPMOP5)>ZlnkijbXWVSOSV\j_XVRQTRQPRVWVVTXVXXWVVXVTVVXVVXRXXZXXXXXXZ^[YXXX][Z[ZZZZ[ZZYZZZYYZ[VX]]ZZZZZXXXX[[[XY[]]aecВЬ“¬§ЂЂђђѓ≠ђЂЂ≠≠ђђђ≠≠ђђђђ≠ђђ≠ѓ∞±∞ѓѓ≤∞≠≠ђђђѓ≠ѓ∞ѓ∞∞±ѓ∞∞±±≤ѓ±ЃЂЂ©¶ХH(;Ь≈≈∆∆∆≈≈≈≈∆∆Ћ»ƒЅ¶S1887<4332133414513444413222633211242543245348112234491/11.443633323433/46433433134331534669967:99977659>AAB>@ECBA?ABBBDBDHIFJT\a^\XTNJJB?BBBFGHGEBD@BEDDBCGCCBCD@@@=D36sFDDB>>>@ABFFFIIIIKIMU[cb^ZVOMLJJJGKHGGJIGGGDDDCDGGGJJDGGGHGFFIHGHCL<5rNDHIIJGDGHGGFGDGKOTZai\\YSMLJ@HLKJHKHGGIDDBBDCGDCCDCBBBCCDGCCBCB?GHDDCDDA.?aGFCCCCCDGHJLLNTZbb`^ZTJLJGGIGGFHGGCFCCCCCFFECCCBBCBA@CBBAA?BBDECBBEEFFCCR:!CiKIDCGGKGJHKMORY`cmcXXQLKIMKLLKMKIIIJJKIGKIKDDGGDGDCCDFGEGBFDGHC@CCCDGHIGCGFJGC<-%4OKCILLLLLKQX^bfghh^[VSSOPSRNNMVNNNKNPNPMNNQQPMNKMMLMKMNPOMNOONMKMPPQQQSPQSSQRSQQRPI@'!8TSVY^cccfceb]ZXXVVUVYVVUORRPPPOOPPPOMNOOQQMMMNKIKJIHFGGEHJGIGKIIKIKKMMKLNNNNRSRQPPOO/,@UvoikidZZZWSTX_o_XXROTTRPRTTVTTVVVUPSTVSTVXZVVSOUVXUSVVTWYZYYYYVXZ[Z[[[Z[ZZ[\Z[ZYZ[[[^[ZZ[\\ZZVX[[[YW[]_edcШ”љҐЂЂ®ЂЂЂЂЂђђђ©ђЂЂђ©©©©ђђ©ђѓ∞±∞ѓѓ∞∞ѓ∞ѓѓ≠≠ѓ≠∞∞∞∞±±±±±±±∞±ЃЃЂ•°ЩF'DЮƒ≈∆∆≈ƒ≈∆∆∆ƒ≈ƒƒњҐX5;64632333331313323431132222111/01405433654454444598;2131/468755433433/36432432234123412526836646666789;>5?Ґ„„≤НЪЭЭЪЫЭЮЮЬЬЩЧ®Ь¬≈Э††Ю°°°†°°ЭЯЮЩЩЩЩХХТСКИШqE2/%w_QW_inpsytsssqvonnllknkigfffe`]cF5≠sZZSTPQQONKKHJIKIDCCCCDHHACF?AFEEIMSZ\[XQLIHGGCBECCCEBBCCBHCFCCDBBFC!К[CB@BBAB@BBB;=CCBA?ABBBDACFFGJPX_\XVQMJJDAB?BDDFDBACDDCFCBCDECCBDBB@?M3>oKCFDDHGAACACGHFJIFLJIPPSZic\YSMMJGEECHHGGFFEDCCCCD@FIJJJFHJGHGGHIEEHHD93tLHGHIHJHHHGGGHHJNPU^fja[SOLJJADGJGHIHFDDCCBBCADCA@C@BCCDCAGDCBCFBFHGDECCF+"@[CECCDD@DDBJLLNW\cg`]XRLLMJGHGGGCDDGEGDCCABCC@BBBBBBACBBBBA?@ABDEEEGGGIEDD: C>УZ@BCDCCDADDDGDGCHGFDM$HfB@CBCGDHHHLKMPY]cpc\UQMLLJHGGGGDCDGFGFCC@AAAA>AA@BBBA????ABB>BFEFGDCFFECB@#CfJGGIGIGKMKIIMPU]ccb^VQPNKKHFGGGGBFGGCFEGECDGGGDHCBA@BCFBFFFFFGDCGGGHHIMKKIKLJK?.%5LHLMLHMSQRUWZ`bcid[SRROMNMOMNPPNMMOMMMNNMMNPPHOMPOMMPNKPOPOSSPPPPPQRUQPQPUQSQVSRTPH@)#9UTXZ_agfgcc]ZZWURTPSRSSSSOPPSROOPPRTPONNNRPRONKLMMJKHGGHIIJGHJBJHJJJMLOOOONNRNNONOOP)+EWreeec`YVSSSVW`r^XVVTVTSQNSTTVWTWXVVTSTSTWVXVXXZVVU[WUWTWWTSWWTWWWWTWYUUUUTURSWZZY]RXZTTVZXSXXXZZYZZWZ]_glcЖ£÷µІђђ≠ЂЂѓ∞ѓ≠ђђ©≠ђ®©®©Ђ≠ђђђђЂђђ≠ѓѓ∞≠≠ѓ≠≠ѓ≠≠≠≠ѓ∞±∞ѓ∞ѓѓѓ∞ѓ∞∞∞Ѓ®†МA% R≠≈≈∆≈√√≈««∆≈∆≈≈ј†T385485211/13146314444428335322343422520521123242111222/111-1464511;43441/034/46463219752548;97769974479@>6F¶Џг®НФЪЬЪЬЮЮЬЬЮЪШ•Ш#!Ј•МПЛЦЧХЧЧЪЬЬ°ЛwoЛХТЗУИКВrJ>ПаK$[DIKZaiooooqxpnqqorqrrqrsspoqnnfnF/Љkd[`\[_VZYURUUSSSSOMOKLJMMJKMJJMMMR[^^YRMMLJJJGGEBBEDCCDCCBCC@??===!СX<<@?BABBABC=>B@>=?@?AMB=BGIMRR]__ZUNHLDBCB>>B@AAAABACIC@BDBCCA?AAA@BI5'L`HCCCBBGGDCCDFFGFHHHKPPSXZc^]YXPMLHGHGDGIGFFFDHJLGDGDDDDFDHHGEEDHCFFDGJ5*nLHEFGHDFFCDHIIJLLRY_gec`XSPMLJLLKJNJJJEDDCBBBBDDDBCB@@JCBCCBADGDDCFDGCDCC'O_C>DGDCBDGJJKMPX_fke\PQMJJKFGHIJFCDGGIGDECCBBG>CDAB>AA?AAABCB>ADCBDCCCCDC>CHXEHHKIIGIIIKKMQT\feb]XSPOMLIGHJIMKGHCBEHGGEGFDDDCCBBCBBCBGGFCCCCCGGEFGIKIICJKJG<,&@5J®№г®ТЩЪЪЬЭЬЬЬЬЬЬЫІЪ#∆ђ©Еrmsz|АДЖИЖzP\zЖЛНЩ°ЯЯЮФДЧЅZ.C\\ZZafjlprlljmkmqqrrrttstwstwtrsyN8√Дtnijhb`__a\[^]ZZZZVUURQPPPNMQQPPQUY[^_YTNMMJKKGGGCEGDCFFFDFCEDCC@@>.СY>>CABB==?@>@=>=>=?>==D==@BCGJIWZ\WRFGCB@>@==>>@BAACAACABBDDGFABBBA@@D3*UVGCGFBDGGDDDCDHJJHJHJNPQX\_^^YSPNNJ@IHDGJGFFFBGJMKFFGCGGGHJHGGGGIGIJHH[33`OJG@DGFGIGFGDGJJNPQZa`]^XQOLLJJJHFHFJLFDDDCB@ACDDDDCBBDCCCCDDGGDFFFCFDDHH%V]GGGGCABDDHGKMPV\gfaZOOMIKPABHGGFCFFGIGHGGDDBCAFFBB@?ACCFCFGFCBFGCFDDGCEDCBLVDEGIKJIJCHKKNTV^fcb]WOMMKMHGGGFJKKHGDHLMHHJGGGBCFCBBFCFCCFCCFFFGFCFFIIIIIJLLIB9* @AA??A??>@BEGPUYYXRLDC@<<<=<<>H.!X[JGGGFHHGDFFDDHHKJJKLPRRW\__^YSPMLIDHHHHGFDDDBDDIGCCGDHGDGH@HICDIIGDFHQ0/rLGDAGHGKKJJJIGJLOQXZcf^_XSOMJIHHGDDDDJHDGGDCC@BBCCCBDC>AB=?A?@@@CEJMUZ[ZUMHDB==<====????==<<<9:==?A=??A>>@H/ SvFEACCHFFDFDGDGGKKDKKLPVVZg`_YSRNLLLJJLLJGFFKGDBGBBCFFGDDDCCGEEEGGGCDDQ*/hOFGDDGHIIHHAKGHJLPW_ekc^YSNOLHGGDGGDDHHDDGDDCCCCDCDBCDBCB@ABCDCDGDFDGEEGEQ[IHIGDFFIGJJLLPY^jpe]ZUQLHGIIIKKGEGEGIFCGDDCCABCA>AA?AB?A??CC=BCCDHHGDGGCFC%'IYIGEJJINNMLOMPV\ahdb_PPKNKIIHJHHGGGGGHHHHGHJGHDBCCFGFCCFFFFFCBBEAFGDDEEGAGGIIFG;'&;PMMNMMNSNQQWZqfge`ZVUNNOPPPPPNMMNNNOPMPPMLMMOMLLNNMKNIKMNRRPMNMPPQQPRPSSPVRSSTTTRQP4//;TUW\_cbfgabZWWTTSUUUNONNPQPPPPPNNMOPRPNRMLJJKNKJGGILKKKHHIJIHFCEEICJKMJJMNNNNNMPPNN^#&Bagfefb\URRMQSScr]VSQSPSSQQOSTTTWWUTTSPRPUVVTVTVYVTXVVXXVVVVUTURRUVUWUVRU\TVX^XTTVUVVXXZZZVXZXXVXZZZ]]_^dmd_М≠ѕЃ©ђ≠ЃЂ©ђ©¶ђђ≠ђђђђЂЂЂђ≠ѓѓ≠≠ђѓѓ∞ѓ≠≠≠≠ђђ≠ђ≠≠≠∞∞±∞ѓ∞ѓ∞≠ѓ≠ѓ©≠ѓЂҐЧИ5 tЇ≈≈≈≈≈≈∆∆«∆≈≈≈≈¬ЪM595334433346662122222012333303351313442:1135231,13111131//134210432553313353443243363113444666555546649=>>>B6?B>ABA?=>>>>=<<<=?@=A>>9?ABA@@ACDLJKKLNPSZ`^\YVSPMLLHHLLMKKGJGFDFDBDDFKHGDDDGGLJKHFFDGQ&2rNJKGGHHHIIIAJJJJOSX_fh_\XSPLGDHHGGHEDGDCCDDDDEEEIDCA@CFFDGDCDCCDGDDBFCCC@XZGEGFFFFGIJJMORZ\ggaZXUOGHGIKAKKGCGGFGGFGFCCFBDBB@DCABBAG??CECBCCCGGGDHFCB9*#JSIECGGIJMJKLMJU\biiaZWSMMIIIIKKGHJIJJJGGGGHJHHGDFCFGFCBCFFFFCCCFDDDEGDFGBBGIGFH8 %;MKKNMMMOMPPU\fgkig^ZXTSSQSSSQQPNQPPPPMSQQOONMLKLMMKKMKKJMMMKMMMOOPQPPPRQQSSVSUPUSRP44/>YTX\afehicaZZVVUSSUYLRSPQSPPPQQPPPROOOOOLMMMOMJHHEGEEEGGGIJIEEEEFGJKJMMLNOOLNOLMMPL]"(A=>CIMTX^WSLHEB==>=?AA>A><=<<><==<>@<:;BN..[t<IGIGFFGHJORV\_ei_WUOMHLGJI"АЅ≈≈ƒ≈≈∆∆∆∆≈≈≈≈≈√ЭS576446331/22222//5413221123213213324352212234661453563443147875666:364344452225563655422411164315555558<<5Jђ“ ЧИСНПУЦХЧЧЧЩЩЩЫФ(+•µШЯЬЬЬЪЫ†Ґ',lxНШЦЧЦФСХНКУЗМЕЖЖz|tvo]SOUZZMPZZ[[\achimnlljlqsn}DXЏШ~yssrrtrrrpprqqqqprqspplllmlljkmmmqrstqqojffhb^a^[ZZ[\ZZXWLRTQPMJZJ5∞bJMEJGGBCCECECDCBBBBABCCBCBCKMN\ZZWQMJEB>>>==>===<9===<=<<=;<;;<><>B@>@@ABBBABCDGGGGFHJPSY^[YVRPOFJMIGJGJFGDDDCBFDFDDDDGDDGHHJOHHHHLGHKБ√≈ƒƒƒ≈∆»»≈ƒ≈ »≈¬ЭR68744422122343213443321/1221231/111631113125451110/122224314665434386333122335644465956544446654253550<=<0F≠џ»У{НЛНСПУУУУФХЦЩМ#,ФђХЪЪЬШШХ©Ь %WwРЦЫЪЪЩШХУТХПТПТТПЙРМЙМЖВЕГГzrГrpm`\gYh^P]\Y]^]r8^ Цrtjmwikorsnltpssqrrqqprppprrppppnrtrttrttsmmofcieceeccc_\ZVWZXXWRlK8Є[JMMMMODHFGFGEHEEECDACGFCDCGKOQZ\^[UMJGECB>==@>==<=??<;<<<<9:9:<=9:=AE4*ZpH>@=<>>>?AA@ABDCDDDFIJPTZe\YSRPMFJJIGIIFDDBDFFCFDDBFDFJGGDHJJJIJHGACDLBiOHJGGJGIJGIIGHJPSVZ`ce`ZYRNMIKRIIKJIIIGGGDCCCDDCBBBBCBBFDCCCDCGHGGDGDCDJ<aSJJECGFFJIHKMPT[_gf`ZXSMLLJMNKJKIIMHDDDDGECGBBCCAADBABABAABCFCCDHGDCDCFFEA;'$PPJKJKJHFIJJNNQVZbfhg`UUSMLLJLOKJJHBJIGFFFGJIGHACAABBBCCBBBCBBCCCDGGHGBKIIIIGFIF7 >HHMMHLKMMMSY`ccgda[VTSNNNMQQQQNMMJJNNNPPMPQNONMNMMKMKKKONMKLLLMOPPPSSUSSSVVVSRSUSOQ5//>VU\^ffieeaa]XWVWVSSQTSSOOPROPOOLLPSPOMONNMMMNLJJJGHHGGGGIJIIHEEGHEHKGLKKMMNNNOOPOOJP.05kaeaca\WWQOOSVclUOTOMMOOMOSROPRSSRRSPRPPNRRSPNSTTUTYZZXXZXVUVVTRNSSOVSUSSSU[VVVUSTXTVXXXZYWWZWWYYZZZ[[^^el]Тљ∆Ѓ®©ЂЂ≠≠ѓѓѓѓђ©ѓѓђђѓ≠ѓ∞≠≠ѓ∞ѓѓѓѓѓ∞ѓѓ≠ѓ∞ѓ≠≠≠≠∞±∞ѓЃ≠ђѓѓѓ≠ЂђЂЃђІђЪu>Д≈≈≈ƒ√ƒ≈»»∆≈Ѕ≈≈≈ƒЬM47544323320230111214221/143445302316510163354:0000/01222446333321.174333102123420344545323136657772556<====<>A<=<=?><=<<<:>>=@DV//^vE;<<:<<===?AAA?@AABCFINQYaZWRNMJBFCDFFGDCCACDFFFFFCFGGMGGJFGJIMKHGHHGM%DfMLJJKJGGIJJJGGHLNRV\ecb\YQMMKKPFHHHGGIHGHGDGDGGGDFCBBGBFCBBDGDDHHGGGDCCI; cMKIFBFBFGHGJJMRU^cga[UPLLJHJMJIKJGIDGCDDDGGGGCFDACFFGGFCBA@FDCGHOGCADDFFCA7)%XSHIHHHGGGFIMMQSW_efa^URPNLMKJJJJHLJKKIFIGIKHGHCECCFDFCFFFCFCFFCCFHGFFGFIIIKIIPJ5#TU\^beicgee_ZYVSSSSSSRPPSUSSSJKPOOQPPPPROOMJLLJLLGIGHHGGHKIHJEEHFEIIEKHELNNNPNMPNOJO.-=<==?>=>>=>@GZ),_vJ=?><<>BAAADBABBCCEGDMMNW_YVPLGGBACCACD?BB?BB@FDCBCCDDGCFGFGGFKGFGJJLR&OqMLHHJIIJMNMJHHLLO\X]bba^YRMLKIJGGGDCDDFDCAB@ACGCCCCBFCAFBBBDDDDGGGIGGGCJB`LJGFFGDDGHHMLMRW]cicZUQLKHDGGEGFFFHGDDGGCACFFCDCІЖn|uxunzlrmbkgZnZ[fhac_gfggejgijjlnporrqpkkjjhijiikiljgjjeefdbccahKW÷dP]]\[\ZZZZXXYTTTRRRSXVRPRQRVUXb```ZRMMJFDCDDB??=?A=;<<==>?=@@<==>@@GT0&oxLB?@<<@ABBABBBBFCCCCCKJPX^ZXQLHGDCADAAG@A@?BB@ABCFCCGGDGDFKU#UvOLHGJIGJJNNOJJOOQYZ_df`\YRPNNLKKKRGGDGCHDCBA@@ACACC@CCBFCABDCABGGFJHHDGX@^UFJGGGHCGHLMORX\begb]UROKHGHGFJFGGHGDGGGDBFFCEC@@@@BCCB>AAACCACDGJJIGHFEEA5)dOHDGJJHHHHHKORY_fhha\VPNKKLKKKDFHJJKKGHJHHHCCBBCCABCDDGCDCDDGGIGIKGGIGFJKHJJHJH5%;JHMNNNMMOSVV^cmgc^WWUSUQPOOOPLMNPNKNNLNNNMNNMMPNPMMNJIJNPPPMMLJOOPQPQTTTWVSQQQUSSVO/%,DUSX[aiccfb`ZYYTUSQQSQONOOMMMORPOQPOPOMMOOMMMPOMMKKIICFEGHJIKGFGGJJRJKLNNLMKJNNKNLMJH%'5bmb`d^YUSNOSVWqaWOSQQQOMMQQRRRRTOPSOTTTUVSPSUSTUSUXRTXTXWKSWWSTRSZSSQOQQQPPPRMQUUUURTRRRUQSSUTSWTW[^a``eiodР√«І®©ЂЂ©®Ђ©ЂЂЂ≠∞ђђ≠ђЂ≠≠≠≠ЃЃ≠≠≠≠Ѓѓђ≠ѓ≠Ђ≠ђ≠≠ђѓѓѓѓѓ∞ѓѓѓ≠ЃЃЃЃЃЃ¶ЃУk:Гƒƒ≈≈≈ƒ≈∆∆∆∆∆Ћ»≈≈ЩQ5943124532321342122210/112433311112234343/22242341/03111313324-/11152241433244225353314455322124944:787898C≠ўњ~nА}~}|ААВД|НВnПЛСФФФФЧ§Й 2qКУЬЩШЪЧШХУХФФФФНМММЛЛЛЛКЙЕ{~}lИ~{{yyvvw|ussuyqfИ:?ЈwkrxАЖz†ГФТПМА|~yttrjkgkgjfdfc`echihghihgefejeijhgjkmrhfiffdeedcarDg¬iZc`_]_^_`\]\]ZYYUXYZZZXVWWXXYZdddb_XRRMKJHHGGDBBCDBBBBBACCAAA===>@@LL5,lnFAB@<<<<>>>@@ABCCCCCEIKPX]YUPJHDCCCA>@DD=D?>>@@@7@A@>>BAACBBCBEFCDCCFT(YnMGGGHGFGGINOJHJMOUX_ffa\YRNLLLLMMMHHGHEIIGFCCBEGDFCCFDCGFFDDDDDDDDDFFDFM6!XUFJIFGHHJHHOMPX\`ee`ZXSPLJHJNIJGLKJHGHDGGGFGFCDCCCCAABBABCCDDCAADGFGFFFCC=5*ZGHGHJJLJHJJDLSW`ehe_\TQQNNKLKMKKKKKKJIHHGLK@DGCDFDDCDCDBDDGGGGFCIIGGJFGHJGHHGIM3;EJLMNNMMOSU[`fkifaZWVUVPOMLMNPPPQMKSPNSPKNNKLMMMNLMMMIJLLOKKLNCMMPNMMMQTTSSSSSPUUPR4"/FTUXZ_fffhc`ZZWWWVSSSQPPOOPOMOQPPPOSNNMMMMOLLOOOLHHFD@DECEGHIFFGEHHKKKLNNMPPPQPQQRROM*)9cieeea^YTROPVZi`VSSPMOLOMOSQMPPMMOOLSTSTTNQQQRPTSSVLRXXWYQTWWWTTT[WRSSTUSRPOQOQSUUVTTRTUVTQPTRRUSWYY\^]_cicМЋЊ•§®ђ§£ІЂЂ≠≠¶≠∞≠ЃЃђЂ≠Ђ≠ѓѓ≠≠∞ѓѓЃ∞≠ђ≠≠≠Ђ≠ѓѓ≠∞ѓѓ≠ѓ±ѓ∞∞ѓѓ∞ѓѓѓ≠ІІФj<Жƒƒ≈≈≈√ƒ≈∆««ƒ≈ЅЅ√ЫR5864337753543332033111/11243311111455213331434448102331193444111242112101122233020.1/.34331122448547589974DђёЊyezywwwwzzz{{wДvhЙВДИМПРФ†Т.!\ХЦЫЭЪЫЬШШЦШЦФУУРНННРРПРПЛЕyqrjnrrrsrrrrqwrrrs|qkz@U§Бrqrrsv{АЙМНЛЛЖВВДИВИА|М~А}xxukgi\jh][Ze]bcbaedgifcffikgehhfdccaact@\№h\dc```e`_`^__\\[Y\XZXZZZ\ZV\]_jhfdd\ZXPNNLLMJJJFEEEEJGGDHGCBBB@=>BCIL3/|v>BB@>?A>>?@AABBBCCCCEILPUZXRLGHHDCA@@@>A;B=?ABBA<@C@@BBBA>>>ABCEBGDCL`)#P`MHJJGEFFCGJIIGGKLSW^cda]UPKJIGJJJGKJCJEIGEGFBEHGGGDDGGDFGHHGGHGGGGGDDHFG5([ZGIIGFGHHJHLLMPX\bi\XWTOOGGJJIJJKGHHDGFGJGGGGDDCDCDCFGFFGGDGGDCDHGGJGGFGFH4*YPJKJJGHJJJJHKRX]ehc_YPPNNKJJJKJKHIGGIJJGHJJGHJHGIGDDCGGGHGHGJHCFFFEFGFMJJGGHCML/=GGJLLMKMMPWZ`bggb`ZWVUSPOMLMNPPNQPNPNPUQPQPMMNMNOOLLMKNMMMLMMMQNMNNPMMPQPQSQQQPQOMJ5#.CSTV\aeecf`^WTWWWVVSSSQSPQWQPQQQQQQXNNOMMMMLLMOOKIHHEBGEBBCECBEEEHGJHIIKKMPOMPHMPOOOC+=kffefc\YYVSTWYjmWYTPPR@QQMQQQQXMMSOOSSPPPPPSQPNPOPTHPUUVUSTVTVRTTTVRSSTUSQOQQQUVUTURRUXZZUSQXTTWYYZZ^^^be_dК√ґ¶І®ЂІ®ЂЂЂ≠ЂІЂЂЂЂЃЂђ≠Ђђѓѓ≠ѓ∞∞ѓѓ≠≠≠≠≠ѓ≠≠ѓ∞∞ѓ∞∞ѓ±≤≤±±∞∞±∞ѓ≠ЂІ§Шr<!М¬¬ƒƒƒ¬¬ƒ≈∆∆≈∆ƒ≈јЫP797543865552221/122111002144210//3466313222434.14111112254443334421.2413944<44/282/4/2332311/024646544772<>ІбґvnurqrrrtttutqxhiЖ}}АБЕДДТМD:ЮЭЭЯЭ¶ЮЬЯЬЬЫШЧЦФФФФХТРТРРЗ|sobblprrniehitkerrqqmg?PѕxnrrrvzАЙЦЦПНЖ~xwru||{~ЕВЕИМДКЦЛВ~urrmikijje_`[[_^[]]__^_g_cc`b``]n=dљs]fbcabd__b_d`a`^\e^^]]]`_^[`bbjjiifa^ZXSURPRPQPKJJLKRKGJKGGCBCB@BCCD_")К?FDC@BCCCDDCFFCFFFEGGKNPVZXRMKIGFCB@@B?<=@=??@@<:<>@=>?@A=>?ABCBAAC@Je%hiMGGGDDDFFGIFGGJLMUX\k__ZUNLHGDGHKHJGEIGGC@BB@DIDDDCDCDDDGHIGHHGGGGGEGFDK3,\YKMKJJHJJJJLLQNX]ffb[XPOOKKPJGJGGFGGGDCCGFCFDCADDAA>BCBCGGDGHDDGHGIFGIIGMJ2,]VKKMJHJJJJJLOSX`fgc_YSQNPMJHHEGGKJDHIGIGHHJHHJJHHDGGDGGHHGDGGHFFFEDFIKOJKKLMIIC/CMEJMMOMMMPUZ`bfg`ZVYVUSMLLONPNNNOPNMNPOPNOPPNNMOMMKONNPNLMOOOPSMQSQUQQTTSUUSRSSQOLR/'/C[TV\]ccc`_ZVSVRRQPPQQPPNQSGSSNOOSPOPOONNONLOMMLLKJJGEIGECEGEECDENIJHGIKIMMKILHKMLLL<".9h`caa\VVSMPSVWnpYUTRPSPRQQSQOSVQOQSSVTSRTRRVRPRRRUWSSSRUUUTTSTSSQRUPOSSQSQQQQQSUTTVSRUVXXURSRTUYZZ[]]]^be_dМ¬і®≠ЂЂ®©ЂЂЂ≠ЂЂ≠ђ≠ЂЂ≠≠Ђ≠ђЃђђ≠≠∞∞≠≠ђ≠ђЂЃЂЂ≠≠ѓ®ѓѓ±∞∞±∞ђ∞±±±∞ЃђЂђХe8'Хƒ¬Ѕƒƒ¬¬ƒƒ≈∆ƒƒ¬√јЬM776542435353233213364454255;41//131441342/2446./33311144144/3314420111258649751693470255133233446;855355:;9µб±xeqjjomnnnopjhnc"SrlnottuvtY<&!2k°ЮЮЮ¶£Ґ°°†°†ЭЮЭЭЫЩЩШШХФФПЗzribnprolddfipihrqkggc<Nј}stwrt~ГЙЬФТКВzprooomrusuxvzttД|АИwБzЗ}ЙНwЛБЙtphb]][TPT^M\`Ya_`Y]8 ЇЖdibbbb_``bad`cc_]`a``aaaaaabedjijihdaaZZZVXXVVXQQRTLMMMOLLGJIIGFGHHE[+%Х}CDGHFFBCDCEFHGFCFHHIHKLQWZZVRLJGDFFCBBB>A@ABAB?<><==<>?=A@@@AAB?@?>BJ_^cHDCCCDCDBDFDDDHBLRXY__^YULLLHGHJJHHJJGGHFCBCDDDDCDDDCCCGDDHFIGDHDGGGIDDT1.^SJJOHJHJIKKJLNV[bife]XRNOKJPIGIIJGFFGFDFGGFKGDDFFCCBCBBBBCCDGDGEDCFFFIIIHL.)fKMMLJHJJJJLLPRX^gfc_YUSPQNNKGDJLPIGLJIIGGHJHHHGGFGDDCDGGGCCDHHGDDGGCGJKKKLLKJLA0(DFIMMNMOOQRTX_hjic`ZZQMQONLPNQPNMMPMNNKMNNPMQQPMMLKKQLNLMKMOKNNMNQQQTTUTTSSVSSVVVRMS,)+HXVY]ccfffb\ZZNTTSNQPNPPPNMMPPLLNNNNMNRPMPNBNNJLM;GMGIIIGIIIJLEGGJILILKMJPNKIKLMPKMM?$/9e____YUPOLMOQVjlTTRMNPNOOSOOOPVMLOQQUSTTTRRVVTSUTUVSSURTUTTUSUSSUUVROROOQUSSQOQSSSSPOQSUVSSQPRTWWYXZ[[[becjЛ√і©≠≠ЂЂ¶®ЂЂ≠ѓ≠≠ѓ≠ђЃ≠ђЃѓѓѓЃ≠≠ѓ∞∞≠≠≠≠≠ЂЃђЂђђ≠ѓ∞ѓ∞ѓѓѓ≠Ѓ≠Ѓѓ∞ѓЃ≠•£ЦP7 *Шƒƒƒƒƒ¬¬ƒƒ≈≈≈≈ƒƒњЬL75574212333-1231332331245>=AA??BBAAAA@AA@BD^onC;AABCCCABDCCCH>JNV\__^XQKJJGDGJGFFGFFFGDDCCBBHCCFGFFCCLECIIPJHHCGDGIGGM51_NJGLJGJDJLLLLMX[aegc^VQMMMJGIGIFGGFGFGIJIJIKGDCCDDDCGGGFCFDFGFMFGGDDEHGEID/(ZJHIJJGGJKLMMQXXbtfe`UQSPPNPLLLMMOKMMMIIIJJJJLJDGGGGHCDGGGCDGHHGDDGGHGHJGGHLKKJ>0.EIIJJLMROMKKLMMMMM?!.9\Y]]_ZWQPNOOPVlbORQMMOOPOQOQOOSONOPQSQOOPPPRQSQRRTRQPRPRTPPTTTUUXXXUUZRRRRTUUTRRRTTSQSTTUUUQRRTTSWWZ^]^^cgrЗ»ґҐІ®®Ђ®®©Ђ≠≠Ђђђ≠≠≠ђђђЃѓѓЃ∞∞±ѓѓѓ≠≠≠≠ѓЃ≠≠≠≠≠∞±∞ѓ±∞±±±іґ∞±∞≠ЃЂ†Ш[2 1Сƒƒƒƒ≈ƒƒƒƒ≈≈≈≈ƒ√јЪM:5453112123/1211323123124898753341180/311223433322296676556631014223353313233331112:2134434,555554689:387;>≥–Ѓtckfdfdhfddc`]amHOZ_Z^`]\XYXRKC>5>==83IZ`hlgju~xМРЦ£УЪЦЦ†УРЗvqqrqswrswrwsvxrspqy?Y°Ц}А}~ЖЙПЫХШСГxrsmsqrrrrrrrrrrpnrppnppppprjptrxxx~В}ДА|СИВЦАЕЙuЛ/?мЬПimalljhffikggmh_ca]b^^`X^Y_^`bead`aab^^[Z[ZaZ[]]\ZZ^ZYZYYYYVUXSXUSOa,&¶ЬJPPPONMMLMKMLJIKLKIKJLQWZ^YYSOLKKFCBA@@@B@@@AA>?@@?=ABB>ABCBBABACCACDf!rpE8C@CCCBAACCCCIDJNU\^\YRMIJFBBCFFCBBABBJBCBC@@DACDCFCFDDDCGGKKGHJJGGIGHS42iMDGGHJJHLLLMLMVY_fm^YPOMMMGCJIIDEEFGGGGIIJGFFDBDFBFCGIGGFGFEGGJGGGKJJLJFJG*)dPJKMKGIKIMKMOVZ`igb`YTTPPMJJMMMMLKMMJIJJKKJKHHDGGDDGGCGJJHJHHHFHGIKKJJIHGLLJQJ>4.>FILNLLMMMOUZbegiaZYVSPROQMONMMMNNNNNQMNROOOOOMNNNMMMMMNLLLNPMNNPNQQSQRRRPRQPQSPQSJG,'*JPSY]bccbcaYVVRTVSQQSQQQQTSQTQPOOPPOQQQQMNKKJMJMMGEGCCGFFFFEGJGFGCCECCGIILJJJKMLKHKQ<&6;WXZ\ZZVSROOSSYg`VSSMOOPSPSQPNQSVSOPQSPOMPOOQQTONOQQQOOMMMMPPNNPPPUURUTSRPLUTTUTRNRVVTSSTTSSVUUTWVXWZm]]`ejyЙ і£•®ІЂ©©ђЂЂ≠Ђђђ©ЂЂђђђђђЃђѓѓ±ѓѓ≠≠ђђ©ђ≠≠≠≠≠≠∞∞ѓѓ±ѓ≤≤іµґ≤∞±∞ЃЂ§Ь`0 :Ш¬¬ƒƒƒƒ≈ƒƒ≈ƒ≈∆≈≈јЩN;5544432,1351212623334231222133441191001-75431312214466343664113103343235778555453353111234455521348853;5;Eѓ÷Ђoflfdb_b`_a^_Zcl!CJUXZZZYTTQRRQMGKFGGHCCNOM?*":YfdnwГЙЛФУБxkfccijqzzГ}~Еyzzwustr@'QТНЗИИЖЖЙМПЩШШФНИ|}{{wxzxvusrtrtrrrrrppplmmmjmnnppprtrsrpqrtww{y|xyy9BќЙ~y}|zywrnepfX^nc``Zrbciceeddbffcj_``cb^[Z\\ZTZZ\^\Z`ZZ\YY\\XXYRWXUXh%Ѕ¶IVVSRRQQVRQQQNPPQPMPQTVZ_jb^YVPLIHGDABCACA>CBBBB@@A>AAAAAABBCBCFF?@BFc!{gHABAB?BAAADGDGGCJPSZ`_XPKGJFBGDBCDBBAA?BA?AB=@>@CCAABCBACACDGGGGCGDGGDGI//nRJGHHKKHLLLLLMT^brbb[UQOMKIJJJIGDFCFFGGFCFC?BCBCBACDEDBDEGCFCGGMJGKJHJJDMG(/jMKKMNJMMJNMNQTZbigd`ZUTPNNJKLJKJKKMKMHJHGHHJJJDDGDCCDDGGGLJFIGJJGJJLJJLLJLJMPH@5'0@JLMNMMOPPRX_bekf_\YVWUSPOMNMNNNPNNMPNNNNOMMMNNNMMLMNNLNJJLLKNNNPPQSVTTUUUWVUSSPQNXG2*,UUTV\`cfbc]WRSOPPSSQQPPPPQQNQPNPQPPOPQPPLNMJKMLLJHHHEFGGIGJGGMJFHECDEEIIHJJKJMMJMKJQ?/<][[]\WRSROPQKWd_VPQNROQSNPPNPPSRTSSOOMPQQOOQSRNNQSSQQQLMLMPPNNNMNPPNRRQPNMSSSRNNMRQSQQOSPQOSMTTRTWWY]\]^f_tР∆≤¶©Ђ®©ђђЃђђ≠ђ©ђђђѓ∞ђѓѓђЃ∞≠ѓ∞ѓѓђђђ≠ђђ≠≠ђЃђЃЃЃѓЃѓЃѓ≤≤≤≤Ѓ∞∞ѓЃ•І°U/ C†¬¬√√¬ƒ≈ƒƒƒƒ≈≈≈√¬ЪJ87655555//55312383464411/332133433022001342311311314444322333322202232535;614766855534333445;9553489?8;:5EJ±’§l[hfdb_^^]]][U^`'!HJPQSXXUPXPQQQMMUMOMMMIKIE:! CMGJLRYcdhgaZUVY^]clwzzzzx{}|АyИr9'MВЙИЙЛНМЛСУШЪЫЪФКЖЕИАА~~В~}}yxzxzvxvvxvrrppprrrpnporrrrpolknmnnlqohhk8 f≈Лm{|ЖРЕМЖ|П~ЕММz}Гvjufklfmjkkggfikcdefcdcabaa]^``a`_^]Z[ZY[\ZYXVWWYTe$∆≤IWWVUUUY^UUTUTUTQXSUUY\^bhda[ZUQNLJKGIIFHDAHHHEDCBCACBAACBFECABAB>B@CX"eFA@@@>@BBAABCBCDCB@CCDBBCDDDDDI(/iRGDDHJJHKBJLLOV[bec`ZUQNMJIIJJJJJHGGJJJJGIGFCBCBBCDCDCBCEFDACGGJHFGDGGHEBD%2ZJHKMMJKMJMMLOSY^kle_XSRQNNJIKKKKOMIKLJJJHJJDOJJGGDDEGDDGGHJIIGIGGJILIJLMLLJMKE>0%4>GLMNMOOQRWY^cgkgb_ZY]VSNPQNMPQNPNNMPNNNNMNLMMNNMLLKNNLLJKLIIOLMOPPQSQTQURWWRSSQOTSO)'2LUXZ_igife`ZZZMSTSSSPPNPPPPNPNPOPOOMNMNJMMLJMKJGHHGHGFFCFIIGIJCFHGEGHIJJIJMMIMMLNMMU<,;Ze\_]YUSPOPSSVleORRNOONONMMLPNPRPOPOOMOLONMQPPRPPQQOQQOOPMPPRNNORPPPPPPQSRUTRRPNPSVSOMOQMMMOLRTRRUTW]Z[]bZsТ¬ђ§®®¶®ЂІЃЃЃ≠ђ©≠ђ©≠∞∞∞ѓѓѓ±∞∞±∞∞∞≠≠≠ѓѓѓѓѓЃЃЃ≤ЃЃѓѓЃЃЃЃѓђЃЃѓЃЂ§§ЯN) H§¬¬ƒ√ƒƒ≈ƒƒƒƒ∆»∆≈ЅЩL9664433213322134933334113763453343102005;3333341/23<444212211432100100333<2/1334633353444,2355534388989<5EMЂ–†oegfbb_^^^]]ZXQZ%)LNTQRRSSNRMMNNIMMOMMJJKLGA;# ACDILNWZZQROKFHFCDA?BBFCAA@><>>@@@>@BBAAC@CHDBBBBBBDCCDDDDM*2fPHDDDGJGJFKNMKUZ`ccZXRQOMIIJHJLIJGGGGILHGIGGCABBACBGGGCGFGIGGGFGGGGEDGGPGC$2OIGGIILJJJMLJNQYaerd\YSSRNNJIJJJLMKIKHHGJKMJGMKJHGDEHIGFHGHHGJIJGHGIIKJLKLLIGJJ>42CEHKOHLMORWWZ^egif\YWVQQPPPPQSQQQPPNQNPPNNPQPQPOPOLKNNLLLMNMMLLKMMONQPSPSPQQPPPPNNML,%4HRVY^gfggcbZZYSTTTQTQQPOOPOKPQSSSNSYMMMKKRLLRJIEGHEECECCCGGCGBBHGEEGEGIIKJMNKMMLNMMX=&=]g^_`\VSOOPSSZo^SSPORNMPMIMMPNQNOPOMOOLMMMMMMNMPPQOOLOOMNPNPTPPPTOPNPPRSURTVUTUUVT[TRPPSPNQQOSTTTYTWZZ\^cZvТƒђ°¶•¶¶ІІ©©Ђђ®®©©©≠ѓ≠ѓђЃ≠ѓѓѓ∞∞ѓ∞ѓђ≠ѓ∞ѓѓЃ∞∞Ѓ≤≤≤≤±±∞Ѓ≠∞ѓѓѓѓ®Ђ©ЯЬN& Q®¬≈∆ƒƒƒƒ≈∆»≈∆∆≈≈јЩI9444332111222231522//0/2094*13133011//143333484213493340133343422311011334111//121431133413333533/77569788J±“Яlafb_][]]ZXXWVM\'DSTQRSUSQSOONMKQNMMMKMOLHC;# @UJJIIIJIGFFJGMJMOPMSWPWPWXZ\X[ic9$CzХДДИПМПМРУЦЫЯЪЪУМУЛМЗИПМКККЙКЕЖЕЕЕЕЕЕВ}Б}}|zyyuuyyvy{{srrrrrpkigt0i»ЙtИНЦЩЙГytrnpdtrtvxvxyБ~{Л|АЖ|ЙЕ|ytoroinkjedb`bcfcbnhdb^dbbd]^]\ZZZQ%+ґ≠Sa^_[[[Z]`^^Z\d__\ZZ\^`dhhhid`]ZUUMRRQQQNMMMMMJLKLJHJIGJJGJFHHEDDDDELQ!МuHDDCCDCCCBBB@CDDJMQYZ^RXNHGBBCD@??AAA@?@?@A>=<<<>@@;@B@<@BBACDBBDBCFP*8lQJGDCGGIHLKNPMTZ`gbZXUQMLJJJIHJKIIJGJGJDDGJGCBCCBIBEGGDGDFCFGGFFGGIIIIGQMH$;^SLKMIJHJMMMONQYdhdd\XMQOLMMJJGHLJJJMJJDJJMKJJJJHDDFKIGIJHIJIIIIJJHJLOOMLLMJGPLG2".KOMMNJOPMMUUZbfiifZURSOOSSPPQYQTQNMPSNQPPPQSQQPQOMMPMKMNNPPNLLMPPPSPQPSSTSRQQQQONNKH.'3NRTY\`cfca\\ZURMLPPQPPPOOOPPPQSSSQPQNMNMMPMMSONJJJIGEECEEIIEFCFGGEEHFFIKIKMMKKKMMPKU7;`kY\`YVSOOPRP\m\OSNPNNMOOKMMMMROOSQOQQMOOPPPTPPRROQNNOMONPNNQQOLIMPPRPNRNPUSQUVUWTWUURPSSOPRPQTTVZXYZZ]becyЩƒ¶£•ІЂ®®®©©ђђ®®©©≠≠≠≠≠≠≠ђЃ≠∞±ѓ≠ђђ≠ѓ≠≠ђ≠ѓ∞∞∞∞∞∞Ѓ∞±Ѓѓѓ≠ѓѓѓЃђЂ®°ШN' Zѓ¬√ƒ≈ƒ√ƒƒƒ≈ƒ∆∆≈≈јЧI8645415322335581112111132231131100/1./2341111101101143311113423123443434343211.3416733564;32;4544454588558Eґ—Эf]a_^^YYYYXUUUKK%HWQPRRTSQQQQPNRSRPNPNQTPMRC& QWKKKIKJFGGHJJLJLMMINLGJCKGKKNMKJ5'?@AB?><=>><<<<<><<;;<<@>@G@>BB\MLLMNJLLOMMQSXZfjec_ZTPOL^MOMJJJJJKMMKKKFJGDDGDCCCGJHIJIHIIFIJJJLHIKONMLKKKHNLC+#'LRQOPKOUPQWV\kkkif\WSSPSRRQQNQNQPPNNPMPLMOPPNQPOONMPPKMPNNNPLMOSSQQQPSSQTVVWVVSRONKH/'4MUV[]bcfcf\\ZSQNMMNNNNPPPPRQPQQPPPPNPNOMMOMMGNNLJJIHJHEECEGGGGEGIHGIGIKPKKKMNNMPMMKO79db[_\YSRPOMPM\lZRTOOHLMNMLMMMKPOOOOMOPMQRPPRSPPRPTTNPRRRPUPPQSQMLNRRRMLNHNPNNNRRMRRPRPPPSRNQQNSRUVVTR[]ac_rЬЅЃҐ®ЂЂЂ®ђђђ≠ђ©©ђђѓѓ≠∞∞∞∞ЃЃѓ∞∞ѓ≠≠ЃЃѓ≠ђђ≠∞ѓѓЃѓ∞ЃЃЃ≠ѓѓ≠≠≠ђђ≠ђЂ¶ЮШH! a≤√¬√ƒ≈ƒƒƒ≈∆≈≈≈≈√јШH55554153112366513122212444223432200133821155200/21/33133110232200555251431224344646743443643;7755556999969Mґ—°_^`__^[X[YYUTRMU!OVMMQRQQMOOQSPPSSRQRQQTRNNN*YWJKMKMNKKKKRQPMOOQMQMIIICCFDFFBB8@bVMJQQKTX^dpw|АД~ДЕЗЕВДЕЗИЛМКЛИККЛМНЛММКЗККМЙЙИЙЖЕЖИЙЙЖЖЗВА}}}|wvБЗ'JіЙВЛРТХЕztnljkllllllnkihhiikkkkimoonphpppztu}tББyИ|xyurwooqiomkhgc_[O(*ЇЇf^XXZ^^_a`[\\\__\^__]`^aehggghd`^^_^^]\][YYYZ\UUTTWW^RQURRRMMMPLLLDGKRЩ|FKIHHGDCCDGFHGGHILPZ_^ZVOJJGGJDAECCCC@==@?@@=>>B?<<<<<@@<<><>A><@=<>>CBCDFJJK;MRXbic^XRMOONNMJJJLLLKJNGGGGGGGHCCGCHFFEEDFCCCCGGHJIIGFFGJIC<%BWKKKKJJMMOGJHRX\affc^YVQPMPOMMLLJNKMKNKNMKKJIGGGGGGEGHJJGIII>GJGIHJHGJJLKIIKJRLC!$ILMMQOORRRUX\epkid^XWQOSQPSPPQQQPONNONPNNQRPNQPONMMNNMMNNNOOMMMMPQNNPQQQSUUVVVVRSNMG/.4SSZ^acfgfga\ZVQPQPQQNOVPQRQPPQNMOOPMMLPPPOMMGMKJIIGGHFGGCCCEEC@HHGFGAIMKHKLKMPNPQOKS5$!:to]_SZYTSOMPK_tWOROOLJJLOMMKKIKPPMLLMMLPNLMPRMMMMSRMPQPPNRPNOOMMPPPPQQQQMORQURTTRUTRRURPRPSOONRRRSTTUZZ[Y\rЭљ≠•¶І©І®ђђђ©©ђ≠≠≠ѓ∞ђѓ±∞∞ѓѓѓ∞ѓ∞ѓ∞ѓѓ∞≠≠≠ѓ±±±±∞±±±∞ѓ∞ѓ≠≠≠≠ѓ≠ђІ®ЫЦI! m≥Ѕ¬ƒ≈ƒ√ƒƒƒƒ√∆∆≈≈њЬK5644425/1/13331111132123232244443/2333622233141123244334111/1233/63445011135566514573332136665475544898947Uґ ІV^c__`][]YXYTROURTPNNRQSQSRTVTRSTRSRQPQRMPV, YMKKPMTQQMNPNMQNRRSRQKKMKIKJIFFF@;'AkPGFEC=?=ADGHMSVZ^fkkmpss{|ВЕГГИИИКЛЛЛЛКИКЛМЛМННЛЙММЛМКМЛМКЙЙЖДЕДГМК.FҐЕКРУУРК|rppprpprnnnillllhihhikiiikmkhgghkjjnnorqsussuuА{|}xГzy|uyvlmS#Ѕ√БhY\_acdc`ZZ_^c\X^`a____aadcda_\[[_^[Z[`[Y]ZY_\ZZ\\\ZUYWWYYWSUTSQWPOUP!3ЮИDPUROHJIDIKKJKJKOOWY\[XUNKIHHLC@DCBGD@@=A@@@<>?=?==>==<<<>@@@@>>@>>@A>BR$CrMCAACCCEFGGJGKPX^b^YRMJKIKIJHGGGHHGJJGJJJGFGDGDDCIGGGGEEFFGGHJLKIJIGGHHMD>&EVKKIIIIJKLLLLQWZ_ccc\VROPMMKKLLLKMMJJJIJKKJKLHJHHHJJGIGMFCGIGGIIJJJHHHLKJKMMJIK@*EGKNOOMOOQRVZbfhgaZYYMRVQOWQPQQOOPOOSQPRSUVSRSRQPNNONPNOPPQOOMOOPQQPPNNPQQQSPSSSSNLB;2:HMW\_eeeccc^YWNQSQTTNNRQPSSQSQNNPOMNLNQPPNMLOLJJJIFGGEGFBDBGEBDGGDCG>KIHHLLKKMMNPNLZ4 Aqb_]ZYYTTPSTO_SSRPMOMJMMPTMKMMMNMMLKKJMLLLMMKLLLMJJLJMLLLLMMNLMPQPNQOQQQOPPTTTTTRUTTURRRPQSQSSSSUWUXX[[]dy£√ђ°¶ІІІ®¶®©®©©ђђђђђ®≠≠ђ≠≠ѓѓђђѓ≠ѓѓѓЃ∞≠ѓѓ±±±≤і≤∞±±∞±∞ѓЃЃЃ∞ѓ≠Ђ®ЩФMqЈЅЅ¬√≈√√√√√√≈∆≈ƒњЮN:<76620/3101111311121221022154211'12112/162013*222131444133113345;43552432564885283554421234431225456559<4N≥–°VSa^YZYZXUUXWQO^NVQQPQUVYVSVZYXVTSUURUVUPO_. eUMNNMRNQPPPNNROQQPRMKKMKJKKIFGFC<AZGFGEA=><@?@@=AB8=AJJIMPS]cgnlq{}БЕЗЗЗИИЙЙЛННПМММЛПЛНННПУЛЛЛЛНИПЛ5>•РНУЦЧТЛЖБ}xtutstxrtrrqqnnkmrmmliliiiihhdhhjjjhjkgkkkhmgkkpnntusytyzЖY*ЩБnYjhhghf`\`i^g^\gedbb__`aecee_^\\]\ZZZ\XX[ZY\^YYZ]ZZXYXXZZZZXWUUWSTRL*•ЙUQWUSQOPNOQQQSQQTV^__^ZYSNNHGHFHJCBDCBB>@>@>>>>>>><<<<<<<>B@@@>>@>>?BBDW$OrPE@CBBCDDFFGJMTY^k\YZLHIHGDCCDCGHGGGGFFGFGDFABCBCIIGGIDGGFDDGDHJGIIIIKJLTC*"J]OKKMJJKMMOOPMX\]cca[TQOPOOKJJLHJHKIJHGGJKKMLHHD@GGIFFFFIFIJIIGCEIIHLJMMMNNMLIHH,UHLNMOMQRQUWY_dig^ZWWOMSPCUPPQPNOPPOQPQRRRRYRRQPPNNPPPNOONQOOOOPRQPPQQRSSSUVQSUUSOJ?5%7OMW[]cefac_\YVPSQQTUNPSPQQQQSQOOONNONNOMMNNMOOLLLJGGGGGFGGGIIFFEGGFGIIIIIMKKLMKMKJL`/ Ie_^]ZWTRSQOPNaoOROILMLJJKNNMMMLLMQQSQOMPPMMNONOOOOLJJLLIIILMLNJKINMLMLMOPOOQQSRRRTTUUFRRNPPPQQRSUUUX[Z]]aZ|¶»ЂЯ®Ђ©¶І®®ђђђ©©≠≠ђ≠ђѓѓђЃђ≠ѓѓ≠≠∞ѓѓѓЃЃЃ≠≠≠∞±≤і±∞∞ѓѓ∞Ѓ≠ѓЃѓѓ≠≠©©ЩЛC&uЊЅЅ¬√√Ѕ¬√√√√≈∆≈ƒјЬO998444446424441643461233112142152/021121164231)13413.132344112343342443434514<35552543443324621525557649:>N≤∆ЮWX^YXYYXUTRRSNMWMZQPPQUMWUUWVXVVTTYYYZZYWPc* h]QRQQNQQRRRPPSQQQQPKKIMKJJKHIGFD;8OCCEC>==;===<<>><<<=?A?:AEKLKLKMV[[bjoruyz{АДЖГИЧЗИКЗИККРКНТНММЛНЕСК87°УЛУШШХСЛЙГ~}z|zztxututrrrsspppprpnmmmllpplllnnmohkkhhgghhdiljkhillorZ%!ГАzsroАr~ВqБlmwcsg]fd^gbddddhjjlggeee_a^^^\Z^\^\^ZZYWZ[YWYXYY[[Z[XYZXYWI*≥М_ZZXXXSSSTUWUYXUYZ_eec^ZXSSNNNLLMG@LLDDDCCA@@@BB@@>><<><<<@><<<<>@BBBCDU XpOFBAAABDB?DGIJQYZf`WXMHHFCCDDGCDHHGDDFFGFFBDBBCACCDCDGDFDAAADDHHGGKGCJJHMI(F[NMMNMMOMMNRRTX\]eed_YRQRNQOMOMLLJKJKLHKKKKMLLJDDDDDDDEEKIGGFGIFIIGDIJMMLLLKJFGF.OLKMNOORRRYZZcmkjcZYXRQQPMVQOOPQRQQQPQPLONNTQQLNNNNPPOMOLQRQOOLMOQNPQTVSQUSWTTSVUOM=.!4NNZ\acffci_\ZWTUSSQSTSOQTTQQQPLMJJMLNLONPOONPNMLLJHHFEGCIIIHGFCGIJKKKIMKKNKLMMMNMIS[/ %She``[XTRRNLNO]rQNNIOOOMLMMMMLLLJOQNPQOMONNNMJOOOOOMMMLMLMMRRNTMMMPMNMLMQOOSOOSQPPRRPRLPPONPOQQRRTUXXZXZ[]XБђ∆¶°ІЂІІ¶©ЂђђђЂ©ђѓ≠ѓ≠∞ѓЃѓЃѓ∞∞≠ѓ±ѓ∞∞ЃЃЃЃЃѓѓѓ∞ѓ∞ѓѓ≠ђ≠©ђЂЂ≠≠©ђ®©ФГB% rњ¬¬¬√ƒЅ¬√√ƒ√≈≈≈ƒЉЧM7343434235334433304/03121114220>72332224343221202124111133111//3//0431444531484655453241331103255579787=<<<<<<<<=;<<<<<:8=?A>A?@?CGDDQQ]c_]`cehlpАБ|ГА~БУДКИККИЗЛЙМД<:ЩУЛТЧЩЪЦСПЙГЗГБДВ}}y|}yxzy{vvswutusssrrrrrnppproqoqqmmkkiiinopnijljlza$#ґЬ}utppoornvru{wВБ|sx|uurnnjel]lgfijcbcbcaaa`ba___Z^[Z\ZZZXZZ[\Z\\\Z^\cB<њЧZ\]ZZ\WWWU[Y[]XX\\^ehecaZWURPRPMMKILMJIDDGDDDCCECCCCCACB?FLCA@>>@BDC@@GR\nJD@=@AAA@>BFGLNX]`^WUOJBFCCDGGDDDGCACFFGFFDGCBC@CBCBEJFFBCBBGGJJJKJHGJHHIBESIKMJLOQLLMOPRVZ^cff`WRSRMQQMMOMLJJJJMJMMKKJJLLJJJHDGHGHKIGGFGIGMJIGJHIJIHIIHGD@+HEJKNPPPRRWVZcomicZVRROQQMTPQQQPTSNQNPQSQPNNPXOMPPNNNMLMLOPOLOMMMOMPQRTQNUTUQTSUUUZ=)"1PS[\aegfff_ZZWWVVSSUTPQQPUQQQNMNMMNLNLOLNOOMLJHJGHHHEEHBCGEECBCHIGIHKGKIMMBMMNNPNKMR. (Roe`a^ZUSRNNPSbmSNNROOOMMMNMMMMJJONLLNMMMOMMLHMOOMMLMMJMOPPRRNNMIMNLLLLLMPSQQOSRPRTTPRTTTPRSNRTSRUUUUUUW[]VДЂ√ҐҐІ®¶•ІІЂ®ђ©®•ђђ≠≠ђ∞∞Ѓѓ≠ѓ∞∞ѓ∞±±ѓ∞∞ЃЃЃѓЃ∞∞±±±∞±≠ђ≠Ђђ≠≠≠ѓ≠≠¶£ЧВH! ДњЅЅ¬Ѕ¬ЅЅ¬¬√¬≈∆≈ƒЉШO45322132141111030.323102121211241334342334422323311321433311111721133237431133343463334/3331.3555575188:90?ЈѕЭ\`\YXYXXXVTWTSQZFUSQSVXWYYWWYUUWZWWUWYY[YU^2 hZMKTQPQTSURRTWQSUUSSTPOOOMLKIGDO7.OFCFCCA>=<<@<<<<;<==<<;<>?A>=>;=?@@=FBPOOMIJC@CBB>ABFGFGGGJIHHHJKKB!M]KKMHMNPLMNKMNVYbcfaZWQPOINMLLMNJIIJJHLLLJHHHHKLLJHJJLJLJGJIIGIJPMJMMMMKMKLLMHDA*TGJMNOMMPPRUZagif]YURQRQRQWOPPTQTQNQNMPQQSRPOTPQPPPPPNMNMMNTQWMMQPPPQQQQQTTTPQQPOM^;1LVZ]_dfcc_^YZVVQVSVVTPQQPSSSQNLNONNNRUPNLNPMMKMLKJHHGGGGEGFFFFEGEBEGGGGHKMAKKMNPNKSM,%Nr``a\YVSNLQVU^qPMNRQRNNONOMNMOMLNMNMMNMOMMOMLMMLJHJLLLMOOOQPMNMLLLHHLMLMPROOPSQRRRRRTTTTRQSRPSSUURRTVYZ]dZИ©Ј°£ІІ®®®¶®¶©®®®®ђђЂђЃЃѓ≠≠≠ѓѓ≠≠ѓ±ѓ±∞≠Ђѓ≠ѓѓѓ±±±∞∞ѓђ≠ђђ≠ѓ≠ѓѓѓ®ЃХКPЛј¬¬√√ƒ¬Ѕ¬√ƒ√≈≈√¬ЊЩQ7:543131031010010211124101/121120/1322010352-3232//01131331/1/132363333:343644366676545533334455745225574+?∞—ШR]ZVUUTWWOUURTVTFUQSTTXZYZYWZZ[[[ZZZ[]]_b[d4 lXNQQPQQSRMQRUSPQSRQSTPRPNOMKKKGM40QDFGDC>>;=AA<==A=>?>==ACFMKOOSZ\ZafflД82ЙПДЕКПТХФУСРПМЛМММНМЛЛЙККЛКЙКСПНЖЗЕГЕЕГx}v}xvyprsswsrrqrrrxrnronrqrЗm!≤ЫВ{tnppkolonnnkknoplhrrptvtwv|zx|xГАqЖrhuhgoakeehYhfdffcfferd_^`b__\\`@5—Ц\`_^]\Z\YX]]^^`_daaojlkh_dc\ZYXYZWVQQRQPMMKHFKJJJHIEGGGDDFGGGJGFDB@?A@KZ lzMJHBBACDFEIIHKRW_fZWRQLGGHCCCBCABBC?BBBB>>A@<>><<>@===@@>>>BBDDCDGGGHGIJL@"S\HHJLLLOMLNMNKV\cgh^ZWRRPJLMMMMKLKLQLLMHJJLJJJKHHD@GIJAEJJJGGIJMJJJKKMMNMNNLLKGA,\ILPPPPPSTYZZaggg^XURQRQQPQMOORPQPMPMNQPNONNOUJNPONONMNNNOOOOROLONPTUQRQRTYVUWSSVL_1#7RcZ\_gefc_\VWQQQQSVSQQQQQQNNPNNOOOMNQRPPMNMKKMOMKIJHHHGGGGIIJIFGGFIGGLKMMNPMMLMPLLVM&!$Oi]^\VVSRLKPSQgrCRNNNORNNMNMMMPROPPNNQPOQMMQOMOMJJHIMMLMPOOQPOPNLMLIHKIIMPMNONPOPPPNRTQRSTSSSRTRSWTTRURY]_ZКµ√•®®®©ђ©¶©©≠©©≠≠≠≠©ђѓѓѓѓѓ≠ѓѓѓ©ѓѓЃ±ѓ≠≠ЃЂ≠Ђ≠ѓ∞±∞ѓ≠ђ≠≠≠≠≠ђЃѓЂІµПИMЙ¬¬¬√ƒƒ¬¬√√√¬≈Ќ ∆јШQ8966446334221//13321/37/1312>11522131210/121/2121//11133/3313000135326643446663444747565344894575436777:;/MѓЋЪGdZWYTSTRQSTPQQSEQOQUUYZYZ[ZZ^][YZ[^[^^_a^f3 o]QTUSUSUSSRRSUSSZRRSSMNMNPNMKKHJ5/TJFGCC==5=?A??@AA=<====A?A?A?C>=ABAEIJMMIGBA?<;;<<:<;8;>>@<Сx^_\[ZZ\]\Z\X\^\\^^^ejnlib___bb_\_\[YZZZYUWWJPUQQPMLKKLJIIHKJKLKJJFDCCBHOpzKGFCDACFGGKIGGPX_cXWQLHHGGGGAADFDGDCCDCCAAA@><<>?CA>>=A>>BB@BCDCCABEH@#PUGGGKJHLLKMMNPSYafa^ZUTSNMOMLMKMMMNVOMLJJLMJJLLJHHGGHGHGGHIIIJIIIIGHIKGILLLBLHB<).GGMNQQPSUWX\\gigi`ZUURQQRSRQQQPQPMMPSYUPPNNNNQNMNMMNMIJMMNMMMOLJQOORRORQPTVUTWSSTOb3"7RZZ^aghhcb_\ZUSQSSQQSQSSPNMMOMNNONNPPPNPNMIIIKKKGCGGEGGGGGJIIGFFGEIGELMMPNPLMMLMJJXV#"!Uj`_\XSQLQMWQLaoOOMMNMLLMMKMMIMNNMMLNMMMOOOQQMMLJIIILNMNPMPRSSSRMOMMMMIMOMMRONOOPOONQUQQTTTSRRSSSWSSSRMZ]a\ЖЉ√Ю£¶І®©®®¶®≠ђђ≠≠≠ђ©≠ѓѓЃЃђѓѓ∞∞ѓ±±±±∞ЃЃЃЃ∞Ѓѓ∞∞±≤ѓѓ≠≠≠≠ѓѓђђ≠ЃІ∞СzBИ√ƒƒƒƒ¬¬ƒƒƒƒ¬≈≈≈≈љЧN565314913432/11232211241113363155555211/0311232210313134116331211123244314434446437697445568957742485578>9L≥ћЪKe\Z[ZYXUUUQPST[!ERNMSWW[YYZZ[[]]WY^[Z^^^[^a:  qbPTUUSUURTSPSVUXZUUWUUQPQOQQPNJK9!8GJHHCADA;==?AA?=A=>==???===<<=?=AACCKOONJKBAA=<=<;;=<=<:<==9>=>><;>;//pMIFINXbfoqqquztuy|А~ДВЕИЗЗЙПМПППММУЛМПССМЛЛЙИККИЙЗЖЖАВВАА~}|zz||{Эd$•¶}|{uurrrnmnlmnkmnnnknllnnnknlonmmnkkkmprtuw{yy~s|{wyyxyutrmrgkkehcdh`:!PЅФr^XZZ`^^cY[\W]\Z\\\bgijfdbbbdh\\`\\]]^^\ZZYZVYXWXRPPPQQNNMNNOORNOKKPJGHOwАKIJDIECGJJKIHLPX_bYVRHHHHDHGAADFDDCCBABFB>ABA>=<MVGHJHGDJJKHMGRRV_a_^YTQODMOLJMLMMMMPNMJLLMLJKLJJJKHHHHLJGGJJJKIJJJIKHKHHJLOMMJF9).RKLMNQNORQWZbpiig_XXUURRQUUTQTQPQORUQZXRRPPNQPQPQOOQOJSMMNLMLKMLOMMMOLQOPRRQSQQSPLY4 9XXX\_fggcc`^ZYWSVSSVTTSQPSPPQOMNRQZQQQPMNPKKKIIJJHGEBBGCFCFFGFFFEEJEBHKKPMLIIMLLKLHQ%"#Xfeb`ZUSPSSYSS_hSSOOOMLMOMMMLLILJMLLMLLLMMLMMOQMJMMMNMPRRNMMPRMPMMMMLOLPRPPRRQQOQSSOSUSSVVVUVTUUWWWSSSSY]c_БјЊ††¶І•®®®®©©©©≠©©ђђ≠ѓѓЃђ≠∞ѓ∞∞ѓ∞Ѓѓ∞ђђЃЃЃ∞ЃЃѓѓ∞≤≤≤∞ѓ∞∞ѓѓ≠ђђђІ¶ШyBЗƒ√√√¬¬¬ƒƒƒƒ¬≈∆≈≈ЉЩP15321143342321/2123123143114300125341///01110210/2324136439442122235131214436446644445334568754545655567@ACґ“ЦP]ZZYZXYYYUTQOQZ!>_RUSZZ`[[Z[[[[_[^_[Z^[]__c> h^MSWTRUSQQPOPRUXXSUWXSQPMPSPSQMO5 CMPHGCAEC>@AB???<<<=<=?CCGKLMKGFB?=<<;69=<:5:<<>>===<:;;9,2eA<967=><<?BCCILLPSKHBA?5<;89::69==<===<::9;;<&4D9;<;;;;?;:9;8>BBFGKMMSW[`ehkmquz~ААВЖИМЛЙЛРИКРЙЙМНППМНЛЛЛЙЛИЙЛЙИЛЕК•\ҐҐЗЙЕГГxyzyvuxwusutrrrrpprprrptrrppommpmmjlnllphlnmohqutxvturtБxГЗ|НКЕGMФЗnbYcdhhhdhhahiegddhhigjigegea__^___f^^_]__^`[YZ\\\ZYYZZXZXY\XYZZXVXXUSdRРШXYSRRONMOJOMOSX[_a_YQTLLLKKKKFDDGGDDCCDDB;A@@><::><>>>>@>@B>>>ABAACDCCCBP@'ZRIFGGGGJHHJJGMRW\cc\VKOLJJLJJJGKKIGIGKIGIGGHGJIIIGEIICFGJFHHGGQIGJJMMPSLJMNNMLE8#2USNNOQQQRUU^agigc^ZXVTYUQOOMPPOMQORRPOOOOORQOOONPNOOOMMOQQMLNNNMOQTRRSURVWXYYWVSRPX/#=PSY^agicbaZXXUTSROPPPOROPPPPPPNMKNNNPNPPLMLMLIHHHCHJKGGFFEEEEBCCECFGGKKMNLJRRLLMNOUF#2Wi[^ZXVQQPNOPOfiOOONMMJLLMLJHIJLLOOLMMLMMNMMMOQMLMLLMNOPROOZRSRPNMLMGMMPPRRNOMOOMQOMPSRSSTTUSTVVTRSSWTYW[YWГЋљ•¶ЂЂ¶¶®ђђ≠ђђ≠≠ђђ©ђђђђ≠∞ѓЃ±ѓѓ≠≠ѓ©©ђђЃЃЃЃЃЃ∞Ѓ≠ѓ≠ѓ≠≠ѓѓ≠ђђђ©®§•ЪwE#И¬√√√ƒƒ¬ƒ≈≈ƒ¬≈∆≈ƒјЧN24964675465/1123301334344665211633320211211414340361111132213/23466312424545866988683644666775383355478;8@CЇџФM[^ZZZWXUUTUUPUW =\PRUZZ[^[^^^^^_]^^]]]^]]ac< qZPTZXUTTQSSTUUUYYXUUSSTQOPOOMLJG*4]HEGA>@BAA??@BCBCAA@@?>@@@@ABCCACCDFKNQYSNKBBA6??9<<<:==<<==><5==<>?B9<<9GOPSZ]binqq}}ДКВВЖВДЙВЕИММЙМУЛММКНЛЛРЛКНЗН•\ЮҐППЛКЙЕБ~}|}}{xy{xuyyvrrtrrursrrsppoopponprrrurrrrrqruuwtprrsqrtxz|КУM=qnneekpppuinr`ljchbhhhkghghjggdbfbd_`b`^_\^_^^_\\[\__^\ZZZZbZZZZ\\YYZZXX_PЩС_]YXXRQQRPVST_Z^cc__\XQORPNLLKIKJLHGGHIGFCDHFA>@>>=>@>>><@B>>>A@AAAADCD@M2%_LDBCCDDDDDGAHNPX\]]YUNQMJKIHJJGGIKIIKJJIIJGIGIIIJGJJIGGFFFFFFDMGGGGIJJOKIJLJGJ><4JJLOOQQQRTWZ_cfic_ZXVTWRPQQMRRQQURRTRRQQQRTRRRQOPOMMMMMOMOOMONPPQLOPRUWURVVVWWMVTSY/ #AUPY^^fgffc]ZZWUUUUWSVVSSQQPPSNMMLNPNQPNMLLMMKHHHGEGDCBCCEGGEBBBAFFCGGKMMKLNRONOLNOVM&,Yr_\ZVVSSPQSRSlcLRNMLMJJJLLLJLJIIOMJLIFLMRLILMQNMMLLMMORPNMRPTSSMNLMHMNNOPOSQPSLMUMLSSSSSTTWSTTSSSRTTSSTZXYБ–ЅЯ¶Ђ®®¶¶©©≠ђ©ђђ≠≠≠ђ©ђђѓѓ∞∞±∞∞ѓЃ∞ѓѓ≠≠ѓ≠ЃђЃЃЃЃѓ∞ѓ≠ђ≠±ѓђђђђ®®§¶Юt>/Й¬√√√ƒƒ¬√ƒƒƒ¬≈∆≈¬ЉТN368755544320212232/12433455421/314653331200044131183133444/4723435421221021243383433244366'983485577578??CA=ABDABBABB>@@>@BBBBECCDCKLMPQMIIBA@=?B:=A=>><:<>@@=7=A<=M%8M<;>BDHKPMKG@@KSZ`choquvy{{АДЕЖИЙЙМЛМПЛМПЙЗ°[ЧЃЧХТПМКЙИЖЕЖЖВВ~В}||||y|ytvyyyvusrrpppppprrrrtrrqrprrsrsrmmorrrsz~ВЧЩP<’wskmpuvrvuuxyuytprplnec_Z]l\i_`o`ieehcca`^^^^__[Z]`_`\ZZZY^\\ZYZYZ[\][ZdT"££hb`]\ZXYXXYYX\^cjhgd_\VUXVUSPPPPLLIKLJJIIFFDCC@A@>>A@@>A>>A?AAAABCCDDBF@N2'_PCCFFDACDCDCGMPV\]\YSOQJIHGDGHDDGGGGGGJGIGCCDFHKIKGGGGGJGGKIJJSHIJJMMLKKKMJJMN@<5KHKOQQQPORUY^acgc^YYTQQROMQQRRQQRRRRUTUXWTRVWVUURPNOOQQROOPOQPPPQLNRTRWWSUSSSVQTPMU.! BOTV\`gfbdcVYZYVVUWWUVVQSQQSSTQPQPPQPQPPMNNPNLIHJGGFFBDBFKEGCCBCCFCCGFKMJLLONLLMLLNOC-+Wo[`\YVRUSSSVOnjNSOMNMLOMMMMJLMLLMMLIIJJMMILJJMMKMMMNMPOMNMONPPPPNMLNMMMNPNPOQSOQQOQVTSTTTTTSSTTSVTSVTTW[ZbДџЅЯ§ІЂІ¶®©®©®®©©ђђђ≠©ђ≠≠ђђ≠∞ѓ≠ѓЃЃЃѓѓѓ≠ђђЃЃ∞Ѓ∞≠ѓѓѓ≠ѓѓ≠≠Ђђђ©Ђ¶¶Яp:/Мјј¬√√ƒЅЅ¬¬ƒ¬≈∆≈≈ЉФM8687576354101/1123111121142120/1118122321///43112342144654245344443123444222236=333333443637666348975567>5PЇџЙOQ^\Z[Z[YVWXXWNZ 6@C???=<==>==7=A<<:<<9;:<;<@BGILJD=?;>>>>5ADD@IPV[YeotrqqБЕБВГДЗЕДЕЪSН£ЩФПМРМНЛЛЛКЛККИКЙЗЖДДБЕЕГГА~~{|uxurusussusrsprpprrrrqoommimssw|ВЙЩФGG≤Йmhmmoprqpprwx|{uБЗxЦГНГzЖyxrjk`hhhijhggd^^\_]]]b``b]]][Z]]\[Z^Z[Z_`^\gO©§kadaa^\`^^_^\_dfqmkhdc\\\ZYXVVVRQQMLMMLGKGHHFFBBCBCFC@@AC@@AAABA@BBCGCDCG5'\VEBGGGDGGHGGILMV`g_YVRMGHJGCBDDCFECFFDGDGGGDCDDGDDBBFFFGFEHHKHAGIIJJMJNNJJMMPWC5' 8IMOPSVUQQXXY_cdgc`XXRQRQPMPPRQOMQRRQQORTTTTVVSRQTPNONQQUOQRQOQNPQRRSRRWXWWVUVWVVUSR*!BTUX[^ee`]\ZYWWUVXWUVUWVSELSROSQSPNPNNOPMNNPOKLLMKJKIGGFJSJGEECHKCDDIIPMJNLLNLJKMJJH?,$*XdZ^]WVRROOOMRjbRJNMMLJLMMKMNLMLJLLJKMNPPPNNLLPPMRPMPMPPMNLOPOOMMLMMMMMPOMMNLOQOONNQYRPRTSTTSPTTSVTSTTTZ\[eЖ„√§¶¶©®¶©©ђђ©£ђђ≠≠≠ѓђ≠≠©®≠©≠ѓђЂЃЃЃѓ≠ђ≠ЂЂЂђ≠ђ≠≠∞≠©©ІҐ°§£І©ЃЂ¶ЂЯg5/Ц¬јј√ƒ√¬Ѕ¬√ƒƒ≈∆≈√љТK576545223531223235555522210010/011112212/1/121102321031335534433343133412111249831332267796:988646765958E5IЈ÷УMRZZZ[YZYYVYY[VW;YQXYZ^]^_^_aaaca_abcfbd`]h; mhWVVRRSRPSQXSRYWXTTTTTRQPPPNOMKK5)NGJJFBBCCCCCBBBACCEDBB?ACCCAABFGDIILLPRQPKHB@@?>==@A?=A=??=@=:<=><FGECDDGGDCCC5(cfJFFJHHHHGLGLLMV\c^YUQKKGLIDBDHGGDDHGEDDGGGDCDDCDCA@BBBCBBBDECFЈўФV\^[][[][ZZZZXWcCBB>ACFFDGGLLQSSSNHGC@@AHBCDC?BBBCCC>>EAA=>O=><<:<<><><:77:<@<<<=<>=?<=AACKNKHA@<66987:7999:;;<><:?CF>=BFKMQUW]eN hТ~~|}Д~АВВВВЕЕИДДЛЗЕЙЙФЙМУЛНЛНХСПФРУМММЙМЗИЖА~~|}|{vzyxxvuuuss|}ГКМУСР@DµЖppmmhlnmjiknnljjlllnnporrrrruxvz|wВ}~}Аwvwsoofdgh^U\r`rmk{eerggjge^da]dF ±Пh_b``_ac^^_^^abeqmmokqdc__^^_`\_`_\ZYZ\ZXXXRRSPNPMKMMKKKJMKLHIHJHHKJHGFHJ;'iZGHHGDGGGGIBJMOY\\ZVUOJJHGGGCHGGGGGGJGJJGGGGDGGDCCCEGCBBBDADCCACBCBCGJMIFDGGJFF8;PMMMNMRQQUUZ`ceec^YYOTVWVVPMPQQQQUTURPXRQUUQRQQLMOOOMOOOORQQRQQQPPPQQRWQRUUSWVSSVKI*#GQT[\cebb_^\ZYWVXWWVVVURSZVPPPWQTPQPMOOMLMMOMLOLLIKICFFFGFG>EGCFGFHJJMNLLLONNJLLLNMPC-(/e^ba`ZTUPMMMPVc]OOMJLJJHHINMJJJHJLLJLJLMMIILMLMMMMMMMMMMMMPNMMMMLKKMMMPRTMMMMMLOQSOPMOOQSTTSSMPPPRQPRRSVVSfК–µЪ¶І©©®®®®©®©ђђђ≠ђђђђђ©≠ѓѓѓѓ≠ѓѓ≠ѓѓ≠≠ЃЂђЂђђ≠≠Ѓђђ•†ХГzЗСШ•¶©•ЭЭj,CЪњЊњЅ¬¬¬¬√√ƒ¬≈≈√√јРI3433355332125.4311922/341111224441335432053322/121220343644222331131343123110100115401333664443376446697<>>@=<@S':=<>=<78>;<99==<>=>==>ABHIHC@>95696777775597:<;;<<<<;:;;>=?@CLG#]bZZ^`einmqrsx{ГДЕИЖЕЕЗЗЗКИИКЛНМНФТЧТТФФФСПЛЗЖВЖЕДВББББ}||~|uАБЙЛРТТФ?@ћДrrooonponnnrnlljlljonllljkjlnlpprqgrrrАtr~t}ЛtЗАyВxxzlqhejejkkeegggggenK&ЇРehdc`^^a`ae``a`chhoohhcb_]_`_c``c```^\__^ZZYYXUUWURRSQQPRPNSMOMOMLMOMKKHL;(ueMJJGGHHJPLJOOTY\ZXVRJJJHHGDACCGDCFCGGGDEACCDGDDBDDBCFCCCC>DA@ACCFDEJIPJGGGGFDJ<>WJIMMKNPRQRX^ccb_ZXXKNQSVVOKPQQQQQPQPPQSQUWQRQQPTROQOOOQQURRUQPPQSTRRRURUUSOSVSVSQP+%FMU[]ccaa^\ZZYVVWVVUVVUOSVVSSQWTTQRRPOQNNNNOMMVNNIKKFFCGGIIBEHGFFHHJJKMKKJLNLJJJIJJW?( 3b_Z[ZYSVSOONQVibSROJMKLIJJOOJMJJLMOMLMOLLIILMMNMMNMMMJIJIMLIHLLHHILKPMMOOLLLLLMLMOQQQQOQTOQQQSSSRSRRSYVYZ\mМЌі£ІђђІІ®©•¶¶®Ђ®©ђ®®®©©ђ≠ѓѓѓѓѓѓѓ≠ѓ≠ђђ≠ђђ©Ђ©ђ≠≠©ІҐҐХЛКЪМЖЮ§¶©£†h-PЯњљЊЅ¬¬√ƒ≈≈¬¬∆«∆∆јТM544448523323434212431353111/112320321332133211112143014314322334343113344210112444442921144544436464345883MЈ«Ф\`d]\]]e^__]\XTRKjYZ]_``ac_aa\`caacacacc[YfM c_QTWSQTURTUTXSSUYVTRSSSSQNNOPNIY7$JKKIFAAAAA>CDHFFCFFCCAAACLDCFHHCDDHLLMPQRNIFC@@@BBCABABC==<<<<==<8@E+;I><=;:>>@==>=<;:<<<8<<=;C?B?AAHLOMJGCG=:9:9:8<7545887:979<7::95699:8;<6"OC<@EFJJSSTUZ\bfikprz{{ВЗЗДДККЖККМПСПЬТТХУФУСРЛКЛЙЙММЛЛЙЙИЖИЕЗЕЙИЛПЦШҐР>EЊЗrrrroprprrnppoonnprrpnnplnllplnqomgojkrqmqmptt|z|ААВ}||}usvtrsdin^ihhfkC)єґХ]g^^_bbfdfebddaihjljhgeedfneeeceacha\^a_^^^\ZZY\ZWYZWUXXUS\TRRSRPPSPOMJO7,БaONPKIJKJPPOOQX\`]\XUPKONMJHGDCGDDFCFBFCCCBBBB@@ABB@BABCCAACC@>>CBCDCGJJHHJHGEL5"@THGMNNPOPRUZ^cib^VWTUPQPQRQOPNPNONNPPPTRPPRORPOOPQOQMMLMMQROPQPPQTSWURUUUUVUWUWUVWN-%FTXZ]ac_a^^YXWVSQQRRSUUSQSSQSQTQQNOPONQTQQNONMNNMLJHGGJKGIKIKKKHIJLMLMNOMGNNLLNLIMMX?"3[gZ\ZYRSOLJKQWfZSJLJHKMJLLMLMMIJJLMMOMLONMLPNPRNNPNNNMLILNIIHJJIILLKMLMOMJMLJJLMMMOJMMMMOOQQOQQQSTRRTTTYYRdТѕЈЮІ©І®®©ђ®®Ђ©ЂЂЂ≠ђђ©ђ©≠≠ђѓѓ≠≠ѓ≠ѓ≠ђ©©ђ©®І©¶®Ђђ®•§•І•јєvВСҐ£≠•Ґ^/T£њЊњЅ¬¬¬√ƒƒƒ¬∆∆≈≈ЅСM865446533211332323333441311./114225234431202312/2232211111113344332234321111224535865954467666567774445745Oљ∆Цbbb_^][```b^^YYSM`XZZ^acacaaa`bbabdccecc[[fM  heTXUUUUXTUUUWWT[YXYXXUSQRNNOONJR6$GMJJGCCDCBABBCBFBADFBBABCCCBCFFFHHHLNPPROLLHECBAB>@BBABC>?>=><>=><@N,<=<:=?B>==><<<<<<<<>=<<==@@?FIKKMJDD@9<=9<;'@BBCBDGIIHEDCGO- !1er[^YYSPOMONQWr]SNKJHGJHILJKLHHJFHIMOMNPM?MPRRSPPNNNMLNMNMLLLMLMLMLLMMMNMLQOMJOPMPNJOOMONMPOMNMORSPRSSMWZSjФЋЃ§¶¶І©®®®®©©®Ђ≠Ђѓ≠ђ©ѓ≠ѓЃѓЃѓ∞ѓѓѓѓЃ≠©≠≠ѓ≠≠©®ђђ©¶•ҐЃЂўа∆]XqҐЪ¶£Ю^* ]ђњњњЅ¬¬¬√√√ƒ≈≈∆∆»ЅСM5655332121/13535221/1311300/1122255357553334631244423211111233432222154021021133/4553642<45555:876764347;;Rј«Ъhiecbcacabj`c]YS"VhYZY^`cccace`a`]`caaca_]V]D c^QUUUWTXRUVWWYWYZZZUXRSQPPQQOMJJ5*GIJJIDCFCBBCDCCFCBDBB?B?AACACCFCHIIKLPPQONLIBF?AB@>AACB@AB@@A?A@@@@X'8C??=<=<>D@@BB>=;<<<<<<<<=<=>>?<=ABCGDJMQVVZV]_ckqsttАИБАВДЕЛЛЖИККИЙЛЛНЛНЛНННФШФТХШЫђП5 @іПАЖ}|~v}vxxzxvuustttrrprrrworoooprrrpponrroqoqqoporoprprqrssswwtv|ЕГПИC$АЧwr[[\efch\jjhkhioljjljjhfigehhdb]dfgcaadcgeceacaa^^_]^_``^\Z^b^^_^Z\ZZ`X\-EПlXRXWVTRPROPRXY^fab\ZRSTPPMLLMJMKOIGGHJFDGGDGHDDGDDFDDDCBDCCGDD@BBBCFFGDGFCCCHJ,!?A>>Z#7=A>>>@AAGBBCCA>><>>><><>@==>>?FILMKGCFA<@::989985;:;;>:<>=<;;<>D<==>>CADCGHMIIGIJLMQTV]aadgmouvyz~~ВЕЖИИИЖЖЙЛЛНСРТЧЮ§Ц.6®ТГЙЙЕЖЕЙГА~~|}}}xxtvvswuutrrrprrrrrrrrrrmqrpppoqrnprnqrqoqqrtzВЖИЖ}З?-Г{emltyxВyswwrrrqnlnnhjflkbkiihhfeceegdcbXcb_cc_a^ca__dega_^^_\``bda^_^^^X[+QЦr]`[\Z[[ZZYXY_\giifc_SYVTXQNPPOPLQLHJJMHJKHGHFGDGIDDDDCGCDGGFEDCGDDGGGFDGGGBCGV* BIEJJJJLKMOORZ\]\YSPOLKKKLLMKKKJMNMNMMMPMMMPOPRMQOMMOMLMOORMQOMMPQQVURUWRUUTSZUVURWH%%MPXZ]accc^\WWWVWVSSWVVMUUSTRUUVVVSSSQPSSSQSPPPPNLQIIGKQGILNNMJJKJILLJHJMNMPLLKKMLQJO;9ekY^\YUPSHPPPVfZSOJLOJJLJHLMJMMOLLEMVMMRPRPPPRPMKJIIIHDFHLIIIIIIMKMIIJKKKJEMMMMMMMMLHLMPRMWNPPMPPMORUVVY^GzЯћЃІ®¶ІЂ®©©¶ѓђ©ђ©¶ѓ©ђ≠Ђѓ≠≠ѓ≠ѓѓ≠∞≠ђЂЂ≠≠©©ђђ©©Ђ©©•ЮЬrx¶ЃФ/RkЯЬ∞£Цb% rґ¬ЊЊњњЅ¬¬¬¬ƒ¬∆∆∆∆ЅФG5873455343123553211//.1241364200023111003111131254423311*2354234465204455331322343585522455:554642269755?7Y√ Ыj^`cggefeecfc]g^]q`beefkkgfbd`egceeeeeec`Vh; k]QRVYWXUUXXUUSUYYUSSSPNMQPQNOJHE3CXIKKBGE=DCDBCCBCCCFBCBCCCCCECCBHCFFHKQQPNJFFCCCA==BAA?????>@@<<>@<@BDCB@@>>A@@@@CCB>@?BHKNNKJDC=<@:999:98;;<<<;<:=:<<99<:7794<<=>>BBCGJJMIGBBBDB<@@A>:C$5@>?<>><<<<>@@>@@>B@>@A@@CFC@BCHKMPMID><:=9:<<<;;<;<<<;<>C>?=<;<;;995;F7#:;8;<<><=<<>;<=>>=>>>CADMKKJHHBB?AA<<<@>==<=>:@CFFJJJQMGX`floptxz{АВЖТЗ#(ФЧЖЗИИИЗЙИИКИЗЙИИРЛИЛЛИЗЗЗЕЗЕГЕГААА|x}z{zww{xvywrvrtzvttvruwrstvzЕМШЧСЖ}r95ҐЖomkmookqqqrrpruww}zxxuБw~|pthltTng[pmjnhjniljghgggggc_cbcgba_^_^_a__b^]_c*_Ђtjbb``a`_haaccdjoqloogd`_c`\\\\YWYWUUSWUTVSSSPLOMOLLLJJGGKJDFDCHGGGHHHHGFHJFGIP'"CEEJKDJMLLMPTZ]_a^VVQNMMKGKJKMMMMIJNJKNPLLOJJOGGJHDEGDGHHJJJJJJLNJPNNNPPRQQRQUUUSQVD(/CQ[Y^_aca_^\_YWWWYWYVV\STQQSPSQOORQNMPQPOPOMLMMMPMLJJHJJILJIMIKIKKLLNNPPPQQLOMOTQSST8%>ij_`cZUSSOOSYZcURONLMMHJFFHLGJHJJGHLLMMPNMMMNNMPMLLLMMKKKJJLLJHLJLKKKKMMMMMLJJMMSROOMPMLMNNMPROMMMMKPSTX]Hs†Ѕ©£¶©©®¶®©©®≠ђ≠ђ©©©ѓ≠©≠ѓ±ѓѓ±∞©ѓ≠≠ѓѓЃѓ≠ѓѓђ±≠≠ђђ©¶ЭФВ}ХПzТҐ†££ЯЫY wєњњњњњ¬Ѕ¬ЅЅ¬Ѕ≈ »≈јУJ4554222411121112223/0111232334422223245246444455555/1323533443545233523333144/14695555555444667644447898C1a¬Џ•hqijjlikjmjjigmb#ameegijjkklkmjklgjgedcda^\h9m[QWZXYZQXXTSXXUWYXYXUSQPNPPQQONMEEaSKLKKHCCBBCFFFCICDCACCCAAC=?BBBB@@>G%:C@A<><>=<===>@?@@C??>A<=@BB@BDHLLLIFDA<<<59<<989;<;;:;<>>>@=<<<<<<<9=@><><><>>=>>>BACGIKMJHDCA??=<8<>?<5:=5><9DJMNNX\`fmtl'*ЗУ|ВААДГЕЕЕЕЕЕЙИЙЛМИЙЛЛЛМКЙЛЛИКИДЖЖДВГГБ|Г||~}xzzxzxxzxtvwurwzБЛХЭЩСЖyx7:іДormnoqmppmmnnmoorqprpqvrvuК}ЗПЙzztqpnpneenmaihfkkkhhihihfb`ccac^adb_ch'r≤tjeec_ae^ccacadhlollldf``ca_`_ae__\\ZYZXXYYXXVNSPMNOOMMLNNNDKKKRLJKLJJJJIKJJLH@/*=CFJHGJLJJOQV\`]`]XTPNKKIGKKKKMMMIJJIIJLIJLJHMHGJJGGHGKJGGKLJHJJKJNPPPPPMMQOPQPNPPWA%,JKUX\^acbY^ZZVVWWVWZWPYVUUUUTSSOSPPNPQQPPRPOOPNQPMMHHHLBJMJIKGGIIKMNNMMNPONLNLNQQSNM<">hcb_aVQVTRQVVXiVNQOMMPMJJLJJJLJJLHLLLMMSMMMLLLLMIIIIKKHIIKIHJJHJHHAKJKMMLMMJJJMRPRPPNMMMNNMMPRRPRRRPSTWZ]Tg≠√¶£®ІЂ¶®®©©®©©ђђ©ђ≠ЃЃђђ∞ѓ≠≤≤ѓѓ∞ђђ©ЃЃ∞≠≠±©ѓѓѓ≠ђ≠©£ЩУЙЫ®∞Ї±І®§ҐХZzЉњњњ¬¬√¬≈ƒ¬¬¬ј√ЅЅЊХI5661544212231302325243101354453332211421344444852662123364244244546664555335413448686363443432464555579;<'gј—®illjnnlnknlkkjffcodkllpnrrrrrrspnnkgjihb``eBq^RXZXXWTXTTTTSSSXXYXTPPNPPNOOMNN>BZPMMIGGHCBFFHFCFKHFFFBFECCEBADHFFBFFHINQQPJF?B@>>?BBB@<>>@@9BDAAB@@CH!@@A@>><<<=?@BB@@@@=@8>CBB>BCFKKMJGFB@><<<<<<9;;<<<::;=;9:<>><<<>>>>>;<<>@@A>>A@A=>AADGKPPKHCDB?B==>=<<;9<<9<:9:<<<:<<===>A5BF *MHUX^^ecb^ZXVQPQQSSSVVVQTUTTPPQPPONPPTSQQSSSSPNQPPOJJHL@JOKIMIIMKMMNNKMMPMONPNPSPQML< >e``__SQQRSPQT\cUOQNNMMLJJJGLLLLJLJLJMMMSNPQOMOMOJHHMMIIIIIJHGIDHGDDFJJHOJJMLJLORMMMMMIIMONMMNPRPSRPPRWYZ\Zeі√®ІІ©Ђ©ђ©ђђђ©ђђ≠ђ≠ѓђѓѓѓ∞∞∞∞ѓѓѓђ≠ЂђђђЃђ©ѓђђђ≠≠∞∞®¶ЯППЬЂіђЃ≠©£†Т[yј¬њњЅ¬¬Ѕ¬√√¬Ѕ≈≈≈≈јХK456358512244485454844413465555443121142131333341/321/23243233344456666555354313346464896699755444;75777<<@?<>@?==??>BI 2H<<>@@>>@<<:<=@@>:==<>>@BAA>?BDJJKJGFA@>;>===;:<9><<<<==<9::>>=@>@><@>>=<@=@A@>A@A?>@AFHKPPKGFFDCCA@?>==<;>=@<<<:<<:<<:<<:=<9=<;?>79;E1'KJFFPPMV\^_fiqsu{{}ВДВДЕЕЕКЛЙЛЛЛЛМПМУЙЙРПТЛЛЛЙККИКИЕПЖЖДГГБ}}}}ЕЛУЧФПГx: 3ЈЗlrsrqrrnprrooqoqqopoomrprpmhkmoppprrrutuuv{w~xАvyuu}ukm\bYP^aSe[Wh_mgfpjc!ДҐsheaeaccaecccbeggmmqojijjjeekfeggfhgcddccec_a^\_]]ZYXXYYXYWSSSQUSURPORRSSPQPMNO.%RSKNPPPQQQUVY_bbb^YURPMNVPQKIPKGIJIQJGIIIIIIJJIFFFBHCCDGHDFMMKKIINMKMMMPPSTXZ[fµј¶•¶©©©ЂІЂЂ≠©ђ≠≠≠ѓѓ≠ѓ∞∞∞ѓ∞∞ѓ∞∞ѓ∞∞±ѓђµЃ≠ѓ≠≠Ѓ≠ѓѓђ©®•ҐЧҐ•ЂЂ©ђІЂЯТXvЊњњњЅ¬¬ЅњЅ¬Ѕ¬√≈≈√ЊХM2574555242101532118665336424454764665543433464321/12121132133133254636535457546346463686877775444877976;@2_√–Ґjpssrqsrroonneca$irorruuuuuryyxxzyxyvroomhadCcfSZ]XXYWXZXXWVYZZZ[ZVSSTTQPNMMMNCGdTPPKHHCCCCCCCDCCGDEFBCEBEBFDDBCDFGJKKSVSPIDA@CCCCBBBCA@B@BCBA>ABCC@@@??>=:<=<=<9<:<>===A@BJIIJFFA@>>><<=<<<:<<<:<<<><><=>@=<@><@K. !G?=@@@@B?<=<@@@A@@A>>@@CHKNMLHHDAC@>?@<<<<<=@><><<>><>@<=??AA/$G><@@BBA<@B@B@>@BBBAABA@AQ ;J>>@AABBC>>@>>>><==<<><:====@?DHKKHDDABA>=<<<=<<<<<<<=======<@@=<=@<>P."G@@CCGDC@>??@@@AA@A@@BDDHMQMMIFCCC<=?>;=@<:<>>>><>@<<<><9>==>=?AAB?>=>B*'@<>@>@@?>@?B/V√’Ъrkrtqrqrrsrrsmio `uysy{{{~ААААГГГВВЖ~~}xДБO  xXVZ[ZVTUUWSTWUSXXWYZTURTQQPSPPPP3B_YPPMJFCAHKIKIICDCCCCCDGDDDAFJHGHEFHHKVRPMGFC@?=>A>=>=>>==>=@ABBCB?>D9O=>?@A@BB@@B>@@<>@>>=@B@BCHIMMNHCCC?==<<:=<<999:><<=9;;=;==:::<<;E2":>>>@@A@A@@CACEHHIONNQLIHFC@@@@@@A@>AAAA><<<::><>:>==>;??<<<><;A''>C>=>@=A=?@@CFDBKOJMMIMOCOWVZ]_cfhmmquyy{zzБГДЕЗЖИЛЙКИЗЧМППМХШЫ•ЩУҐН* 7©ТГВВДА~А|{|{xuwzwwutxyuxsr|ttrrrsrsrnprpmkllnplmjlllidikhnjppnuuyДЕЛБК|xB≠Мffehlakb_eYjhemcemfjrojlqjhjlgjefigedfgfdedcaacbcefca_^_`bbdb__a_ab___cca__[ZT%/g_Zb_^\^^^__bjojkhb^]YZWWPQOQQPNRNMOOMMOOHJLLLJKHGGMGCHJJGJLJJHHJLMKMMNMMLIKPQMMPJJ7 /LLQQZ^^ZWVQPOPNMKMLLKMKKIKLMOLMSNNNMMMNKNOPOMLLLKKKJJKKIKKIIJKLLMMNNMNNPNPPPOQPQRPXR/$I\]b`ZYVRPOSSVYeQNJIIJLJLMLHJLKKLMOJJUOMPLMPMIHHGIHIIEGHHHHLHHLJJJFHHHHLLLJILMLMMMMILMLMMMMMNLLNLMLJJPST[[U~ЇƒЮ†®І®©ђђ≠ѓЂ≠ђЃѓ±∞ѓѓ∞≤≤∞ѓ±ѓЃЃЃЃ≠©ѓ≠≠±∞ѓЃ©≠ѓ≠≠©≠≠≠≠ђЂђЃЃіЃђђ•ІИT}¬њЅЅЅњ¬њњЊњ¬Ѕ≈»∆ƒјФC/3663543541313864331275432361213033424222133305524441211181,/12//44468688779;::5688458554678649:9;8669;9<9XЄ„Чulrrqsrssrssrmnrcvrt|{|~~{АА~ААВГГГДДААЕЖЖI  !Цweca`[[ZXXZZ[MXZYZ[ZVSRQQQNSQPML9L6D>@>??>=>?=A>>=>=D><@@<>=>CCCBJKMQPKFB@=====::<:7994=<<;;<<=<<<==::<;J1'<<>><>><=>>?@>ACAADDHIMNNNMKIFCCA@CA@ACA@@@AA@A@5>@>@>@>>@>@@;<<<=;>!%K<<<>@>@AABCB@DEDJJFDB?ABBCA:D?GGFJNOQVZ_bfpmprt~|ББГБКЖЖЗИПУЧЭЧСЫТ&)ЬЩЙЕДИЙДЖДВДЖЖВА}~Б|}|~{r|zx{xyxvvtstrsrnrrrxrwnnnnlnjokjokhkjnpt|ЙЛ~x}c[Чu^sjrxlznsrhrrjrfgk`iighjjhiikjjkklmjjmjjifgigeeeefdbaa`dbd\ecaaa^ca__`aadcb^fT(3qc_ddcacaachhqsrqjhc`]]^ZXWTVVSTZSPQRQSPRMPONMNOKKJKJHJLLHLKHHHJHSMMNMNMKMJKLKKLMIO5$1EHPTY\^\\VRNOQNMMMHMRKKMKJJIMKKMGMMJJKKKKKLMLHHHHIIFFIKKKKIIJKLLMMMNNNMNMPPOPQQQQUYW/%'Jjdh`\ZWXPRVUV`iNRMIIIHFGHJJHIJJLJLOMOLJLJIMLFFHGHHFHGGHJJLLJJMLKHHLLJHMMLMMNMLONPMIMMLLKKJMMJJMLMLLMORSWTUzЇіЮ•®®І©ђђђЂЂѓѓѓѓ±∞±±±±≥±±±ѓ≠≠ЃЃѓ≤і±≤є±±ЄЃѓ∞ѓѓ≠≠≠≠≠ѓђђЃђЃђђ©ҐђЕL~¬ЊњњЅ¬¬ЅЅЅ¬¬¬≈≈ƒƒјТB376414212433--333243294643342434134636223344119534546444531//011/364766655588887344/3647668866946789788=D9aЇ“Щ{wuuvvttvvtsum~o#`Зwy{z{{А~~А~~АААДГ}Еwpe/  ,ІКsАА|rjgd^dbbZ`_^`^ZXVXSTSORSQPQ5;KVJLLINDCBCBBFBBCFCCBACCBCCAGH;CGFFHHKQUMSLJBBB?ABAAAAA@@BG>BBBBDBBBS>=A=<>=:<<<><<<=>AB@@FKMNMIFB><==:9=<7:99@:<;;;==<@>@>>>9>=>G3(C@<<=>=>G:9<==?@>@A>>AACIKMNKGCBA@AAAC@@AA@>@>@AAC@<@A@CAA<@@B@=<@<>=@<%)C<>>@>=?><<>>>ABBBBCJMMIGBBBBA><=>A@=>>==7BCAIKNQSU\^bglqrrt{{ВДЖЖНХРТЫН",ЕЭИЗЙЛЙЗЗИИИЖЖЗЗЖЕДЕГГЗДЖБ}Б}В}}zxxxvvvrrrtrrprpnnnnpnominmmmmosyЩЧКВy{`"q®hjlfnnnssxvzxzxx|wvyrkpjnn`llckfkkikiiokkljlnkhhgggeecadddgcfcbbcchcaeabbceecfU'>BC=@B>?A9@DJ>J@CBDA?=?=>A>=>=<6>>@>=:;>>ACADILPKHFB=<=::6<:9:7;<;==;<==<>>@@:<@@>ABA@DC>@CAFIJNNKGAAAAAAA@@><><<><>>@A=<>@=>><==C>'*T<=<>@>??<@@@@CCDDDGLOPNJF?BA?=<==><<<:985<<7;<>=B>BC55MIKPUXahfqorv{ЕЧЩВ$3yШЕДЙЙЙЙЙМЙЙЖИККЛПЛИМПЛЛНКИТИЖЖГББ}x}zxvuuuttrrprppppokokmomnvИФЩЛБ|vekђpmpopnnnmqqrsrsszwuГz|ЛtywrvtpqnmjhihcccbckikncigfpjinemlikdgfdgggkeegfegffgcgV,Gxkgiggqhhkhknrtttqokfeeb`a_a^fb^a_^`^^ZXYVVXXYYSRUPPPKLJOORMLMHRXOPPPMTNMOMMMMMKHIO5#6CIWSVZ\\ZVSOOMMNPNLLLKHGGHHMNMIIIFGFGGIKMIGGGCBEFGGFGCGIIGGGHIGHFJIKGHJJKLNNPNMNNNNO.!'MkaV\ZVVURQSUV]cNMIGFJJJLJHOLLLLHLOMMMMLLMJPHFFEEEGGFECCEFHEECEFFHFFLFEJHIKIDGMMMLLMMQNPNKLLOMMOOOOQMMOTYS_x ЈҐ¶®ЂЂ≠≠ђЂЂІЂ≠ђѓ≠ѓ≠©≠ѓђ∞ѓ≠ѓ≠ѓѓ≠ѓ≠ђ≠≠∞ѓѓ∞≠ѓ≠≠≠≠≠ђ≠ѓ≠ѓ∞ѓ≠ѓѓђЂЂ≠ГM ,ДњЊњњЅњЉЊњЅƒ≈¬≈≈Ѕ¬јУD2764440243433118=43353314664112/1343220131034122422223445.34444643447655;48564998<6687588:68888446848859@;[јЋ†ruuvustvvvtvsmly Yyrvz{~ААААААВА{sukK- !FMSZfkryxvtvyyАКw|utrolkhgc^\\^ZKQX.B^QMKHADDEEDDGABCECCECEEEEHFHGFFHHFIIKQUSTLGHDA@@B?===??<===>=>>>5<>;BM<>A@B@>;>=BFDGKMSLGFB?==5:::::56;<<<=<<:;::<>>:;=>=9>*'A@;4<9>>===C=>ABDC@<>CCFGJNMMIHIFCAA>>A>=?=@?=>?===><>@A@=<=>=%*K;;<<>=>=5>@@@ABCDHILMQNJD=A@>?@@@A><<:;9:479::;:?<<:7:<<<>=BFFBGKMPVVU`I&2fyzyВДВЖЕДВЖДЗИККПМЛНТНУФСНШЛЛМЛКИИКЗИИЕЖЕББ~}}z|xxrstsrtrmpokpor{ГЛУУЙБvv]`®zonmokkhdjjfllllokprrxrrwvБЗЕvГtМrm}gwlhn^`mMcb[pmeohrokjiijhimlrjfhhfhffeabU*SЗpjjfglhjjoomrrtyrqqkgighhhjehg_ggegbcd_^\[ZZY\YYZVVURTOQORQQQOQRRRSRKPOOPPPPPQPMPL7!=>>=>A>=<>HCDJ<<;=<<;<<<<>>;:=@CBA@>59:<>CDGKMOMGCA?>>:9<<<:78<;<<><=<=<<=>><:;><:>,%J>:9;<<>=>=B?>ABBBA:A@BCHJNMKIHIDBBAAAAA>><@DA><=@@AA@==?>?=<8%(Q<;><><<<7<>>@@>?CFILNONKF?@@=ABCBB@=<<==<69:<<;=>;<:<9;<<;:;==<<<9>@@B>A *]`V]fjorusyА~zБГЕЕЕКМЛМПРПРПМСРМЛЛМЛЛЛЛММЛЛЛЙЖЖГДДБ}y{{u{{ry{}БЖЛЛУЙrwWYЃunonmmliijjlmllrnhmnkplnrppqrtmtwr|txДzНЛЙВА~Вzsrrpnre`nl`ilbjlinmojlljkkjgcbJ$!ZЗmhjeffgilnmlorqspqsojjjjjjolllkjmgkgimifqeddaaaaZZ^ZYYXXWWUSWWUURQUUUWSPPSSUSSZVMJ4BILOY\____^XOSPOOPNLMMHIKMKKKMJIJMKMGGKJIKIIFEBBB@@@@?BBABBBCC@>>>>><><>=<<===><=<=?=CD@@>>@<<<9:9999::9;<=:<==>>==><:;>;<<>@:??B>?AAACBAA=A@BDKLPMMGGDC@@>A@A@@<<A??=?A;@A@AD>A@>?BA@>@@@@>>@AB??>CFHKLLMKD?>>>@?>@A@><;<;<;;:<=3==<;:<9;;::99;A<;;5;<;<9</CB<;BDGAGVZYceiqsuy{{ВВДЕКЛЙЙИПЙИЖИЛКЙЙКЛХРРЛММММЛККИЙИЖДД|ДВВБЖЙНССТНДwЗX!Y®wprpopnoqmlmlmkomhjhgljknljlpomppnfrrrruvxzxyuxА|v|АЙz|xx|lrrbrrdpapoommonoqgcE1hФ|bheeffhhehhgpprpiskhjljhjlnnnpjkgkklpmimiiiigffacf_\^^^`^^XZZXZRZ^XZ`XWWVUUSQRSMQ0DIMPW\``ac]YUTPPPOOOPNMLLLKHIMJJJKJNIFLMKMKJHG>EECB@BABB@@ABB?>ABA=B>>@@>@>>?@<<=M!JK@><=?=?==?==?=?A?CC>==B@?BC@BEJMZKGB>=<:::9889:9<<:<::==<<<<<=<<<::<<>>?BBA?@>A@A?=>@".KBAA@@@@CBCBBDFGJLLLLJGDBC@AA=@@>><:<;<<;8;;6<:;:9::8888;<;<;<;:;<<<<</<;;89<<:>BKNNVZ_aaedgkrtz{~ААИЕЕДДГЕЖЛККЙЖЛЛЛМЙЙЛЙММЛЛЛНЙЖЙЙЛПТШШХУК|}_[Ґ{uutrurrtrrpprprokplnlnmnkkjlnnpnmlolnporrpppnprrpsstttux{w}zz}|uzyurgehceeZaC!,≤кШffkksormhkmjoqrp`mkikkkhghmmmkmiikkknmgiiiljlffcffbbcbaccc``_`a^cc__c^]]ZZZYWYY]T1FIQX[^``_b]WSSSPQQPNMMOMMLLDNMKMPMKNLEKMMMMGGGECECEBC@CCDBBCCBC@CB@EECGHGJGGPLHHIJHLB/*JiSUUSPMOLKNJNiaSBMJHJHMLLMMHJLJGJMLMJJJJLHHLLIIDDEERFFFDHIHKJLMLLJHLHHJGGGFHLKEILLLMMLOOMMJCLLMMLJKKMMOVPbЕЉ∞£®¶І®®©ђ©ђ©ђ±ђ≠≠≠≠≠≠≠≠ѓ±∞ѓђ≠∞≠ѓѓ≠ѓ≠ЂђЂ≠ђђ≠ђ©≠≠≠∞ѓѓ≠≠≠ђЂ®ЂІЮ®nE >ЧЊЊњЊЊњЅЅЅ¬¬ј¬≈≈≈√ЉФG556445355564412244212452453011/123113411134331260546634864464353554333357775533556886336757977878957:98>A5^љ≈†zvyyxxzzxxxxspАv_uqvvxxyzyx{wuzsrrbO:)%cwЕrpidZY[Z[``cgghhhjhffb^\UTRNQQRWY[Zg6@gjgjlnmmzjnpglecb\\XWUVRRNMMJIMMJMMMQY^YQMIFCBCB?ABB?BA>>>AC???A@=AR!GR>>==?=C?<======A>?@><<<@?BBABFIMRKIDA>>=<<<;:;;;;;9<;<3===<><<<:;<>;9,(G><>@@B?ADBADFFCFEEFJMPMKJDCGCBDCCAA:<<>>A@BF=<>@?CC<<@>=?ABBAA?<>!/T@;B@AA@@>>A@>B@@@<<=>F<;;9<::<;9;<8<:<;:;:<;;;<278989<9<;;<<<<>=DFMPOMJMNPN[^^dgnxvsvxz}|ГГДГДЕЕЕЕЕЗКИКЛППЛНКЛННССФЧЬЫЫНЕИ^"]Ы|{~xtywttttuuvwwtrrqpqpjpmnnnprprppqnponpnnnmnnnnmnnnpnqrrrttvwy|uБГ|ПКЙЙ{~x~}G"≠≥Дselhikmininpnprnnnpmmnnnljllnllhjkhjmkcgggiih`eegfdcgceeggccfhegggech_bbcb`^^^ZZY4DNY_aefdcg`\ZYZVTSSVQQWMMLOJMKKKNNMMKIIHHKHGEEGDBABCCBBCDCC@BCC@ECCCECEGGIICMLEGJKMM@0(/KYUVVSOMOMLNOQkaSJMLJHJMKLLLHGHHJILMMKLMJHHJJJHADEDGHGHHLIIKJJMOLJMLVJJTJHJHJLIEHJIKLMMNNOMGEHHJHFIEJLKMTP`ЕЈ©ҐЃ•І®®©®©ђ©ђ≠ђ≠ђ≠ѓ≠ѓ≠ѓѓ±≠ѓѓѓ∞ѓѓ∞ѓ∞ѓЃ≠Ђѓ≠≠≠ђЂ≠≠∞∞≠∞≠ђЃ£ђЂ®ІЭ§jBFЬЊњњњњЊњЊњ¬¬¬¬≈≈≈√ЊТG255533.455443312301142124444111454217748332333252456333486664/53557334567677545255876465777737768;77:<8==8eЅ«•|v||zz|zzzzywr}s\rsyxyvyxxxwutspl]G3%(rzxtokg`\YZZ\\`abeffhgccb^^TQNQTQRXZ_^e5 9~ibddgbglhglhnjiihheaefe``]Z[WWZXWYYZ^Z[ZROJHFCBAABCBCBBABBPABAAB==OLP>A@AA=?==<=:9<<>==<>=>><<<8<<<<;96;9<5=<=>>@?<<<<=9<-,M@><>>=?C<>@?BB??ADA>ABEHJMMJIGCCGDCB@@AD><=>=>??A=<@?=BB;?@AAABCDBB?@CB@@@@<>@AC>BFCFDHLNLKGDBBFCB?AA@@>>=>?@?9<<=<><:<<>=<9<<A=<=<><<;J7<<988;87:;<<;5<>@CGJIC<@B5CH=AFFGJNONXdebkwzxyz~zГДДДЖЖККЛИЙИНМЛППСХ†ЬЪШПФ^g§ЖДЕ}}yz||}~|}|uxtrplyppnprrrppppnnnorpppnprpnjqqqqqqrrrrrqnrtr|А~ПЙЙИАy}P!%yМmlgpppnn`nfmokiklljlonmmenjnlnnlnkkjjlkgkgghhihhehgggihdfgfkffgfghjgaiehhfghddd_Z]7C\afeiiikjgb`^^\YYXXXTZSPOSJQOOOOPONKJLKLMJHFCEBBB@BB@CDBCBC@BCCEBCCGCEGEEHEGKIFKKHH@,$/RUXZYUPPONLMOUfZOMMLMJONLLMMHGHHJILLMLLMDHFHHHEAAFFEGGHHLLJJLLMLLLLLMGHMJJJLJJFHFMLIMIMNPMOJHLMMJJKFJJJMURl~ЅЃЬ§ЯІ©®©©©ђ©©≠Ђ≠≠ЂЃ≠Ѓ≠ѓ≠ѓ≠ѓ∞ѓ∞ѓѓѓђѓ∞≠ѓђѓ≠ђ≠ѓ≠ѓ≠≠ѓѓ≤≠≠Є©ЃЂЂ§¶§m< C†љЊњњњЊЊЊњЅЅ¬ј≈≈√√јУD57554314444435344133522542983324442465053324321222322235743586685787744763:7547575647444535416668<999;8<:9[ј√¶v}||zxz||||~zu}p $\rvuyxxyxxzxtsmk\J1"&^vuzuqmid`\ZZZZ[\^```bc_]]ZUQNNNQNQUX\Zg3;zrddeedffbaegjheefgdehijghhhjeeufhhgfhffa[VNPMKHAGGCCCBCBCCCBCBA@==?@?==?BFJMMMFC>>>=:<;3;<:;:58;99;<:<>==<<<:<=>>/2L@=<<=?CC:A@>AB?><>;<=<;<=A>7AA>AAABBCCCCCADC5M@BCCB@@@>BBBGACDCGFJMOMLGDBABAAB@@@>@><<>>><=<<:;:9<<><9:<<>@>;;===?==EC!;GB<<<=<;<<>@><>>@EGIFC=><:;<74:999973;@<@>KQQX\_`gjlpqsxz}ДДКЕЖЕЛЛМХЧЪЧЦЫdm£ЛИРЗЖЕГГЖЗЕЖЖЖЕДБ|Б}rzyqwvrrttrtrnmprrrrtrpppprqnmqqnqoprpppoomrty|ДПШПЙЕ}yrrsN"*Й†qjnortttprrupqppmmlf^hggYhckkmoksglrlnmilihkhijhfdeggiiigeboefgiilkigjhjtgglggld_`3G\`hhkpmonjigcb^_Z[[XWWWVVURSRPSSQPSMPRPMPNMHGHGFEECDBDDCDDFBDGBBBCEGCCEEGGGGEGGGGDC>(/IRUXVSNONKJKOSk\JLMJLJOONMOMJLHJJJJILJIJFJJHOHFECFGFFGEFJJJJLLLJJMLJLHGOLGFHHHHJHJHILLJMJJLLLLLLLLLLLLMPSKoГƒЂ§¶ІІ®©ђђ©©©®ђЂђЃЂЂ®ђ≠ђѓѓ©≠≠ђѓѓ≠ѓЃѓѓѓѓѓ≠≠ђ≠ѓ≠ѓ≠≠ѓѓ∞≠ђ∞ђђ≠ђ¶•§l/ G•ЊЊЊЊњњњЅњЅЅЅЅƒ≈≈≈ЅТC175333375575455677657443244555333323311631244334442394643/3588663558996794<<:99775977667326468858<78:;;<<;\Є√§s|z{zz|~~{~{xu|j!!awrtyxxv{wwtqliZH3 ,k~Вwwxuopkfeb^^Z\[]_`^\\^]ZUUPMNMMMMMRUYSQ1CZf`ddebccbcccbdbdbbb`b`aedbdddfkjjinkoolsfahZZVTXPOLFHGGBDDFACBBA@>BHZ==;9@B@A=><<<<==<=>>@>?@BBCCCFJMNMHCB@@=:6:8;;;;;88;;99;<==<=;:9:;>B;12K@<:<<@@?AA>>>A@???DCCCCGKMQKLHDCC>BBBA?<;<=;=<>?=CD5K@CCDCB>>@BDBCBABFJKOPPMKGDCBCBAC@>B?@>@>?C?<=>=:969<<<=;==<<><;<<<<=>=>7%2C<=>><<<>AGJJKHDCA><<;<<:<=:;:769<;;<"M[<=<;@>><<<><><==<<>@>>?ABBCCFIGNRMD@@B@=B<<;<=<;;2:<><=<;><:B<<7;<<>:.+O>><=>>A=A@@@@@>>??AABBCIIKMIKHFDC?@AA@AABB@==?==?>>=>?A?A?=><><@>>=<<::LBBBBA=<>>BBADB;CDGKOPRNIIFCCBBACA@>B@@ACFFB?>>=>=3<<<<9;=?<==<=4".C;:=<><<<<>=<<>@CFKJJIGDA<>=<><<<<99:99;:7;99;:<;99:6==A>;FMNNTVYacjry~АЕТZQЛЛЖБВВВЖЕЕЖЖМКИМКЛЛМММММИЗЙЙИЖЕЖББ~Дy|}|xyxt{wttrrprtrtxttrrpix~ИСЫ°ПЗАvrpjjI'0У£osomornmnjrpprtnxv|ВxБДzЗwБКw{~|ururponnnmmmqmmojommmmliknjhihhikhgjgghgglhffhhgd^9%Obfllpssrssqqookhjfjhehddcb`[]_`ZZZZZZXUTURRPPNLJJHGGFEFGGDFGCFBBECCEEGGGFFFGIGJJJHFC*5FbUWVNIULMMMISrVPHFCHHJMHHLHECFHGEDEHGHJHGHHHHHHDEIBJJGHJLLMMNLMMJLLMJJJHJJHFFHIHFIIJJHHFGHHHJJJLHHJHLJLMRkКљ©Я•ІІІІ©©©≠≠©≠ђђ≠≠Ѓ≠ѓ≠≠∞ѓ≠ѓѓѓ∞∞±±∞ѓ∞±±∞∞∞≠ђ≠ѓіѓѓѓѓ∞ђ≠ђђђ©¶Ґ£¶f* [±ЊЊљљЊњњЊЊњњЅЅ√≈√≈љУB195464433276546446/46664311457557766654445655355555555545333556:6964644354673;5415,68647779629767858<=@@C=ZјЋ¶ГГБББАААВ~|{vkdnwwyvtvsqog^NA*  -jБz||x{{xutplgeda\`[\\^\^\Z[XTSSNPMKNOSTWY`R0?k[\``bcbcbcbb^^^^\``X_^\[ZZ\^`b^[[]`[\[Z[^]]___```k`gj`jf`e\[ZZVRNGM!R[@CA@CBB=<=?@===><>>>@?AB?AC@CHCPPMF?>>=<>=<<<=:<=<<<<<<=>@G>?<>J/*G@>>A==@<;>B@>>>>@BABBBDDFHJHHFFDDDAA?@>AB?@<>?D=?=>@@AA<>A@@@?LC@CB9=@B@BA@ABADCDKMPPMIAB>>AA?FAAAB<<@ABA>=<<<>A>?>>??A@@C@@<<>AA><=AA:0C9:<<><<<<==<=@CFJNJIGFAB9=?<<>@>>=:<;:<978888868844687;95:;::;=BCBGFVYMWUHJxuzvuuw|~|~БЕЕДЛИИЖЗЛЙЛМЛМЛЛЙЙЖЛЙЙИЖЕЕЖЕГГ~Б~|А~}|{yyz}y||wwvtrt{АЛСШШМЕ|xrnpqE/СЩrrmmkrlkmlkijnppppqkrtstsvuty||Д~ЗzБ}ywvxurtqpnepojklojmmivkikhknijffigfifghggeeV;(Meciimprrsuurqqnkljkmkhhgggcbccfcc`bb`__ZZXWXWTQNOKJIHGHGGGFFFFFFGCFGGFHFFJIIIGLJIID<)!5JSXWURLNLLKKKTpWOKJJMOJXJHJHEEFFHHFFGGHJHGGCHGGG@FFFGJEHIJGJJJJGJJJLLLJJJJLLFFHHFIHHJLJIHIJJHLLLLLELLOMNJJoУј¶†§ІІ®®Ђ©©ЂЂ©ђ©©ђђђђђЃђѓ∞≠≠≠ѓѓѓ∞∞ѓѓ∞ѓѓ∞Ѓѓѓ≠ѓ≠∞ѓ≠ѓѓ∞ѓѓѓ∞≠ђІІѓ£g' k≥љЊљљЊњњЊњЅЅЅ¬≈≈√ЅљТG589775344355643223114436344323536774342267552275775577548613555:6746885353877;6435568866755458668:758:<@C5ZЊ—Ґx|БААААББА~~{tyq!"jvtvvxvxrpgcS:&.r~||{{{wwupnjgeb`b_^[[ZZZYWTTQRMMLJKNQUYZ^U/Ef_[_`aabbb_ba^`aa^`b]`^^\\]^```^ZZ\YXYWWYYYYWTTNUWYSX[Z]_]a`^[r^]dW_ZmKMDJHGG@BBDD>@ABACCBBBC=BGKQRKGB>=<69<::;>;;;;;9::;7;>@><<<AAAA?@A>>@BCKDBDDFJJPFFFB>DAA==>A><<<;@F?<=>@@>A>5A@@@@>@C?@FB?BB=@BB@@BAABAFDDJMRRPMCBBAB>=A??><<<<<<<=9:<=??@@><<>@@><<<<>:A>>>==A;!4H<<=><@@><@><=ACGMQNIIGABA>A<=@BBA?>?:7<998998837877<44588757992;;<13<@>=A;=cNSY]_aikhlruz|Е~МБДЕГЕЖИККИЙИЗЙЙЛЙКИИЙЙИЖЖЖИИДЖЖЕВГБББ~АБ}Бyxyy~ВКРСТНГ|wsprrB*КУqrnompnnpkjjjnnrpnlnnpqqrrkprrrrnrsuvvzwwВ{{|zЖuvzutmlhbeiMrcenansjrqnrmprknmkmjoX6.Oigfhhlmrrrrqlkhjkjkkkikijhecefgffgggcbcba_Z^ZXXVXRQOMLOMMROLLMLKKIKKJGKHKKKJIIMJLKI9*"2NQYUSOMLLLHKMTfUOMLKQSMQLJJJEIJHIIHFGGGGGFIIMEGHEGHGFGGHHJEEEHEEEEHJHIEHJLMLHIHHHHHJMMMLHGMIIMMJHLHJMOOPNEqЩј§°¶І®©Ѓ≠ЂІЂѓђЂђђ≠ђђ≠ђЂђЃѓђђђ≠≠ѓ≠ѓ≠≠ѓ≠≠ѓ≠ѓ≠ѓѓ≠≤ѓѓ∞ѓ≠ѓѓѓѓђђ®І®†g% mЈљЊЊЊЊњЊЊњЅ¬ЅЅ≈»≈√јУG499787366466764344;463334443/33311333113454323445555853366533533447799957577799447669989:77787699;84859B=-cљ–ІnЕАА~ГБА~~~tzx!oxqusttsoiZL;& *l{xБ|{xwwutrlkkfccb_\[[YYYTWTONLLJIILMVZZ^U-Gk^^`ababbbbka^_a``a^\^^^^^\``\[]ZZZYWWUUVZYVUQQMQTTNQTQWXYOZVV_YZ``dYaUYX[TTTLKOMJIFBFEFFFDCC@AB@>BGMSRKJDA@@99><:;=;<;;;9<<<:<<=9<<9;9<;7<**S<@@??=>??>A1BB??AABDFDFKKNNNFFFF;DBCA>AB><<<<@>=<<<>A>@@<<@>=>@AABBACDDJNPTQMGCC>A>>>BA>><@BA;<>A>==<;<<>=@@>><<<:<>>@?=>83><<>@>?=@<@@<>BCFMPPMKIDCB>@==@@@A>>D<9C<=<;:9857888855558757783;8<92;;;9>9/A>CDGHKMNPPSY]agkwvvx{АГДЗЖДЖЕДЕЗКЙЙИИЙИЙЛЛЙНИЗЙЛИЖИЕГГДЕЖГЕКБББББЖЛСУУМДАyurrsB&ГМopqooprpprppprprnpppprrrrqpqqnrorrprsnrrrtrtwqЕqxЕzЙКДТ~РБВЕxstosskjqnnnnmnqrrqs{\5EДГuqmllpqrponllijlikmhhjhjhehhhkighffgffdd```^[^ZVYWVVUVVVURSQPMNPPNNNPOMPOOPPOQPPKI9.&2OTZWWOMMLJHLHSkSNIHJOQMLJHHEAFFHHIHEGGGGFDIIJEEGGGHIFGGHHHGGFHHHEGGHHEEMJJSJHIFFEGHIMMLIHIMHIIKIGJHJJJLMPDsЩЉҐ°І®®®ђЂЂ©©≠≠≠ѓ≠ѓЃ≠ѓ≠≠ѓѓ∞≠≠ѓѓ∞ѓѓѓђ≠ѓ≠≠ѓѓѓ≠≠ђ©ѓѓ≠ѓ≠ђ≠≠≠ђЂ©ІІ©ЭcmљјњЊЊЊЊљљЊњЅњЊЅ√√√јСE37865836642665314686644443441321215550445546:556776555113355365455889456957757757976998:99:;999;;967:5:A53o∆ћђrГИВ{ВГВААyx$oЕrusssndbG7" /s|v|ААА|||wuvrsoojgfgfca^^[ZVTVSSQLJJJMNPVZYaY*!Ii^[`a`__ab_ka_\a_^_^^^^^^[[^Z[[YUZZZWWUUUVVURQQQNRTOQUOUUTT[TTSSVPZUPx`UZ\Z[Y]XU[TRQKMQMNLIJG>ABA@=>@<<>::?;<<<<><<<=;<<9<<=;7G'.[<@>>@><=>=@4>>><>=?@BDDJJMMIGFGFBCCBB>AB?>C>>@>A@@@>AAA>:>@BGF=>@=AH@;DG??A@A@A>>@BAD@@CDEHKLPPJGFDA>=>>AA><<>>AAA=<:>>=><::=>@>>@@@>B1!2I<<<@@A@B@<=>>>@<<<<>@>==>>;>88;;;;:899988;;<<;;<<:<589@4/59<<=>>?<=;;<=>PTXZ]Y\cgilsqyВ{{~БВВДЕЕЕИККУКИЛЛЛЛЙЛЙИКККЛЙМЙИИЕЕЛРУЦЧТЖЖ~{vtyE&zДossppqrpprrprrrrrppqpqqpqprqrrrprsrprrrrrrrrtrustttxzzzz{xz}|ААx}wqrsjrocodlmZ- Ф≈Їqpnnprrojmoonlmkjljiijiiiolhmigjgggigfgfcccbc`[^ZZ\[ZZZYZZWVSPUVVVRURRUSSUQSSRUN^9,"4SX]\\RPPOMLLNXaSOMCJMOLJGGECACCEEFGGKIGEDDFEGEEEGGEEEGGHGGGFFHJHGGHGHDGKJLQJJJJJJKMMMMMLIILHKKIIHHGLHJHMSEt†њ£†§І¶©ѓђЂ©©±ђђђѓ∞ѓѓЃЃ≠≠≠ѓѓ≠≠≠ѓѓ≠ѓѓѓ∞ѓѓ∞∞∞ѓ≠ђђ≠≠≠ѓѓ≠ѓђ≠∞©©ІЂ©ЫbrЉјЊЉљЊЊЊЊЊЊЊњЊƒ ∆ƒјМB/56344466625453/4444554333460520446995553555867645449966645437785578744555566764666799855557799664*9:97=A=l ћ§|ДЕДБЕЕЕВГБА}x&rЕpvuroeWL3' *lЖx{А~А|z|{zvvurqmjhigccb`ZXWTTUSNLLHHKPRYZ[_X/(Mgaaaaabb`fccaaaaa^___^^^Z[YZZZZTS[Z[XWWWWSUSSQQQMQTNQUUUTTTVSRRPQPRMXВXPWXWTUVUbYU]VXZ]XZZYPQMJKJHMQUSVQKJH<=@>=>?<<<;=5??=<<<<>@>><<>>>=A>><<:?@A>=====<>>@BBGJIJJJGFFCB>ABABB@<<><;<9@>>>@@AAA?A@>@B?A??ACB<B@@ADAAA@7BB@@AABCCGILKLLGJDCD>>>=>?@<<>?<>>:::;;==;:;7==<<<<@@A@@>??B/5A>@>B@ABBABBBAB@GKNNMHFFB?AA??==<<<<<:<<<<<><@>:99;8;;9;<8;;:<><<><<04<8<;<<<<;<;<==>DHJJKG@GHGFKPVY\`cchkmnqvxz|АЕВДЕЖЗЗЙЗЛЛЙЙЛЛЛСППМЛЛРФШ£ЭШТНЖЕ~zA$vЗuxwuussrrrprrrrrrpqqtrrqpppqpsrppsrprrrrtrrtuttsttsttvwuxruxsy}БГРЕЕГ}|}Гz{{{uwsuY*Г÷ўЩ[k`gkm{okorrpnrljkjhoighmimmmiikiiikkhkjghgfgcca_^^_baa`a_]\ZVY\][[ZXWXWWVUVVWYRS< 9Y]]^ZVPWOPOOLY|VUCHJLMJJHHHHHKHHHJIIJGFFECDDEEGCDEEECEGGECECFFHHHEGCE@GKKLLJJJJIHKKOMMMLHHJJJJJHHHGHLMLNWBt≠Љ§§¶®®®ђІ®©®≠®ђ©≠ѓђђђ©ЂЂ©≠ђђђђ≠ѓѓ∞∞ѓ∞ѓ∞ѓ∞ѓ≠ђђ≠≠ђђ∞∞ѓѓђђ≠ђЂ®Ђ©ЪjwЉЊљљљЊњјЊЊњњњЊ√¬Ѕ√њК>0566654298666635444424334322151/48899775125556753405797664574799788;888779644<76;7699798537889846827688=<9=A>>==<<=<>=>>>><<@0 /^>B?>><>AABAAABAA>@AABDJJKMNNGFFCB<>BABB@<<<<;<?@@><>?>A?=??J<F@ACCAAA>AADCFJIKLMLGFDDDBCB??@><9@=<<<:9:::<=<::6<<;<<<=?>><><==?@B/3@>@@>@=?BBA@BCBAHLNMOHIGBABA?A??<<:>@<;;<<<<:=:99;;78<<=<8886=<<<<<=<>?=;K82J=<<<<<=AAAGGJHH?A@?<:<<@@DFIKMPQSWXZ`belostyz{|~ЖЕАДЕДЕЛМММЛМПСЧШШШЦХНМЖДИC"iЙДБА~~}}|zxyzxxutttutvttsrpqrrroorporqqrrrtuvtqqststttusssrrsy|ГЛЕБ}|xvxxxzБxГ}y\*KЕТГdndmmckg_l_hifihikikrnkmlcijhjljjihjjjkkhigcgfbcccaccefffadcc]]aa^```_]^[]^ZZZ\Z\9$!A\b_^[YVWRRRNN\iVQMMIKHHIDFGGIMIGHJHJHEGFECDFEFGEGFHGFEGHGEGEGFGJJCECCCEIIHJJHHHFHJIJNMIJEHJJJJJHHIHHLMMRW>s©љ•Ґ§®®®ђ©ђђ≠≠ђ≠ђ≠ѓ≠≠ђђђ≠ђ≠≠ѓ≠ђѓ∞Ѓ∞≠ђѓ≠≠≠ђ≠ђ©ђ©©©ђ±ђѓѓ≠≠≠Ђ®®¶†ЩjyњЊљљљњЅјјјЅЅјњ¬ЅЅ√њИ@1977555254446665344444434331044659886;87555545665302577446997586888;998968997969<778;99:789;8866899987<>E4j∆≈§wАИЕГДДГГДЖИБАЗr'hЕwxrdmS'.xЖz|АББББВБББ~||zwtrqmlklicfa\XXTPRNNMMKJLRXZ\]X_*Nkbddcc_cffcgbcdbb^b__ca`^\\^^^\\XZ[Y\ZXZXXXXUUVUUWUSSTUTTTSRRRRQVNJKSgRMQQOOPNNNLJSNMQRQSSXXVZZ[^^^^b_c`bj^_ZQPONLLHGDCCBCAAA?<<>=>=@>>??<>,0o??><<<>>??BB???@>BCBBFFGMMNMKJGDABA=<><:==??>>>AA;=@@>><<<<@A=ABK5E>>AA@@CA<@AA@A@ADCHHKPQNKHDBBBCA@A>@@;A@:><=<>>>@<<=;;?>@.7E>>>>B?ABB@>>@B?GLGMJJGCB?AAABB><>><<;;:99<<;;8;;<;><0<>>@<;;;<<<>>=>CACB>A?<@*5bA<><<<=<=AB?=A==A?ACCCDKMJKKHGDAA>A==A><;<=;====?AGC?BB@@@A<<><@B9?AG5!JC>@A@@A@D@A@>@@@CCFHINNLIFFA?BA?@@>>>?C?:=>><>@A@@><:A9;???==>=<>>@<<><@ECJJIFBBA@@@CB@?@>=<:<<99;<<<;;<=9B><<<><<>C75@?AAA@@>>B@BABBHJMMLDCB@<<<<;<<<<;<<<;=<<<<;<>BDEFFIMQTU\]agmkmpuy~|ГЖМПМЙИИИ;XРРЙЗЙМИЙЛКИДИИЖЖЖЖЖДБЕГЕГДА}~~|yy{yuxxtzxuy}xvtvvvttvtrrrqptx|ВКЛКЕyturrrrqmilmjT);Zlnmjrrjtwu}|yww|wwuwunqljlrrrsrpspvwrsjnniohckchkgcacfecd_a\_a__ecbfgiigbbabc`calk8"(Gdoknlifa`^_\]glUROOMJHHGCCDEDFHGHGEEEEAECAAACCCCHFGFFGBBGFHCCIGEGGHEECEGHHJHJOMLLMJLMHIITLLJLMMJHHHLLLPMMDs©љЬЭ§••®©ђѓђ®≠≠ђђ©±ђ≠ѓ≠≠ѓЃЃѓ∞ѓѓѓѓѓ∞ѓѓѓѓ≠ѓ≠≠ѓ≠ѓ≠≠≠ђѓѓ∞∞ѓЃђЂ®∞Ґ¶РhЊЉЉЉЉљљЊљЊјјјјƒƒ¬ƒњЛF7:997522744234234433433344634686;7733646364478868957;9999885597669967678745<679668576867436989:<9989;:A(7rC@CBBA>>>AAB>@=AB?@C9CFJJMLHHGC>AAAAAF><<<<7;=>BA@@>>@B5=@@>@@@@B?A=A9LDB@B?>@?JAA>>@B@B?BGINNLHDFA?B?>@<@B<:;<<<<<<<><;:<>=6<==?=<=>=>>?A>C2@JBA@=?>?<<>@@@?@@DJLKHEBB@>>>@@<=>B@>>>>?<<<:<<:9;;<=5:<>9<=<>?A?==A>@@=>C48BBBA><<>><:;;<>;<:<<<:;<<<553:;=>>BCCINNPSY_ebeiprx~АГАДw5ZЙЙЕЕЙЙЗИЖИЗЗЙЙЙЛЛЙМЛЗИМЙКИКЖБЖДДДДДАББ}xyyyyzwwwvtvttutuuuzАИТСМЕ~yvrrrrtrlhmhgL);Vjklhoofoprrrttsrsysw|yuyxГrВuuwr{rtuqtnqqqtrrtppurnmpomghgfedd`ddedbbcgggcccbccclc</Gfgoqqkhfd`baajsRPONLFGHIFHCDJIHJJJHJGGCFGDFCAHCCGGGEGEDEEDEACGEDEEDAACGHGEGGHHLJJLIIJHMMMKLJHJJHHJGIMMPMSOw≠і°§І®®®ђ©©ђ©ђ≠ђЂ®ђђђ≠ђЂђЂЂђђѓ≠ђѓѓѓ≠ѓЃѓђѓ≠≠ѓ≠ѓ≠≠≠ђѓѓ∞ѓђ≠≠ђђђҐІПc|ЈЄЉљљЊњњљЊјјњј√¬Ѕ¬њЛK9998954145744:56743333324455588696643444333244566669988989=749;78;9988;;858=59=;8:577966769978=<;868;9<@<.d“ћЧstwz|z|БААyЙ}Z†•£w8#/xЗГГЖДЕДАБАБwБ|z|zwvurrrqkjgc_YUSQSNMMLMNOTX[acc__5Dqbeekigfgggeeeeccccccbbecbbbbba``^^\[^Z`]ZYZWUTTTXURUQSUXWYYYWTUTMO\[ZRYPPSMMQNPNQPNKNOLMMLMJJJJMPPMLMNMJLNNNMMMMMMNPQSTUWWUZWU[VUQRWPJHHCL)9wD?DDBB>A?BBAAABDDBAB?DGJHLLJDGDCAABB>B:==>@=@@:@@?<>>><@>A>I;WB@@A@@>=>=A@>CBCCBDJNNNLHGDAAB<@A@>>=<<<=>=9<===>=>><<<<=>A?<<@B@@A@BCCGGLPKGABC@>@>>>>@@@>>@?B=<<;9:<<8;;<<59;<<:><<>@A?=?>>@@=A14B?B@A@CBBC@BACFHNOPOKJFBA@@>=@@@><;<<>?<<=<<;<;7541;::989:9::>>91:FCJPQNT_emjmp/ZЗВААЕДВЗЗИИЙЛИЙЛМЛФСТСФФТРППЛМККЙККИЗЙЙЗЕ}Б}||y||yvxxxxx~ВКНМКЕyxvrtrrrrlporrI(@^fАllrpnpqrnppnqnnqfpsrqsrrБwwЕ|zЗwwtrrqqqrswvtvttroswpoljnlmkljljgac^dmhhfggdggft_B3EqimqqpmiigihglqPPLHGGDFFFFFCGFFGHLJJGGGFGEEFCGACHHEAFEEEGDFEDKFDEEDACEJHAGHIGHJHJHJJJHLKIJHJHHHEGHGHLNMMSUtЃЄ£¶І®І®©©ђ©©©≠≠≠ђђѓђЂЃЃЃђ≠ѓ≠≠ѓ≠ѓ≠≠∞ѓ∞≠©≠ђђ≠©ђђђђђђѓђ≠Ђ≠≠®©ЂҐ§ЛZ{љЉљЉЉљЊЊљЊњњјј≈√¬ƒЅЛF5837774545554776644753336567797896795544334234435489886669<447779;8885;;657548:9=<;78;96996777<<<;9698>?A@@ABBA@>@A9@B?A@A?>??@A>A>>?]JB@@@A>?==<>?@9@BAAA@<<<<<><<><><<<@@><==>=>?=?==A>>><<<<;;.;B<@>@><@CBGJMPKHCCA@?@>>@@@>>><>=<;<;B<::<:===<5@@@B=>@>@>AB@CBBB>FJNMNOKJGFBBA?B>@BB<<>>CA@B@?><<<<<55;<>84778749:787<<<@><<8:@A@;.VQ_ejqstw}~АЕДВЖЕЙПРРУСУУУЧТФФТСТРРТСПППМЛЗЙЙЗИЗЗЗБГГБ}~|z}ВЕЙКККЕ~|wturrpprpkrrJ&Cdcljorpnqprrrrrrrrxsprsrprrrttttvvwwurrsrrqr|zyuwvtrosrnhkcoormrrrtjen`fihhfidcfeen]B,HioorpppkmikkkrnSNLFECCCCFFECCFDFKMIHEEGCCCECCGDDGECEGFFDEBDEDGDDDCCCEHLJ>HLMLLMKMLLJJHLJHLJLJLJGEHGHINONSQrі±Я§¶І®®¶Іђђ©®ѓѓ≠©©ЃЂЂЂђѓ≠≠ѓ≠ѓ∞∞∞ѓѓѓѓ≤Ѓ≠∞∞ѓ∞≠≠≠ђђѓ≠≠Ђ≠ђ≠ђ®®І••КT |ЉЉљЉЉљЊњљЊњ¬√њ√√Ѕ¬њИE67673545455766214316444663565757999:87533463464476698868684967775<:9845545557776=:8888989977779:;99;;:;A@5i«ЌЧwwttsttvwttvvsАypЧНИI 2ЉЄЯЃ†°¶Ю°ҐЫЩФССЖКЖЕВ~А{yvwvsrokheWZXVTWSSPSTUYZ\`ad_k:2Jqngjkjkiiliiigeiegiececccbbccbb``j\^``\`_[ZZYZ[\[[ZWYYZ[[\ZYYWUUURZZhUNRRPLPPOQQQQRMMOOMNNNPRNIOMMNMHHLHIGIIJJJJLLLHHHLJJJJJMNMMNMNMNQQQ`UX"IyYPPPRQUNMMKHGECCHHHGEEFGIKKMGECDCCDFABA@@AAAACCAC@>A5AABDCCB@BABB@@A;<dM@@@BB?@>@>=>>>CC>AJMNIIFDAA><>>@=<<<>><<<>>?>><>A<>===<>@=AABB?@@<<=><8.9B<<>@><>@>@>>@CCHJMNKGACA@>?==@>@><=A?=;?===@<><<<;><<<<===>>5@@?A>AA@>>9=B@>@>FIMMMMKKFFDBBAA:>AA<>@@A@?>@A<<;;<<99<>;>>>:<(ECDHKNPPU^cglorswz~ДИИКККПМНСРНРТТФФТТТФУФФТТСППСККНЙЕЕЖЖВББЕИЙЛЛНРКДvxywxtrrrmsmI$Fggjjkrpfrppppppppprrqnrqrrrrttrttrrsqprrrsqquvxsyyvyx}sqqnnpqrfrrosknupnqhheaacd`aeW?%'GИ{rsqtmmmipmmrrVPKIHHHHHIIGFDKGKSRWHGHFACAAAAEEGGEBCACDCCACCCCACDCABCEHEEGMMKMMMMMKKIHMLMLNMLMLHHHGLJLQNVVsЇ∞Я•¶••¶¶ІЂ®®¶©©©®Ђ≠ЂђЂђ≠≠ђѓ≠ѓѓѓѓ∞∞≠≠ЃЃѓ≠∞ѓѓ≠≠ђђЃЃђѓЃѓЃђЃђ©І•ЃМQ*ДЉЇЉљљљЊЊљЊњњЊљ∆∆≈√ЊИD5::74555554535653224444456344447956855566644573566567556643;9;874=>;9746677589953989:;8787:9977::99;;9<>>1g¬≈Ьsurrqqqssrprssynz¶Вs8 KЮФВКМСУФЩЮ£•ЭЯЩЮЦТЦТРЛИЖАx~{tusolbUZZZZYUSUVTWYZ^`ab^]G=Oygikkmkjioigieglikieeecffcfffcdb^bb``^[\[\[ZZZZ\[ZZZZZYYYYZWUYVTTQY^oYSUTTRSVTURQTTOOQQNNPRTSNKOQNNMJJJIKIIGHHHJJJJHJHKIHGGJJMHJLHLJKLMMKMT!CsQMRSUY[[ZYZVXZXWXMSRMMNHMQSQLIIHHGCGBABBA@@/AB?BCAAABABBAAB;8dCABACBAA@AA@ACBDJADJLNLKHDCCA@<><=<>>><<<<::;<<<<<<<>;<=><=>A?>>?A??AA=B/ <@<<<>@>>@@A@@@CDLLNNMFACC@@>=@@@=?;===<;>><<<<<;;<7><<:;;<<=?B>?@?>AAA>D;H/>KCBAAA@<@B@BCBGJMOQNLKCDDBA@B==A@>>><=>==>@<>7<8<<<;<<;;<<<<===<><<<<<><>=>>><;+5:<4BCFGIKKMVZ^\^_``hqrtw~~ДДИИЗЙМКЛКККРТТФХХФФТТСПМММЛЛЛЛЙКЙЛМПТСТЦТЙЙББ~}yxutrvpM#99::9<<>8i«≈Ъtprrnnnlqnjnosll$mҐВ[/  =Гjjqqqqor}ВЗЙНМЧХЪ§ЪҐ£Т¶ЪСПНИК~ytgja_`__\TZZXZZ^aaaa^^NGWseghhkhjfiggiikgikhdefcfgffgfcedbbdddb`_``^][Z[`\\ZZZ[Y^YYYUWXVVXQYYgSQSSSSZXQSTQTROORTPPRRQQPOPQSQMNMLKMKMIJLJLHJHCJJJHJHHKHJHHHDHHKKJHEGRByQGJJMQSNSSSSVZZ^`X`ZYZ^]\]]]YWSOPLKEEFHFDFA@>AA>?@BAB@??>BBBB?@@??@=;5!]>BA@@A@ABA=>=<<:9;<<<<<<>:::<<<<>>>=A>>?>=;C*(==<=><<>>:<@>B@CCDJMNRJDDDDBA>@A>=?>D@=?>=>><<<<;;:9<<<7988:<=A<<==>>@>>@@>A?>@B<<><><==;898<8;;=;;;;<>><>>@<=<*3<<:>>BEBCCDKNPMMJD>JQQVY]^aeloruwyz}~ГЖИКЛММСРУННПНРНРЛЛМЛМППСШШХХШУНМИЗЙЕЕГ~|yv{wS"@A?A@>>?@ABDCKKLMIGFCDAA@@@A@A@BA@<>B<;8;<<=<>>><<<<>>>AA=>>AAC@;<%(E@;<<<<>>;<<<<CGKMMHCA@C@?@@@>=A=>=?B@>BB>@><<99::<;58;8:;??<=>@A>G.A>@BB@?>>@@@CCCFJMNNKHGDCDDAAACCC>?AB@@C@BABBB@@@?=<<;8<<><A<<@<==%4B=>BA?BBDCCHKMMJGCCCFFFDGGGIMNQSWZ`bekqs{z{}ББЖЗДЕЕЖЗИИЗЛЗЙЛЛНФФЦЧЩЧТУПММППЛИБ}АuT Inv}~|}yyyxywvxvwutvttАrusrsrrprrrrrrrrqqrrrrqpprrrrrprsrsuwy{~ДЕЕ|xuuu{xАxxzА{w~ЕlK#H Ъs|zwtwyy}trvmPPIHGEEEEDBBDCECGMLIHEGCDA=@DCDBCCCBDDEBDB@C;GEDDDDCGGGGGGHKIGMEIKKIIIFHIMIEHHFIFFHFHFHMIJUw¬±Э£•••¶®¶ІІ©ІЂ©®©©©©≠≠≠≠ѓ∞ѓѓ±±∞ђѓѓѓ≠ѓ≠≠≠≠≠ђђ©ђѓ±ђЃ±ђђЃЃЃ≠©®•і|I 4ФЊЊЊљЊњњњњњјњЊњ√√јјЉЛD8<9743554432044333255654325,385666796766799779766666523766644764679977<766669;4887998:/758899;:;><::<;=A>9s∆ЋЩ[fnllkklnonommxr#atzo' C{a]^^^^YZXUSSXXRYZY[^_\^jikrww}}~З~ЗМЗВКВ}ywstrqrnkke_IDUukhlmjilihfeeffeikbcegbcebc_bdddbaecccabbabb_ab\\`_a^_^__`^^Z[Z]ZXVWr^QYWUTTVXTTSQRQQONORMNPPPNMKKNMKMMLKJJJLJNNMKMJFCLKKHHHJJLHFHJHFJJJFCS#HgKAC@@>@@>@D>@A=?A><>=;<<;<<<;<=>>=<ABAAAAABC@B=+&E@<<<<<@><>?<<@BACJKMKGA@B@>?>><>>>@<>8@@<><=<:<=39;?A?B@<<>A??@2<>BC??ABA@@@ACFDJLMPMJEDCDBBADBBA>>=><>AA@@@@B<@==<=<<<<>><>=?<<=8BI>>>@?B@AA@>>" 7>AAB>ABBDDDGKMNJGGD>A@?@BB@@C:8u≈ЋЩQklllkllmopnmmrqPzВp# JДe]_^[[YYWTWUTTRRTTRQSSSTTRVX\Zaeikoruwz|xz~|И|}{xxuqhB6RГlnpnigkkgikkhkhhkfgdggcccedddegdddcecab``__^^_`a`a`[^^_`\_^\^[ZZUYWwZSYWVSTVXVVTTRSUQQTSRRTQQRNNMNNMNMMMLJMMLNOOKKJLKLLJJKHHHHHHHJFHJHHEJX.CTFHKJGJLJJJHHJLKMOKJLLKMCMMQQNRUQRQUZZ[\W\WX[TTRTQNPMMJHCDC9B?DACDFCAB*0^MABAAA<@<>>@AB@CCFFLPPPGEFCBCACAC9A?=??<<><<<<<;<;:;<<<<<><<>?=AA>@@>>E;/&LB<;>>@@>>@B>>BCDGKMMKHCCCA@>@@>><@<<;<<<;>@><=F5KEBCBCBF@AD@@AGFKNPSQMJFCCCBACBCB>A=<<>@AA@@BB<@><<<=<<<<@>@?=<<<<>A=A@==CCBCBFC%8CCCCBCBCGGHMMMNMJJGDBBB@B@@BC>@><<<@@<:==CFIIFIMNX[S\eloqrv{БzГЗКПТСПРЛЛЛЙЛЙЛТММ}ZIzЖКДДЗЖЕЙЙЙЗГГББ|z~|u{ywwvttuuurptvsuwwtrtrrrsusrrttyww|АГИРНЗ{ysrrsusrsrrnrrqraA!Dtsnphrrrrprxr~mWNIEGDDCECGGFHHJNOLLMOHECABEDGGDCHHGIEDAAC=ACEC>BHB@CACCDCFGGFIJGHJJHHDEGGHIKMLILMILMKNNOGSГƒѓЬ§®®®®®¶¶¶ІІ®®ђђђђђ≠©©ђђ≠ґђ©©®≠≠ЂЂЂ≠Ђђ≠ђђ≠©©©©ђ≠ђ≠ЃЃЃђЂ©®•Я≥tA 1ҐљЊњЊЊЊњњЊњјјњЊјЅјјљРC<=;9743755974763635853=87:933477734453466463443464649955567479767888779:77938667778;9698889989;;;;;<77@<55|«ћФ`killjjiijiljmrqIЕЕk HЗc_a]^ZYZXWWTTSRQUPNLLLNMMMIKQQTYZR\ZX\^bglrrt{x~}xЙv8+EВusvrmlmkijjjkiiiffedcfee__a``deeggggdcfeeddccb`dd```_aa^\`_^_][[UUXp^VYXXTXVVXVUTTTTTUUTTRSQQRQOQOPNNMMMMMNNMNPOONLMNLMJLMKKKJJJLLJJJJIDGU*>QDIJHHFJHJLHHHCDHMJLKIIJGJGJJJJMLJJMOOQSQSRSUTUQ^UU\TXWPPQQLOJIEJFIFBF,3_KCCCBB=@@@@>@BCCB<>><><<;<<<==<<;><<<<><<@=<<<>B>>AADGKNKKFCC?AA@@@?AA=<>>@;<=<<=<<<85<=<<:<><<=====?I/ A>A?BA>A>@BACDAFKNNTPNMJAFFCFCCFGBBA@>@BAAB@BB>@>8@@A=?<;;<==AB??HBBBA@9(?ABB>BFBFGJJMRPTTONKJFGDDDC@CCCBB@@BC@<>>FDABB:;;<§љљЊљљљЊЊљЊњњњЊƒ≈≈¬љПA<;:975537;956554:586855646744464755543769864==6799767555775469869968687:977.6988:89;99989999886;:;<;;7<<;8~ƒќТbkjllnkjjjjnlhurLЕКk  Rt]_`^]YYZXWSTSOPPRRSLBIHJKMIKLLNPQQSPLMMPSXYUSbfhnqpЕ-#;ИДy}Аwuronmmlnjjfcfccd^ada_aaaeiabfedddefeebbeedebbb_abb`acb_`_[b[PZ"$moXZZZVXUVXVVTUUUTTUUTQQNNQOOQOOPNMLMMMNNNNNJMMLLNMMLMMMMNMLLLJJHLLLEE])DZEGJJHFLJLJFFHHHJJFHIGGEFHFHHIJLLLMJJGKLLMLLLHMPQRTUTYZUU^aZ\_Z^YURMMR51]J@JKFFDDAA@?BCCCCAHHMMKIFFCBCCCCA?@?>@C<<<<<=;7;===@@>=<>>><@@>>?=<98+*A<<@<;<;<<><<>@>BDJMJJDDC:>>>>>>AA?=?>A@@<=><;><:<<<<<8<=;::<@<>>>>>=>AA(@B??>>>@>>@@B>@IJMPVMKKIGBEEDFGBCBCBC@AC?AB?@@@B?8@>A>>><>A@??B<;=<==AB=?B?@A@A8(A><===>@3>@@?BBFJNLRVZ^chkpsrruy|}КsMCtЗЙЙЛЛНЛНСЛССНРПМЙМЗЗККЛЙЗЕЕЙДЖДЕВГБ}~}{z{y|{y|wtzruswy|~ВНФХРБzusqswsrxtrswrsspxc6'HtsqttrsrrrsqrЕjRIFCHBBCEEGECDFECDDFGDAAAAAA@DDCDEDBEGCBBACCC@AAAC@BEDDDDCEGECEEHLLMLJGGJIHHIIMNMMJGJJMPLDZД»ѓШҐ••®¶®¶•¶¶®®®ђ©®Ђђђђ©®ђђђђђѓЂ©Ђђ≠≠≠≠≠≠ѓѓѓ≠ђђђђђ≠ѓ≠ђЃђЂ©®•¶Іv0TђљЊњЊљЊЊњЊњњњЊњ¬ƒјјљН@9<99:9629;:75761855665344664973333541/886:85999:::9779779997;:8669799;<;;7797:;::98<89;:9979873:9:9<88<57;t¬–ПbejjlmkjnmlnlinuMЕЙa  ax^^^\ZZYWUSSTRPMPPPNIFHHIKLJKLIJKLLKMJAEKPQKNPNUWZZ^mk,<ЖНzАzv}sqrtqtrpolijjjcdebcbadceaabbedbbdba_abbbbadbbabcaccb_`a`]Z]Z"laVZ[Z[[ZZ[[ZXXVTUUUVQQSQQTQQONNNQSMMJMMLNMMEMLMMMMLJJLJJMNMJLJJHLLKHEZ*EZHJJLJLMLLLJFKLJJJHGGIGIGJFLJHJKMMKKKIIHJJIKH>HKJIJCG@MMMTUVRY[e[\YY`^51]PKQSPOLJHEECDDGDGHHIKQLPIFBBBA?C@?@@>@@>>>><><7<><;<===<<<<<@BBBBA>@?/-O<><>>AABCEKMMJFDBA@><<@????=?>>>><>=<<>;<===><<<<;9;<=><@<>AA@>?@BC, >?A@@<@@B@CGIKPPNIJIECBABB?=?=AACAAA??AB=?>@?=@?==<><>>>??>>===>ACB=AB?BBAC8';:ABFCGGGGGJMOOQNNMJCBCCBGCDDEGFDBDD>ACBDD?ACCBCB=A<=>@<>@@A@=<@C@BE@HKFIMPXZY\ciraABg|}ВГЕЖЕИЙКЛМЛЛКЛЛРЙЙЛЛЙМЛЛЙМИИЙЛЛЙЖЕЕГЕЖВВДГББ}|Е|~{{~БДЕЛРСНДzuuqsusttnrorrqrot]5&0Mppqussttvxvtr}hPMHCCBBEEACDCDDDCCCDFCCCCADCDFECDGCCFGCCCABAAA?@CA@@DCBBCEECCECCGJJLLJHJJLMMMMMPLMMKMQTUSM\Уƒ®І¶Ѓ©©Ђ®®®®®®®©≠ѓ¶®Ђ®®®ђ©©ђ≠≠ѓ©©©ђ≠ђђђ≠ђ≠≠ђђђ©ђ©©≠ѓ≠ђЃЂ©І••ҐІx/ ]ѓљљљЇЇљЊЊЊњњњњњƒ«≈ƒјЛB9=78<;7779977764774865344666752133444189787597798=9799;76797978566779<<;<;;;::<<:9<@89:::<776999999<77;97Co«—К_ejijkjjnkkklkdrP~ЗW  iwb^\\ZZWWWUSUSPPQTQKKHHIKIKLKKJGJLIKKKIIKKLIINMPNQUTYi*!AМ|ceihhllikynp}prxourqolkjhigkjgggeefdcdbbbbcaaddabbbbefabba_aab_ZZP vcYZZZ[ZXX[ZXVZXTTVUUTUTSTVVTSNPNN^OOMMMMMLNLQLMLLLJJJLLJLLIJKKJJJLJFAR+ GZGKHLJLLDJLHFKLJJLIIGGJJHJMJHKMMKKMMMLKJJLKIHFFHKJIHFFJIJIJKIJNMQPPPRZ%/kY^UXXWXUQROMPGOMKMLPRVRWKKFCCB?CBBDC@@?C@>><>=@<:<<><>@@@>><=<7<><>CBCBBBGLMOLGGCBC@<@B>?A<>AB>A?==<;<<<><<9;<97;;<<<:<=AA=<@@@L- BA=?;?AB@ADCBBFGKMPSMLJKEDCBB@>>@>CDA@>A@?<==?<<==?<==<<=>:=9=?ABB@@BBEEBI9#F;CDIIJJKHJLPQSQPNMJ<>@@@@<>A@>;?>>@=@@<><;A@???9>>>@C<<<>?A@?@<<<:==>@A>?AAAAJLMJDCB@@><>BB@@@@@A===<==;><>>@<<;<=?=9489;;::<A>B>K*HA>?9?ABBCCBBCGBKMQQIJJGCCCCB@?>B@FBA@@AAB?=???===><<A=<=A=<><==?AB@><<>@?C;"!8@ABGGJHJHJJNSSWQMJHDHHIFGFGFGFFFCDF@GGGCCFFFFBA@=A>>=>@BC@AA?>;??@B<<>?BCBAA@@@@<:42=GMNWY\\ceioqsuvАzАА~ДДДЕДДПЕЕЕЙЛЙКЛЗЛЛМПЛКЛКЙМЛКИИИИК|ДГЕЙМПРТРЗДy|wxxyvxzxvurrwsU5&0[Вnrtuwwwwwvww}gPKFCECAC?>>@ACCCCCCEFDCC=67765685756664245545:744243464575896577:9997775:997699995::7977779;:87779;967878566:177979989739:79;=8?@@7v≈»М_klljlooopllnj{h"P~|N hsW[[[YXUTYYTSQMNPPOIGCHHFIKLIKKKIIKIHIGGGGKKLNLLNLPQQZ6;БeUQNPLPNNQQQPPMPSQQUUWY\[adcllllknkjnllnjjjhhjjjh`geedfccdddcfb[_cXp^^][ZZZZZZZXZZVVTSSXTTTSSSRNNQSPSQWMNQMNMQNQRRQQRQRNLMNLMMMMMMKMLMMFC-JnHMOJJSMJLLLJJHIIIJLJGJJCFHJDJJHIKIJIIEKIKKIIJHJJJJMMGJHJHHMMMMMLLJHDN15rRBMQPRSQRRTZX\\Z]_ec`hddk^]YOPMJKJJGCCB=>A<>?>>@>>@A@>?<@BBC=D%0J<@><@><<=>@=<=>BCIIHGCB@@@<<>@@>>B@@>=<<<<<><<<<<;<<?BA?==;J*!?=CCA?AABCB@BBCDJMNMFIIFDBCDBB@=ABBAA@AAA@?<=====<<<<>>>>>C9  >=A=BFFCBCDHKOOYTLKJGDD?CGCIIGCCGFFHGGHGCGGIHFABA?AAA>@CGGBCC???@B@CBBBCDDBAAA??<<92/8AECJIMKIIIMMRUXWckkiqrr|АyЖЖЕЗЙЖЕЖЖИКМММКЛМММПХЛКККЛНЗЙЖЙССТФУКЗГ|}|}zz|zxwuryT5%/\{oruu{{xyzuwtВgUMFCFD@B@>@>:ECEEEJECECCC@B@@CB@??BBDCBAA>A@>===ABDAACABCEEEA>AAFHHLJLMMLMNNPRQSSPLRUSSUM>mЯјІҐІѓ•®ђ©ІІ¶®ЂЂЂЂЂЂ®©©®ђ≠ђ©ђђђђ®®®®©©ђ≠≠ѓ≠≠≠ѓѓѓ≠ђђђђЃ≠©©©®ІҐ°£q& gЈЉљЊљљљЊљљЊњњјњ¬ƒЄєЉЖ=3;975855778886345533524424834546777457575776677:8<679;::9977:99797996799:<74787:767:479758788957974699<=>==<<88:<<>>>>A?>@@>@<>>:AFJJJGBDCBB><@@@>@@>><>><<=<>>;<;<<<<<<==>;:88:<=BA?=<<=?CB@>BBBCFCBCDIMMQNJIJGFDCDBC>@??A@>><>@?<=??=?=<;<<@BA?ABAADGCBAC@A@BB>@A@B=A@==A>BC@;@CHGDJLDFFJLJJMPUZUUSSUSRSODm• ©ЯІЃ•©ѓђ®©©ЂЂЂЂЂ≠ЂЂѓЂ©ђ≠≠ђ©©©©®¶¶¶©ђ©ђђ©ђ≠ђ≠ђђ©©ђђЂђЃђ®©®¶ҐЮ¶q& mєљљљЉЉЊЊљЇљњњњЊ≈Ќ«≈ЉИ?7<:9896898898666775554554566;78955985555444777:99=8799967776699995766779=<:79:;<:9<<69:8:=88:8899:9989<@<9m¬¬ЛhmmkjliljllnlgabRБЛK  |e[[YXUYYYYXUURQQPPKLLL;IKKGIIIIKKJEEEIIJIGEGGIIHKLNPYa9$bUOQRMNPMLMLLEMKLLKIKIIIIGEHHHLJMPPWXZ^b_dfhhojlqmnsosnjnlkmfjhhbZ_R sl__]\\ZZZ_]ZZZZZZZZZZZZXXVVVTSQRXWUUTTTVVTSRSSQNQQOOMLPMMOONOOMNLLMKJI,KWJKMJMMMJMLMKLJJLLHHLMJLMLLMJIJJKJLMJJMMKCMIGGMMSFFIJFLHHJJLJDJHJIIGEM-3TJGNJMLJBKMMOOMMNMNQRSSUUUY[Zc^_k_]`__YZTUSNNKHJJGCCA<<<<<>>>@>@@<<<<<<>>><>@ABAAAGJMNIDCBC@@>@@>@BB>>@@@><<>>B<:;<<<;;;=;<<<<<<<;<>><<>>?;B% $=BBBB@B@?@BABDCGMOQQNMIGDDDBBB@IBAB@<@=>BAA??A?=<<=AAB>><>ABB<=A?A@?:ABB=?BCBBB5 (F@BCAEDDGHFHPTSTRMRLJGFCCCBCCGFGGJIGGCFCDFDAFEDCCDCB>CBCHDBBCABBBBCFEFCDDGEEGFCCFFF11:AFJNMJIGFBBB?A?A=BBBp¬ЌУlqonnnlnlljlifkcTБТE  ybUXYXTZYXUTSTQPPMMLLKKHKKGEGGIKLLLNKIHKKKKIKMMKIKLPYU`@#ZMOPRONNMNOKKGMNMLKHKHHGEECACAGFHIHLKNQQPQUWX\^^dfipkrnqrvrwrsrrjdlXhndc^]__\ZZZ^]ZZZXZZXZZXXVTVUSSSWWUVUTTVXXVTVURRRSRSRRPSNQPQQTQNSNMRNHE,M]KJMMMMMMMJLJMJIJHJJJLMMNNLJIJMMPNMMJKJJHITJLMLCNJHJLLMLJJJJLJLLMMJJCM/0ZKJLHHFJFIJMMMJKMLLLLMNNMMMPSSMSWZZX[ZX_T^ZUZVVVSTQPMKIGFFDDFG?CDC@@<8AC9 A\EA=<<@@@>>@>@AAAFJJRHDC@>9>>@>7@@@<>@A@AB@><@><<=<<:;;=<><>?>><;;<>><>?>BBBBA=?>@ACFFKMMNMJGFDDCBBABBCBC@A@>>>??B?@B<><@A;<><>@ABACA>@4 ,9BCC>FFCDDGJOTVRRMMLJGGECEEGCEBEFJIIGFIFHHHGGEGCCDCDBCDGGBCBAAACABFFDCDDCFEEDCFFGHJ/2>DIJPQPPMICBA?BB??>???6=@ABCA=?A@BDCJLFKNNUX[goonrzyzААЕВЕКППТССТСМКИЖЖИКИКККЛИЗЛЛb%'qН}ДЕЕЕЕЙЕЖЗДД|eNIHCACA@?>>@@AAAA@DDFDCEEGCCBECLCEEGECA@A@@?@CAAA@>AA@BDEEEFGKGGMKGJHGGHHGMTQVW[XVTSTSQPPBm®є†Ь§І®©ђ©ђ©®®©ђ©©©©®Іђђѓ≠ђђђђ©©®¶®©©ђ©ѓ≠ђђѓ≠≠≠ѓ≠ђ≠ђЂѓ≠Ђђђ≠ђ•ЮЬsnЉЉљЉЉЉљљљљЊЊЊЊљ¬ƒƒƒєИC7:888698544595477466466447679799957558977896679:<;;<7:;9:9649977689;9;7::7636979979:;975588588;8;969==?5?Ci√њСcpqllnlklnlkjjpb$V{ФD  upUXYYZYWWSRQPQNMMMLLJGIHIGIICEKKKKLIIHHKHKICMMLLKLRVUo<%\VORPMQPNPRRPRMMMMLMLIIGECECECHFHHFGHKLMCIKILKRSPVYW\]^ffsnrtx~{zx}\rufihecec_^a_[\ZZZ[[Z[ZZVVVVVTSSTVVTVUUXXUVTUUUUSVSVTVSQSTRQRSUQQQQOMJM(YfNMOOOOQQQMMMOMJJHLLLMNNNNMHGMMJNMLMKKKKKMLHHLLJNJHHLLMMLJHHLLJJIIGHES/1YEKLLJLHFIMMJMHJMLMMLLMMLLLJLMJMNMQNMMMPKRPPPTUUUWT^USaSPTQTQPIKLICDB=BC:>YCB>@>?D@@>?@@@=>@<8><>=@<<>@@A:2>><=<;;<;9<=><<;=>?=?>?A=<>>DD$%J==A?BBA?@;@ADFHIMMMLIGFCCAAAAAAA@GA9ACBBEC@><>=>>><>@@?=A?>>>CG@>@@@CBAFGAA8*>EEDFDDCBDFGNQSQQLLJHGFDCCGEECBBFIGGCFIAIHHHFGGADDDDDDDGDIGFCDCFCCGFDCGDGGHEGCGGGBD,3>;;<;AB=>>?@>@@>;AA>AACCAFGHGGHJGHHGGJHHOORTWVVTSOOOMPPMqѓє°ҐІЃ©ђђђ≠ђђ©®©≠©©©®©ђђђ©©©®©®©®®©©©ђ≠≠≠ђ≠≠≠ѓђђ≠≠≠ђЂ≠Ђ≠Ѓђ≠ђҐЫЧtoЊєєєЉЉљљЊљљљљЉЉЅ¬ЅЅєИC:<<:99;95557754676336774366666654497588:655657799:9<:<:9;;<:97779;><<<=<9955::9:::::;99755;4679;;;;9;;><9Bl¬љЗcrjkkliilklnjjk`"[ЗK  upU\YZ[YYWRTUQRPMPNLLGEJJKKKGEGIIKIKIIFHIKKKAKKJKKLPURq7%YQMPRNOPNPPPPPNKNNPPNJKJIHGIIIKKLLJJJMKJHHKFHIIHIIKIMMMNSY\^jpy}КЖНZxxinjnkkhhjdaa```^^\^_ZZXZZZVVVTXXXXVVVUXVTSWUURVXXVTTTSSSTQSSUOMOSSMJG*]fPPQPOQSMNNNPMMLNMNMNNSRNQNNMMMLMLLMNMMMMNMJJMLLMLJJJKJJLJJGJHFFGIGFCU*3`FIGJKJKIHJJGJHHLMLMNJJLJLLJLLMLMLMNLLJLJMJKDKOOONNTSR`WUZZ_Z\TWUUPMNLHJ<@cC@@DBABBB@@@@D>CJMNMIE@DCCB?B><@@@>?=<C@>@<:;;;<;;9:;;<;:9<<<<=>JE!)M=>A?A?@BCA>><<<<=<<<>==>===:>B@>@CC@AA@CAQ4,CDEFFHFDCEAJQOSTMJLHGGFICEECECECBFCCCGGAFGGHGHD>DGGDGDDDFGFGCCBGFFFCEDHFFIKJGECGEHC'4BCJNPQQNMJFGFGIFBB@BBBBA@?BBBBA?<><<@>8<>7>>A=?;>>;9=BCGJLPUT[_dknrux}zД}||ВЖЖЕЗМ]!wСККПФРФРСССМЙЛZKHCCDDA>BBBBCBCEHFDECCCCACEACCCEHGGEGGA@=@@CBC@@B@EC?>>AAACEEEDGFEEGGDDEGIMIMNPRTRPNMOLPMNo∞ЅЮҐ®Ђ©©©≠©ђ®ђ©≠≠≠ђђ©ђђђ≠ђђђ©ђ©©ђ©¶®¶®ђ©Ђ¶©ђ©ђђ®©©ђ©ђ≠©Ђѓђ®¶ҐҐРr rљЉєєєєЉЉљєЇЇЉЉЉ¬ƒ¬¬ЇИE:><:567957988979454356:669776778658788994675799:67699<889;<977767;<<<>=<9889;97:::::97>99:=<8::;=;<=<<=A=?p¬√Лjqjklkklnllmlkrh&Wo|=  {oWZZXYYYUUUQQRPNNPNNMELNMLKKIIIIKIKIIIHIKKLHIHILJGNQTl1%fOKMMKMKKMMNNPPMNMNNNMMKGJJIJJKJKMJKKKKJHLNBILLKR?=KJFPMANQSYbfzЗФUu}jvqqrrmorlhghfhdcaa^]\^[\ZXZZYXZXZXXXVVWWWWYXVXXZXVTTTTTSSSSSMQSSQOSSaaPRPPRQQMMOMQOMOQNNQMMOSNSNQNOMJLNNNONOONONLLMLMNMMMMMMLMNMLLKHGJMIFHU(6YIGGGJKIJIJIJLHHLMLLLJJMMMMLMLLLMLMMNNMMLMMNJHMLMJLJOMNNKOWTXYX]]]YY`ZRb@DiPGLMIGBEDCBA@DD>GMONJJFCDDD@>@<>B@@@?>>@>D>@@<<;;;=;<::88;89;<;<<<;<<<>>DC!,O:=?>?=<>BABCADHKPPPNJJFABCBCBA?A@ABBCCCABBBBAAA><<97=<<=><<<<>><>B?AACCCABBC@C5*BAIECCCBFIBJTVSSMMLJHHGMGGGGHCCCCFCFFCFGGDGGHHGCDGGBDGGCEFCDDBBFGGHGEFFDDIIJFEEGEL<'5EGJMPQQPOLKKIINFCBCCBBCCCBBBCBCC@?@BBB>@D<>@A??<<;;<9:97<1<;EFFIIIPVU[`aklluytАГ~ЗЖV#АТЙКМППХШХФУММДYPKDAACC?BC@@@BBFECCCCCAA@AACBBCDFECEC@A@@AAA@CDBD=CCCCAAACEEEGGHHFGCE>GDEHKIKPMPPNMMJLKKKLoіі†§І®®®¶ђ©¶®©®ђђ≠ђђ©Ђђ®©©≠≠ђђђђ©®©≠ђ©ђЂ≠≠ђ≠≠ђ≠©ђђ≠ђђђ≠≠≠©®§Ґ•Хn sљЉЇЉЉљЊљљЉљЉЉЉЉЅ¬ЇЉЈЗH9<<:577975576759573554347>::9768997:776889:;99;C97883;8::<;97757689:99<<<778:77789<<::=9:;:<>;;<=<=????@CCp∆њПjsrnonlpppnmmig_.ЦИqB% %l_VXXVTTTQTRKQMMMNNMJMIMMLKKLKGGIIIKIKIIKKLKIHIJLMBMPVn/)mMKMMKONMNNKJNNKKKKKKKJKIJIFFFKJJJKPMJKKKLKLLMMKKJKNNOPMGMMNTZYfr^SDrr\_aejjhkmmljrkjmjjhbaceca[Zb]ZZZXZZ\ZVXWYWWYYVXXXVVTVVTSVUQSSUUSSSRXOrtQRPSRQSNSSNNMMMMNMQOMMPMTPPRPMJMPOQSNNNMNQNMMMMOMLPPPMOPRPNRQNNMMJIMO*9\KJJJKJJMJJKJLHHLMLLMJMMOMJJJLMLMNMMOQMLLJJLHLLHHJLHJLJLJMMMQNNNQNRQVXQXMJy]_XWURROKKDIC@E@JOOVPMLCBCB???<>@>AC@>>@@@<<<<<=<<<;:<<<<<<=<<=A>BD!2I<=<=?>><@@?@ACGHMMMMIFAA@BBAAA?BA@??CBBBCCABA=>>==:9=>>>>>?>>>@<@F@@CCCCBBBB@C<-?>DCDDDCFG>NQSOSMLJHGJHGFFGGKGEFFFGIGFGGGGGHHGDCCGGCBGDFFGKBCBCCEEGGCFFBBGGFGEGHEJ<*"5CGJGPQQPPMLKKIHEECGDEBDDCBBCCACFBBCFABBACBAB??A?<<<;8988868<=9=<857:19?@?<<=SX\adgjQ'lЗДАГЗЛПТЩСТСПАUSMECECCBBB>BCBDFECCCCDCDCA@ABBCCDEACC=@@==A@@ABBD@@ABBABECCEEGIGJIHFDBHHFKMORYMMMMMMLLJKMMsЈґЬЯ••¶®®®¶¶¶®¶®®ђђ≠ђ®©©ђђђ≠ђ≠ђђ©©©≠ђђЂЂ≠ѓЃ≠ѓЂђђЃЃ≠≠≠ђ≠≠≠ђђІ•¶ЪmxЄЇЇЇЉЉЉљЉЇљЉЉљљƒ ≈ЅЇЛH;=;:597865755447443566346>77:44997996677798;;;9;<89;9=<==<;;998;;:;:9<<;<9689975789A<::97777<99;<==<<=<<7//7j^Z[ZWUUWRSSQOMNMMNKKLGIGIIKLLKIIIGIIIHHIIIF?JHJILMMOUr+*iNKLNMPPNPRKMPKKMKJJJJGHJJGFFFGGGGFMKJJILLKLLLLKKKMMPQNNPPPPSXZ_]ZZ@sИMNPSUWYZ^[\_achhnujionvijgafabbaY]\`^XZZZXYXXVVXXXVSVVSSVRSSSUUSSTRVOilSRSTRSTNVSSRQQNONOSMMMQMQPQPQPMMMLNNMNNLMMJHLKIMOPPMMMPQTQSPNKPOMKIKI&?UPMMMMMMMMMLMMJLNQMMKIMMOMJJHLJJMKKMMLLJJHJHFHFHGHJDLJJJHNLLJJLJJKMMNPKKF"Pv[\ZZ]Z]XZZ\^k^WWWY[[[ZTOHJDCD@AA>>BA@7@>>B<>><:<=<=<<;;<<<<<<<@>@CBFHKPPMJGFCB@BABA???>><;@A?A>B>>===7;=<=<>>==?A@>>>>BC@>B@CCCCDCBHB/BCBDDGFGGGINQVPSOJIGHHFEBDFFHGEFCFGFFFGGFGDGDCCC@CGDBCFFFGGDGDFGEHICCHIGGIKIHGHGEQE%+4CGMMQPPNOLIJGGDECDDGFEDDDDCDBBCEDDCBBCFECCCCAABB@@@<<<8<<<<<<:=<<<;==<<><<<<>9B@ADE@&\YeimotzzААДГМxMHIBCFCCC@CBDDFECFFBDBDDDA@ACDDCCDEACCAA@==@A@@@@AA>A>AABCAHEGHKIJJH?DGIGGKMNSOKLMLKIHJJMOJqљµ†¶••І®©®©¶®®¶©©©ђђ©®ђ©©©©ђ©ђЂЂ≠ђ©≠ЂЂ≠≠Ђ≠≠ђђ©ЂђЂЂђђђђ≠≠≠ђђ••ђЦh {єЇЇЇєєєЉљєЉљљљљЅ¬ЅЅЇЛI<<:95899;887755<95556744698776467776667667799998999:<<;<<;;88;;<<:99:<::=;99::;498:><9999:77889;;<<:8:<>@>tћЊПcupproonlllkint`.∆ҐЯoVZ^XQPT`]ac`^ZZ^YZZVTSUPQRMMLIKEGIKILLLKHKKGIHIIDIFCKJIDILLOOr, )bMIJMKKKKNMKKLKKKKKJJGFDFGHGFGFJKHGKJHILLLKNLLLKKKMMKKNNPQRRTXZ`\VQ?tmMLMLNMMPOPPTWXUZ\^aaaekmrhhljkoihrkjjgbda`^\ZYXYZZXUWWXVXTXSRSSUUUWPOypVRUVRSSQRQRQRQNSQOQOMMOMQQSQQSSPNNNQNQNMNNLLNMLMLMMLMOQLQQONNJMMMLKL>+?dMNMMMMMOPPHNJLLMMJLLKOMOMLJJMLMQKMMMLMLILJFFHFHJJJJKHKJHLLJJLLJJJJMMLKE@OsSKRRUWURZZ^Z\r]^kfjrioohjaWSTPNKG@DCC>CA>=<==<9;<<<<<=<;;<;<<<6iF>B@@DCCA@ADFFJNPTQNMJCCCCBBA?AA@>@>CBB@<>=><>>;9;;<:<=>=???<>><><<<L>/GCEGGJGIKLJPTWXUPLHHGFDCECEEHGFECBCCFGIGGIFFCCBD@CCDDBCECFFDGCDFCGEGGHJGGIKIIGGGHJL"/7?FNP`USOMKKKHFCFFFFGGHDCBDDCFFFBCCCCCFFFCBCEAABAB@@<<<<<>?>@=<>>>?;?!*LIJMPPSX\]cgkurRIG?AA@A@:AG<@AAACC>H@BCD@>CDDDCDEEAC@ACA@@@FCBB@>>>C@@@AACHEGJHHKHFCGEGHHMMMMMLKNJHIIHLMRKj«±Ь§§І•¶•®®®©©ђђђ≠ѓ≠ђ©≠≠ђђђѓђЃђђђЃђЂЂЂЂЂ≠ђЂђђђ©©ЂІ©Ђ©ђЂ©ђЂ®Ґ†©Нa #АЄЇєЇЇЉєЉЉєЉљљљљ¬ƒ¬¬ЇНG;<<98999<:797579<45587966897666779976786667979979:9::;9;=;999<<;;<;;<><;;;;;<:<::<;@;987:<::<<;=><<=<<>D@?~ќ√ЦuzsqyqnnlkikijqW$qЙЙpfca\\_]]]^b^^]ab][ZXZZZXXURRMLKJLLLLLLMKLKKHKKLJIJHHLJJIJJMMZr,*ZPJHGJJKKNKGGJHHGFGFDBFDBDGGGGHKKHGJIIKNLLLNNMMMKMNNKJPMLQRVWYZ`\XSFcfMMLJKJJIJJJJNNGNNMQJIQUY\[[^`dgfhkqornkkljjjhc``bh`Z]]]]a[ZXVVV[YWYQ\БpXRTTTSQTRRQQRNNQNQROPNNMQSSSQQQQNNMMMNMMQRRNQOPONOQPMPQMQQQQPMMMMMMFF$BUNMMMJMJMMMFLLMLMJJLNPOOOMMJLNNNNMMLNJMLJLMJLLHEMMLLLIMKLMLLLMLJJJJMKKKJ=OcMGMMNNNKNQNQTVSU\^_cbgjhlob_^\ZZUTQNLIFFCB@A@?>>@<>>@>@?<=;;@GmD;B>>?ABA>@CBCGMQQQPKJDDD>BBA??>@BB@CC@@@@>>=>?<;<<::=>A><=?>>@><><<>??AA?BB;B9+KDBCEGFGHJ>TVV\UOJHJGFGGHGEFGHFGCCFCEJFCCFEEDDADCCCBBBCDFFFFJCDCCEEGHGFCDGGKHFGHJIJ*6=GMQTUSPOLJGGIGIKIGJGFHGDDDDFFCBBDFCFFDCDBBCCCFB??B>>>=>>=??==AAA?=??AAA>@@?<>A<@BCC%.AMDA@<=>BA<@=<><=ACA@@@FAAACAAAEDCCEB<;A@>;ABAACCD@?@@AAAACAACGEJMHJOHHHHEHHJMMMMMMKLIHIHJLIJJfЋµЬ§§•••••®®©©©ђ¶ђ≠ђ©©ђђ©ђ≠ђ©Ђђђ≠ЃђЂІ©©ЂЃ≠ѓ≠≠≠ђ≠≠≠ђЃђ≠≠ђ±®І§†ІЛZ "ДЄЉЉљЇєЄєєєљЊЊЊЊјЅЅЅЄЙE9><98767::8965754+4566755755886697999;96667:7997:<9::<<:>=9:;:<:9;=;:<;;9<=<<<<:9;;;;;;9;<<=><<><<:>>;@E=AВƒњЩoxxtwqrqqponkksS"]xs`emnmkvrplr_\YMbZJZWX^_b_^[[XSSOMOOONOMOLLELKKKMLILJKLLKILLPR`p.*XPMJMMMMMMKHHJHFHFCDDADBBBBDFIIHHDDGKIKIHKKILMMMMNMLNNNMMNRUV\^f\ZZC%P\MLMLMKLJIJJIJKJFCLIHGIKLLNMPPPSVX]\_edfjhgiokhqmjkjghfgged_`][\`[ZVVhЖ~ZZXVXZTVVSTSTSSSMOQOQSPQRQQSONNNNNNPPQLMQRRRQOPPPTRPNPMMRQQRQQPQPONMN!EdQPOOOONPPNNMNNLLMMNMNOMOOMMLMNMMLLLMLMLJLMNJLHELLLLLIJJLMLLJLJLLLLMMMJL>JOJDNOMLJLLNMMNMLNSWTUXXXXZ^[[^_be^bf_X\ZTQPLJHFEEEC@ABCEAA@=<<@BBAA@@><>>DLBOBBCB@=AA?>>>DDIMMOOKJHGGCA>===<<=<<<>>A>><<>>>AAB>?@AABBBBB?B52FGACBGGDGDBPTUVROLJHGDGGEECCGFGGCCEEFGGECFCFCGFHEHFDCBCCFFEFD>DCCGIGHGB@GGGKHGGJHHH(5AEHNQSOMMJHDFGIGIGDBFCFBGFDCECGFFCCCGGBGCBBCBCFC@9>><>>>>==?=>AA?A??BA==<=<5VYLGABDB@AA?BB@>CHDAACABBBECECCAACCCB@@B><@AA>CBE?>A@@@=6CCAEHHGGHJLHHHGCFFIMMMPPMMMIIJLJLKMXlƒіЯ§§£•¶®¶¶®©©ђ©©≠©®¶©©ђђђђђЂ®®ЂЂђЂ©І®®©ђЂ≠≠≠ђ≠∞ѓѓ≠≠ђѓ≠Ђ∞©®•†≠ЙR $ЙЄЇЇљљљљљЉєЉЊњњЊЅ¬¬¬ЇМJ9<=<:;9:9;888579326234445665563684<8:=:,=>69;6995579<=<;999=::9:;=@<<=<<<====<<;9;;;>C<<З»«ЪjxzwxutssrppjipZ!P|\H%2<@JZr}А†yНЙВxohfddedb_]\\XS\VVUVTVTMSPOFNMMMOMKKLIJJH@ILRRZd//cRKJMMMKKGKJJMKLJJFFGFFDFBBBFGHFFDCFGGHGFIIHEEIHIKHIILNKKPOOVYZ`[UU=!(M[KLNPPMLMJLPKHKJHEPKKLMKKKKKKHJJJKQMRSXUZZZ_cehqolmsqqtsrrrsomiegfe]YjuZX]\ZVXVZZXXURTSSUSSUZRSUWUQQSUSSQQSROMMQRQSQPQQRTSNNNMNRQQPSSSQJONRUJeNQRSQQSQNMNMMNQNQMNMMQOQQMNMMONOLMLMHLLLLMLJNMKKJILMLJJGQMLILJILLLMMMGCCJMJHJMLLLLMNMMNMMQNSMQNPNPNQTUSY][]^ec]`\\`^[XXWTRUPKMLLJFGDBB?@ABCCBCB>=>AIE\GCCABA@BA@<>DJPLQWNKMHGHCCCCA?BACCA?AA=>>>BA<<=<=>>=>=<@?><<==>>AB?BB@@BBABAB@83BA?FCMFFHGJMQUWUONKGJIFEGEFGGGEFFDCCFGFCCFFFFGCF?GF@BEFCCCDCB@BFCIJFHFDCHHGKJFGIGKI*5BEKMQSPMOMHHGGIGFGBCGGG@C?BCBABABBCBCFAAAAC@@BBCFBA6"+MBIIBBA>=?A@>NWNHBBDA@ABBFC@>CDACECCCCCGEGCC@AEBEED@B@@@>A@@>@==>==>@=@AAAGECHHFKKJHGEEFHIKKKMMMMMGGKHGMJZsјіЯ¶І¶¶®©®®®©©≠≠ѓ≠ђ®©®ђђђђђ≠ђ®®ЂЂЂЂ©¶®®©©Ђ©≠≠≠≠≠©≠ђ©ђђђђ≠©©®•ЃЗJ*РЄЇЇЇЇЇЇљљЄЈЇњњЊјЅЅ¬ЉЛJ;===<<<;9997;76;65:4246668656:489785797699779879545668;;<;79:9;<=?<====9==<<<=><==;Е∆ƒЩez{yzwtytsrrngiaGl[;4nkknvu|К{ВrЕvП|ЙtjfZf___g[[nZ\YVY\VYRSPOOMLLHGGIJNNVc/0eKJFFGJJJAGGGJJJIHGHHHFFFDDDFDEDCDIIGHIGHKHIGGJJJJHKKMMKMKMOQVZ]ZRL@#%JVJLLLPNKKHLMMJKJMLLLLLNMKGJKIIJJLILMNMPIMPMUXWY]__dhjjqruv}}z|xwuqrhhgt|[^^^[X[][ZZZWTTUUUUSTSSSUUUUYSUUWVTTTQSSSVTVSSTTSSQNNQMNPUPOSQTQMPMRO OeNPRQQSRSMMMMMMRRQMNMMOOOOMLLMPMPMMMMLMNNMMLMNSNMLJMMMLKGMJLLNMLLMMOLIECE MRHJMJHLMMMNMMMLMNMMLPNMKMKNNOMQPQPQZUSRUZZZ[Y[ZYZ^Y[ZZWSUQPLKMJBIIJGHFCCCBG9VDCA@@A@BBBBDDFNMSVQNMKHGCCCCCCCBBAAABB@>>>A>=====>===<<==?>==<<==A?@@<=>A?CABG82:ABBFIDFFFHMRRXUMLJGGIHFHGFHHHGGGGDDGGFDFFGGFFBB@?@>?CABCACBBADCBCDCGFFEDGGJJGGHKOJ!)5IGLQSUSPOOMKIIMGHGCEGGEEHHGHECGGEFGGGIFCCFDBBAB@@>>>8>>AA@>ACBA@CCCCDBCCBBC>ECC@AABECCCCAAA>@@@@B@A@>@@><:@ACGEEFEFJKLMGCDEJKIEDEGIGIDDHH@JE`wі§†¶І¶®¶¶®©®®®ђ≠≠ђђђ©©ђЂђ≠≠ѓ≠ђђ≠≠ђђђ®©®©©Ђђ≠≠≠≠ђ©ђ≠©ђђ©ђ©®®І£ЂЗD/ЧєєЇЇЇЇЇєЇЇљњњњЊ¬ƒ¬ƒЉКL<<<<<::;9997<8896777544668656:9997999::99::9;9;::99879=<::97888;;=<<<<<4<<=;>?;>==ABCEC~ ЋЧnА~||xz|zywvsrm_ Arc; "lZZYZZ_c]dgfllttЖГ{ЖНКu||nto_cZWZ\U\]bU]ZZYYTTPMQOMRPQc0 ;dMKC@DGJGDGFDFDCFEFFFCBCFBDGDDFCDFKIEHIGGJGIJGGKKHGKKMMMMMOPTYZ[ZOMG#HRKMKLOMMKJJJLJLMMIKKLKKKKJGJJHIJJJJNNMKEKKJMNNMPSLUVYZ[`dl|zyА|ГБuБ}{_gzhkiga\aba]]^[ZYXXXXTSTRSRUUWTRRSWWSRRSVVSSTSSMRTSTVSSUSSWZTUSRZRSSSaK YjUPPROUQNNPMLJLNPMMMMMQOMNMMNOQPPMMLMLMNNMNMMNPPMMJNMNNNKNLLLMOPMPMPLKLLA"PRHLLLMJMMIJKLMLMMMMMMMMNNMNMMOJJPMNNLMPQUQSQQQSRUXX\[[[[f_bYZh[UZXVTUPOMMKJ6OGHDCCCDCCCDDDFLIRWQLKJJDDDBAA?BBBBCABB??C?=>=>A>=<>A===8<<>AA@CB>@<>>?<>@AABCBCCBDCCCCBHNC:*/;NNMJICBCCCEHKQTMGEBCAAA@>@@@@ACCCABCB>>B=CCCAA@CEBDC@ABA@@@@@B@A@@AAA=;<<;?=<;;<<=>==?;<<;<===?==>BHE~њ ФwЕ~z{{~~z~{zxr_Do> !q[UXUWRUSWYWW[ZVadagsxrwАq~БsД~{zzukkdcfd^Y[ZXXXSSWWY[_/$=PPMJJGHHJGGGGGDDGDFGHFCBDCEDDCDCDFGHDHFFFJJJHGBJJHGFJJMKMMMQRY\\ZRUH MUJLLKLJKJHJJHHJQOJKKKKJJKJKKKJKHJGLLLNIEPPMMNLLKPNNMPVTTZ]ejnpmjnpqyЗM[pyuqsrpomkkjfd`b__^[YZZXSSSXUUVUUUSTRTXVYTSSVSRRTVVRTWXXYWSTTRSRQQQYN[lWRPSPYSQRPPPNQNPQOQONPPLMMMOMOOMLKJMLLLMMMNMPLPMNMMMNNMLMLLLMOQPLMMMMHHAVPHMMMMMMMMMKMNLMOLKKKKMKMKKJIMJJOMJLLLMMPMOGJJLLLSSRSPQUSZ`Z]ibdde__m`^`]cY9TTQOMNKJJJKLLBMQPRSRMLJHDDC?AA@>AACCCD@>ABA@?3?A8<><>=>===??=@>@>===?AA?ABC>>@@2 4?BCABGBBCDFMNPOLLJHFFFCCFFCGGCDCEDFGDHHGGHFGFFGFBBBBBECBCDDDDDDDFFG@AACBBEBBBBCCBBDE@9&5AAAACCCDCE@=@AAAAADCCECDEC?@BA@>=>A>=@>=@@@==AA@CACC;FHHCJIFHHGJMFGEEIIDDEEEGK?^Гњ§Ы¶®®®¶®¶¶©®¶ђ©®©©©І©Ђ©ђ≠ђ≠≠ђ©®®©©®®≠ѓ≠≠≠≠ђ≠ђѓѓѓ±∞≠ѓ≠≠≠ђђ®ЂІЂДC G§ЄЇљЉєєЇЇљЇљЊЊњЊ¬¬ƒ≈њЙI>=<::97868689;99997777544756536766879<<99::9<::9:99:;<<<;;998:;=<=>=<=<;<;<<====<=======A?AB><<;?>8;;<<>><>@>=<>@A?C?AA==?B@<=@CDCCGCCHCBDBCEBECC@8.8?IJOJGCCBBCFIIQWLCCAB@>CBB>A@AA@ACBBCEECCABCBBCAACDBEBDCCCCA>B=@=<===@==@AAACE@>CECDEFFFHEHFDEDEKK@DGEEEIDZГњҐЮ•®•••®¶¶©©®ђђ®ђђ≠ђ≠≠ђ≠ѓ≠≠≠≠ђ©ђђђ®©≠ђђђ≠ђ≠ђ©≠ђђѓ≠ђђ≠ђ≠ђђ®•ЯЂ|? @ЂЄљљЉЉЇљЇљЇЇљЊњЊјЅЅЅЇЙF@@=97:888988:;66899;9::;999;:59<8977::<::::6<:99;<;;<<<<;;9;:<:<9;;<;<<::;;<==???=?<=A?=AACF?????=?==C?AGI}ЊЄЛyГ}~{~А~~~А~z],-ZПЕN. xb\][[XXYXSTRTSJPOMMLKKMKQSLLUUZZ_cgnlqsqЖЕВАzrrtyukx*ФЋ}r\VTWRP]RPOPOMJHGGFG;GEEDCFGGGCDGHHFGDCFGGDF?GHHEDGGJHGKKMUXZZXQP@!JIHIHILGGKJJHHKHKHIJKFHJJLKJJJDJKMJKMQSNLNNNNPPPRRRSRRVTRXZ\`]ZXWPOOMLD#TМOWRY\Z\\_afmhg{mlymookjhifdfa`a^[]ZXZ\\ZZ^XYVXXXVXXTVVVYWVUWTVVWUSMQI[pTPRRPRSUUSSUQQTUQQUQQPQQNQPMOMMOMNQNMQQQOMPQQSSPMMNMNQQQSNMNMPNPMPLJMKJ5(XPIGLMJMLMLLLLLQMMMMLMMMMMMMJMMMMNLNNNMMMMMMJLJJJLMLMLHLJJJMMMMMMMMMNNNPST[X Dtbffaq_^a^_`]_aeghgd`]XTQPLMNILJFFGECF>BBB@@B@@@<<<<=>===@==<<=?=AF.6CACCCDDDGIMP_YWTNKJGFFHGIIDCFGHFCCFFFFHHGCACBGDGBBBABB==>?@B@@FBCDFGFFDGGGGHDEIGMJG)6NINSVSVQPNKKIGIGGGIGGJEGGFCFCGGFIDCADCBB@>BCA@BBBB@>C8=???=AACAADEFFGEECCBECBCCCBG@83?FMMNHGGGECFGBIQZHECAAA>>><<8<=:;=AB@??==??BB>AA=HL¬ЄТАД~БАБВААААК|d+-dФЖ^=($СkjjbURYXRXYTUSRSPMNKKJJJKMMDGJJLLJMQQQWZaccrsrnС~Д††ЮЪ+ oХ{vlfdfb^`XTYXWUQPNMKJCFFCDCDGFB@BDDGCEBBBCDGGDIFCGHHKKKKKLPUW\[YRODJOJPKKLIHNJJJGGHIGGGFCDDGGJJGG=GGGDGKLMLLKNNMPPPRRRQQTRTTXYZ`]YVSPOLJMB#ZgNWRWTRSPSQVXZ\^acceegromrkqljhrkhegjhda`\ZZ\Z\bXXZXXZZVZXYZ[XXXYWURSNnnRTSSSWVUUSQTSQTSQOQQQQSQQRPOQMMOMPQNNNQQPQPQSQUOPRQMLQQQQQNQORPPQOQFOQR2-S\IHMKJMLLJKLLJMJLNPNOMMMJMLMLMLLLMNNLLMMMMMILIKHMNKLLHJLKMMMMMMMMMKKMJMNMMMDy[ZS\_bacjihihkrrzyrvskie\YZUDPN7LJHGHFHDCBCDCCC@=><@A=>>A>>>?>AA?ACABABB@BCCCCCDDINVUSQLGGBCFADGHCDGHGFGFGFCGFCHJHHDHGBCBBBFCABBBBDB@BBCDFFFFDHFFCGFBFDEF=*9CGMQQNPPNMLKGGHGGJHIJJGGEDCDDFGGGGFGHFDDBBCDB@@BED><=<==>=>ABCA@?@AACBBBCCECBCCBACA4/BHMMNJHJJHGJKCJWVJGCABBCJBBBBAAA@>@AACB@DA@ACCD@>CCB@BAA@@@AA@>@>>=A>@6>CCA@CBCDEDFFHJKKJFD@CFBDHGGCGGIIIO9gИЉ†УҐ•¶•¶®®¶ђ©®ђђ©≠ђ©ђђђ≠≠≠≠ѓ≠≠≠ђђ≠≠≠≠ђ©©ђђ≠ђђђѓђђЃЃђ≠≠ѓ∞ђ©І•Я¶Д1`ѓЈЄЉЉЇЉљљЇЉљљљљљјЅјјЉБE7<=;;;;866867:5;48897997977885897:<:<9<:>::=<<<<=<<>>A@@B@AA@HGВ≈ЄУ}ВА|~АБВААВАВ|i./hСЖiWD5' НУШГВ}vrkjke]`^ZWSPPMKJMJJMKJDHIHHHKHALLJNNNPPU[Z^fmwМЕ5:wrpДzУ{~|ppbhfdb`]]ZVTRMMaOMOLKEDEHDF?DAABDCDDDHDDGEHHKHKJLNRX\\YROEVOIJIIJJGMHHGGHLMJJIDGGACDFDEDDFDDBEHIIGGIKLKKKMNPNQPRPTRVXYb]YQPSPKHLB#JiNURQNOPPOMPOPPSSVPVYY\XX__gfhfjojqmnpnkjgeef`bgYZ][^ZZZ\]Z[\[[[YUWR]IvnUYXUXYYWWSSVSVXWWQUUSQTQSQSSPNQQPONSSQSQQQJPRPSQQRQQNQQQQNQXMNMPQOQMKRJ31RQNMNPMNPPMMNLJLMNMONOMOMOMLLKMLLMLJLLHMMMKHGJJLFKMKJJHJHEMMKMMMMMMKKMJMKJJ>DeTRCQRNSWYZYZ]^ggnqltrsrooglc__ZRXSONLLILIGGEBEC=EB@@>>AA>>AAAABBACBACA@AA@@EJH*!5BBFDCCCDGFIMQRPOJGDBBC?BCCBCCBDFEFCFFFCCGCDGDGCBBCEFGCBCCCCCFCCFFFDCFGGFFFEEGEFFFN;.;AFIOSPQMKLJJGGCEEGGJFFGECECCEFFCDGGGHFFGDCDECBBBFC><>?A>@@>BCA@@ABA@CCBB@@CCGCC@AG<5*JVNHHBCGCC@C@AACDCCCCA@CBDIB@ECBDCECCCCECA@AABAA>>>>>>=A:@BBCACCECCCCDHMFHFDCDDDBCGEDCDDHHJM7oФЉ£Ш§¶¶•®®©®©©©©ђђѓђђђђђ≠ЂЂЂѓ≠ђ≠≠©ЂЂѓђђђ©©©ђ©©©ђ©ђЃЃђ≠≠∞ѓђ©©ІЯ•{. [≥ЈЄЇЇЇЇЉљЉЉљЉЉљЇЅЅЅјЇЕF:<<999;9889:;<>B19;9;;767677689998:9::=<>=<=999:F<;;=@<=:=::88;=<<:::==;:<;;<:<>><<;<<<<<>=A>@B@AABB>~ƒЇФyАА{|}~{xq*gЛyngZO<1'!BСХДЦЗЗНГДД~xrmica^[[WXTNOJPPMLMLKIIIIGIHHKKMMILHMZ[Ze72HS\fkysz{ПИВГ|xrtnjc[[ZThXT\ZXXTTPPOKJKJIHHFIHIGFGDDFFDGIJLSZb^XNPE!KFFGFGGGFHHDDDEIGDKIGHDA==ABB@B@BC@AA>CC&%9DIMOQSNGMKJHEHCECEGHBBGEECEEGGDBCDFFGFBDBCAA>BBBA@<<>@BB@BCBDB@@BBBBEBBECBCDEBCCBE@2->A@@AA@>ABEGDBDDACFEEACDGCABDABAB@@AA@==A<@@CECCCEDCDAAEEEDDCBEBBBBBCCCEFHHHK@hЦіЯЭ§§І®¶®©®®©ђђ©Ђ≠ЃђђђђЃђђ≠ѓѓѓѓѓЃЃ≠ђ©ђ©∞©©©®©©©ђ≠≠ђЃ≠≠∞ѓ≠ђђ®Я•u* YґЄєЇЇЇЇЉЉљЉљљљЊљјЅјјЇДC<<=98;;8998:<:9<99;<><;77798889;;<;99:=<=><=::99=;<;==;<<:;;79<<=<<<8;:<<<;==<;<>;9<<<><@@@@A?AAABCCCBBBFFz√µХvА~~~}~~xwk!jЖrqkgeVJ>7!8Laryx~И~ГЖДДГzz}v|xsni^X\XWUSMNPPMMKLJMGHILLIGJLPVV]p5*RCANNQQPNY_kr~{КtШ{|ПШУwstrjghba^_^ZY]ZVURPPNPJMMLLIHHIFGGHMT]cZXMLK$MCBDDDDCFGHDCCCDEBFGCDAAAACDDGHGFFHEHGEGLKILLNMJJMNPHRRPRTYYZZVTPRROMLH!>TNPPMPNNNLOLMMMNMMNNPLKFJIIKKDJNPTTYZ]_`ggqlrurzxzxyyvxsttupnkhgaa^]]GylSUXUSVXVVVVVSUWSSRUSSSUUVTTXSTSVTUQUUUUUVVVVVTVTTRSSTTTSSRSSSMQSQQOQMID5"1MKKJKMMNMMOMMNNNNRNMNOORQRSNMLMMMQSOMMLPPMNQONMMPQLJMJJJLMMMLLLMMMMKLQFLKHJJ5ACGJKJJJMMJMKJJMMSSNOMNQVY[__\dgjhfhlkgofdhda`][VTROMLKJKGGGGCB@@BBB@CBCCB>>@BBAA@>BBBBDFCCCBCBDCGHDDDGGFGMIFJHEC.;FJOQTSSMMIKKFGIGGHEGEEGECCEGGHE?@B?><<<<>AGABB@>BBGBEBBECBCEECCCCCB4/8@FJMMJIHCBNFJJYZLHGCB>>?BDB=<=@>@>==AAEEDBCB@@AAAA@CB@@BC@@ACBB>AA>@@==@CCCDCFFDDDAACGGFCCEBAACBCCCGEGGHMG`Эє°°£••¶®¶¶•©©ђЂІІ≠≠ЂЂ≠≠≠ђђ≠ђѓ≠ѓ≠≠≠≠≠©®©ѓѓ≠ђђђ©©©≠ѓђђѓЃѓ∞ѓђђ©££|# aЈЈєєЇєЇЉЉЉЇЉљљљЇЅ√√ЅЉГD98;87995786798999999<9:9:7478::;;=<98;==AB>><<;<=<@<=A@>><:=::><=><:7;:<==@@?=???@BBBBCCGCs«єР}~|{{~{~~{|{|{|g%hЕtrurlf\ZL;1,/KWejnnrur||z{Г~ММИКЕ}rvsjdb`[\RJMKMIKILLIJJKNSU_q5,OABDDCJGFIJMFSSNX`_gmozВЛРСРТНЖyЗsum[jiZ`\ZZY[XcWWWRRMLIJKKLQY^YSMON%UCEFDDFGGDGCFCCCGCDGDCCACCDGFDFFFFHHIIGIGHIJKKKHJJMNIQPRRTTXZYRPNMMMKOLCXPOONQQTPRRNOMPPRLNNMMJHJIHFGADJLMMMNPQPXYZ]abddiopvw|ЕАЖБИБ|}ytsokejOxqZ`[Z\Z[ZXZZ^YX\VSSSSXWWUVRQXXVVXVVUWWUWXYXTVTSVVSSTTTSXSSQRUSQSWSSSRQPO9'/YNLMNMPQNMQNMNNQQSQMMMOQQRQNNMMMMMOMMPNNNLMQNMMLMNNJMMMMNQPPMMLMMOMFNSNKKJJI$6BGIILLHHLLFNHJHHJLOKMJIKMOQQMMROQRY]\_ad`bifhfefda^a]]\XYVUQPLKGFHHGGGAFFCA@A>C#&@CBABJGGFFJMPUVQQOOJJGFCCDDCDCDGGGBFFFDFCDBDHDDAGFCBAACDCDDDCDDBBAFDGHGDDGFFGJFFFEEC-9FKNSTQNNMIIGFFGFHGADEEHECEEBCGHCEGCBCCDGCGI>>6<>>>>BBBBBCBCEEBCCECC@/,7>FJMMJIHGEGFGJe[OJGB@>>AECD>==@AC@>>CCDDGEECAA@<>CGCA@=B@>@BB@B@EC>>====A@A=<==C@;<===A@A>::=>=A>;<=><<7>@A>>>=?AAA??=<@@@AB@s«ЊЕt|{yz|zz{yyyyyf*cqrssqrpgi`YNF55'FXeejlnrrrpvtsqpvАЖМЪ~РПЕАВyqe\Z\^UTLRSLLJMPTUar3/PCDFB?IFFDCD@FH@FKCJKMNVWZ^bpruwЗxЖЗЙ|rutgeZVWRSYRQRTRSSQQVZYWVNYM %PIHHHCGGGEHDFCDGGFFGGDDBDGGFDFGGFFGHIHIHFIHHJHHJLJKRKNNRQQQVZUPNMKNMKMMDSMNNMPQNNPNNPRRRTSOMMKJKMKJKJHIJOOUPKMKPPNPPORPPUV^_`luyЕ}НИ~Жzz~t{{vQ_zkifdd`````^`[[_[ZZXVZZW[[STVXXZQMYUWWWYUUUTVVSUXQSRSQSZVVMSUUSUUSSQPQSO5;]UNPQQQQMOSQOQQRSTSSNOOQQQRQRVQOQNNMNPNQMMMNLLPMNNQNNMJJMMPPNPMLMNNJPJPMMJID7IMKMLMLLJMHTLLHLMNOMPNMMMMNNLMMMMNNPMNSMQUW[YY][]]_f__g_fbdd_Z\UPQONOMGKKJFDGGD#&AICFFKKGGJGMQUVVPNMHHEDAEGD>DDDFFIBFFGCDDD=CCCDGFFCBABBDDDDCCC@EGFGGJHLDDDFDGDDCCECB.:DKNSSOMNNJGGFFFFFCADFECDBBBABECCCECFCCCBBGFCB@@B@@>;>;<@>>?A>@><@>ACCEEEECEEABCGCC=.4=JJLMHCFFECBFJZ[KHE@>>>ACBD@@ACACA@ACCDFHFGDAABAAEJCAA@EB@HBCCA>>@A@;<@@B@ACCCABAAAACA@B:77999;98888;9;<:::<:<<<9::;;;9:88<<6<=<===A<<<==;<<=>:<==>@@><<<<8<=><>>:>FCADCABABCAA==<=A==>>BDAy»¬Аzxyyvtvvwvuutrp_,ajnrsrrronkec\N=*9BBA?FGIMKLUW]aiwБqЖsЗРsХvЖЙВ|rifgf`^]\Z\YSZVPTE ;}L8CHGHFGEGFDECFIIFF@CDDBFDADKGFEFDCGDHIHJGILKJMMLLNLNPPQRUXXXSOMKKHGIG>JJMMJMNJMNKKPPPPRPMOMKIKONNMMLLOPPSPPPOSRPPNOQRRRRWXW\^floqpnkmqrrtx~LXБ}tonpkikkjgedadbaW\[[[ZZZVSXVVYVTYWWWWWWWWWXYWWWT[WUYSVTVTWUSQSRQRNONPH.BdYPPUUSQQQQQRRRQRSTTUOMQRQRSSXSRRRQQPMOSNNPPMPSSSSQQQMJLMMQQOPPMMLMLMIJMMNJ<8KIKMMMLLNMIJMMLMHJPOOPOJOMNMLMPQMPPPMOOOOOOQQRTQQRXYZ]`^ebqhhcf^\\\YYYPVURPNMJF%#FJIJJIJKKMKPTYXWRPMLJHH>FFDDDCCCEGGGGEBBDDCDCCCCADCA@ABBBADDDBBDDFFFGGHFGGFDFCFCDKF>/BCFGEBCA@BECCB@BCCFCCFBBDFBC@AB>>>8;<=><<;<<<<>>=BBBBBBBBCECCEGGCK*%*>DHKKGCDCFDBDMZSKECA>@@A@@CB@AA@==<@BDCEEEGDABBAAAA@@B@C@AECCCAA@@@><>=@CABACCBDAC@@C>>DDJHHHLLJMZЯЃЬ°¶§І®ђ©Ґ≠©©ЂЂЂЂђ≠≠≠≠ђѓ∞≠ѓѓѓ≠ѓ≠≠ѓЃ≠ђ≠ђђ≠≠ђ≠≠ђђђ©©≠ђ≠ЃЂѓЂђ©§§†ЖhЉЈЇЇЇєЇЇЉљЇЉЊЊЊљјЅЅјЄЙG=@?<::658898898;9<=:::=<<<8799<<==<8<>=:==>>>=====>=<=<<=><<:===<<:<98<;>@==<=CAADCBAABBBB??;@EMFА»ЇЗАxw{vsxvrtttsol^,aolnqqrrrrnooj`WLF=/>@Q^bkije`ZQICB;GRY^cegklmtxxБ~ЖНЪЧХФТРД~tsogb75VMRPNLCCHDBBBA@BBBB?9@@<>>BCCA@?GKLKMRSVYbbfnnu~ЕЖМСЙНРuБyqvkgcfb]b@eЂИQSPMPMLKJCHHEG>FBD>BCCFD;=BBDDA@CCDDGIGHGHILLLMLMKKLPRQTXYYYVTPMKHFKFBOJJMIJJJJMGGMKKMKJKMJNJHLJKKJJJJOONVRNNSRPMPNOVTTVSSVY[^ceaYVRZZ\\^Z[Lftqrrrsrrsstpomlkkj_ec^\_][ZZYVUXXYYWYYWWWYUWWYYYYW[ZWZWWUXWUWURWWVVVTQON+"GiTSQWUUUUQQNNNNMQQQRVNNQNNSQQTQQNNRSQOOOQMOQOQORRTQSSSPOPSSSQQPNPNMQNJJMMPM;;GIKMNLNMMMJJLMLMMMLPJMMMMJMMNMMSMMNMNRQQPMMMMOOKKJPPQSQOQWYZR[\\]\\^b__a^b[ZXYU!%KMONOMMPOPISY_]YWRNMKHHEFFHHGEBCDFIGIFDDGDCBDCCACCDCACCADDCDGDBBCCCCBEEDEJDAFEGFDCL20?FHEPTQPNMIGGCFGHCCFIHCBBABDFDDFCGFCGFFECBCEBC@AB??<<><<<>>;><@<=AEEFGEAEC@CAAACAC@B@@??BACCCCA@A<<=@AA@CCAB@B@ACB=;::4787688<<=;==;:9=<9:9999:<==<=<>=<==AA><==>@AAAA==>@==<:<=:=<><=4=>=:@AAA=@=@=<=?ABB?@???>>>AA?@@FOEЕ»єИsstttsrrprssqnlc ,_viopoqwvrrsrnrleZNB>2>>@>?@CCGFEEFCFHAGKMPOW]gnmqzr|{qБz|syrvu> CЅ∞И_[VZ[YXVTTSPXOONKHGFGFCBBC@B@A=ABCDDDBGHDGGGHHHJKKNNPSVVZZZTQQMKKILB!JQJIMIJJHJJKKMJMMGGKKJPJFIFGHHHJLMMPPNMMNRNOPPPRTVSRSSXZ\]^YWROPQQKQML>h{UZ`ccehlpvqГurxssЕqwulhd`c^ZZV[ZZZXWZYWWWUUUYYWYXZXWYWWWYWUUWSYXXYYXVPN."DrWTSVWWWUSUTSVQNRQQQTSNSQSRRNQONMRQQNQMOOOQQQQOMWSUYWQOOQSSSQQQQSSQRQMMNMNS<CKIMOPNVOMMMMQNMMMNMLJJMJMMJNPMOMJKKHKMLMMMMMMMMMLLLLLMMKMPPSPOQQQRRSYZZa\pdhnd`/\lZ[ZXYXSUXX_cc_]WRMPMGJHHHHHHFFCGIIIGGGEDCBFAFDCFCDCGDDHHDDDDCCDEDBCEECFJHGJIIFGBA/.GHHGMPPMKHJGGFGEDHDFIFBABBFFDGGHDGICFFB@DCECBB@B?A?<>>>@===?A?BCBCBBFCBBCCFGECB@I!2@NILJCGGHIKGIQ\RMICCB@GBA@@>@?@@CACFHFHJGGGEC=CCEEBD>@=<<<=ADDF@CB@<@<=@AACC@?C@>AC>;@?BA?B@@AA@DGEHHMOOJLb≤ЉЮҐ•¶І®©©©ђђІЂЂІЂ®®¶Ђђђђђђђ≠ЂЂЂЂЂЂЂЂ©ђђђђ©ђ≠≠ѓ≠ђ≠ђ©ђ≠≠≠≠≠ђ©ђЂ•zoЊєљЇљЇЇљљЉЇЇЉљЊљјЅјјЄЙK@A@<=><=>AA>><>=>AA@>>==>A@=<::==@>AB@@B>@?><>>ABBCGABЖЌЊ{kvrpnnlngplnjeed.Zjgnnkorrqrrssvrolg^SE555LkpUTQ:5/7>MPXZ[\[]\\\_Z^W[_Z[eknpttvЕЗРЗ/3~МЗrxjfe^VMRPKMJCCCCACDB?@@CABCBBDCBBB?@BB@BDDGHEKMJNNSV[Zbnqq||xХ8'zИyepgqmhgfab_]^[YXUQQQPNMIJKJFCB=BCFHGDCGGFLDDGDCDJJJJKONTYYUOMMJGHGOBCJJIIGIKKJGJKNKKJJIIGGMHGIGGJHGOMLPQMKMQNRNPPPPRPRRRRRXYZYZYTRMMNPQOHG0[fQRSQVXZ[_\]`fiqrruy~~zrprrmkjhhgffa^`\ZZZZZYYZZYXZXXYWYYWUWWYVZZXZUV\NN*"=wYTTUWWWWSSZUYWTSSRTVVTVVSVVSSQQNRQSSSOQSQOQOQOOQOQNQNQOMNQQOQQSUTTTSJSXMMR3EIMOONQQOOQQPSPMPMPPNMOPONTMOOQOMJMMKKLLMMMMMJMMMLMMMJLLJJMNSLJMMMMMMQSQRVVVZ[dM /erbmjljfgccloqrojb_ZZXRPPOOMLHGHIHJIHHGHGGFDE?FGEDBA?CGGGD>CDDCBCEDCEEECEFIHIIGJGED2!1BFIMNQQNLHHHHDBBBCCGGBBBBCFGDCCCDDCFBCCABBBBCB@><=<<>><>>>>???CBAABBEB@FCBCCFGGDCBAC!!4?OLIKGGGGGJGIP\PHG?@>8??<@A@A??>AAAFEEFGGHEEB>@CCB>@=>==A@BGED@@IC?=A?@@AA@AB@@@@A><<><<@@B@@@@ADFCHHLQOLH_ЈЄЮҐІ®Ђђђ©©ЂЂЂІІІђ≠ђ©≠ѓѓ≠ђ≠ђ≠≠Ђ≠ЂЂЂЂЂЂђђђ©©≠≠ђ≠≠≠≠ѓђђђ≠ђђ©©©¶®ҐtsЇєЇЇЇєєЇЇЇЇЉљљЊљЅ√√ЅЇМM@DB=<<9<<;9;<;;;<=;<;@;;=<9=>;==??>><=?=>A>A>:>>>>==;@==>BA==;;<<>=9BB>=?==A@A@AA@CACC@AAA?DABC>>@ADDDDHHGЛЋєБnsnpnmnollggfb_Y%XfcikhknknnqrrrnnpjhlZN=/CPIGFGGKKMJJKGGJJJIJFGOHGIIIGIHJKKMJJMMOPPRQRPPPPRRPPRXVYYZYTRMMNPPMHM*OYNOPNPNPRVPTUXWZZ^`^`ginlpjqqooqpqqrpjhfbecbd_^b[^aZZ\\`[ZZYWYXXXUXXWXMK*!GvZTRTWUWWSQSSWWWTVSTXVUVSSVVRVSTSSSSUSQQSSQUSSSQUSTQQQSSOMQRQQSQUTTUQNNTNNV2CMQNMQQOQSQQQOMMOKNPPQSQPNMMOOPPMLOQQMMNNPPQQMMMOMMNNKLNLLNMNMJJJJMKKMOMMMSQSPMB*afW[]cdcheirvu{z}wsljge^]ZXUROOOOOMMMNJJHJHMLKGIFCFDBCCCCC@ACCB@ACCBBBCCDEFHGBIJGEJ+3@HKNTSSPMJJHHCCCBCFGHCECCCFCFBBCECBCAABAACBBA>><=<;8;;8<>@>?==B@BCCCCCBCBCCDFFGFHECC#%0?NNIHGEGGFIGJNYPHEB<><>@>ABCC@>?A@?CCECCCDEC@=@@@BA@>A<>=@BBDBB@D@???=AAAAC@@@@@@@>=;:>>>@BB>@@@BFBIJJMHHCaЇ±Ю†¶І©®©©ЂЂЂ≠ЂІІђ≠ђ≠≠ѓѓ≠ђЂ≠ѓ≠ђ≠≠≠≠≠∞≠ѓѓѓђ≠ѓ≠ђђ≠≠ђ≠ђ≠≠ѓ≠≠≠≠®¶®ЪosЇєЇЇЇљљЊљєЄЇљЊЊљјЅЅјЄМG=CA@=<<<<99;;99<=@=5;=6;<=7=B:>>>AABA>@=?@@@===<:;=9<=;<>>>@>>A@A>>>;>AAB>>?@>CBBF=?ACCCCCJGEС∆єЛiolnnnmkijgehkdR%'Pk`egffhhhhjllnklljjrge`UC4!#&***BOXbbbbbddaaa_^_^Z\[WY[]^Z`adaen*>wrossszЙАЛЕВИЖЕ{vrljf\XOLGGC@BGCB>8@B@CBG@B@AC>@BAADABHHLMX\^YTMGB"VDLJMS\fkmmvqyВrБrsromkhdd`Yc\YeUUkUUUSQPOMHMLKILJJLJJKMRSYZZUQPKJHJGUCA]FGGGDKKPJGGFFGGGGGGCIFBGGCCDDGJJKIIJNNNNNPORVPPPPNPRTTZXZXVTOQQPPMJM4CSMSNOPNMOPRPQPPPPRSNQVXXZP[`cagjiiosrЗry~quoonimkijgee`a`^^^\\\\ZZXZZ\RQ*/Z{\YWXYUWUUSQQUUWWWUSUWVVRSVVRVVXXTTSSSQOSSSSUSSQURVSSSUUOMQQQSSQTSSSRRNQPR_5%GQMNOSSQOQOOOMCMNMNNNNQSSPOMPMNMNQRRNNNPPQOMOOOMMQNNPNOQNNQNPPLPMMNOMLMLNMQPPMLH,JTPPOUNTWY[`bghjknumnyjmlgia^\Z[ZXYTTVRPLMMOMLKMHKKJHGGGGHHDFGDCABCBABCBFBCGCAGGIEK'5?=<<;;;<<<<<1===ABBBBAABCCGGFCBCCHE&!*BOOIGGCEGGGFENZQJGC@>>@C>>BC@@@@AA?DCGECDBC?=@<>@AAA@B>@<@AAA=<=@@?@@=???@A;A@CDBBB@B>@@@BBA@ABA@EEOHHLJEJhЇ±†Ґ§®®¶®ЂЂ≠ЂЂЂЂЂ®®ђ≠ђѓ≠Ђ≠≠ѓѓЂ≠ѓ≠ѓ≠≠ѓ≠≠≠≠Ђ≠ѓ≠ѓѓ≠ђђ≠≠ѓѓ∞∞ѓѓѓђ®∞ХqwєЄєєЇЇЇљЇЇєЇЉљЊљЅ«∆ЅЉКG?A@@@==<<;;A:;=<<@@8;=8<;:9:>==<=>>7<<=@A>>=:@@@;<==>@BCA>=>@>>AF=>====AA>>A=>>A>>@>=@>=>;@CBCBBBFJAТЊЇКhilnkjliggeaedaP'!Pibcdeefifffjhigkljiljjl`]R. %>LZabbbbdgdcab^_aa__^Za[Z[Y``[^`k*=scebjklqpqttxzyЗИЖИВЖТЙ}ЙВpkh_SYZOKJCEGCCBF@=A@C>BFBBFCFFILQX^\VNGG2(C?DFFEGJEORNUW]_fqЖjzЙtНswЛkЖysgbcg_bba^[[YZVTUQTPOOORQPNQSZ\TQNJJHHESEFOGFJGHJJMGHHJJKJJJJQIFGCFHEFFGGHHKGGIMIGHJLLOSPMNMRPSVTYYVQPNJMMMJLJW8JXMOMNPRNPRTRRRRPPLRQPPPPTKQRVWYZX\aeemkqurusysvywxtyurpmkmkjgddc`__\\YUS$$]s\YXXZYZWYWWYYYZZYYYWXVVVWVVQSSVYUSPPSSQSQSSTUUTUSTRRQUSOOSUSSSQRRSSRSTRSQZ5'GKMOQTSUSUSUUMMOPNNQQQPTWQOJNNJOQNNNMMMJMMMOOQOMMNNNMMOOQONSPMLPNNNNLMLNNQPSQNPY.AJMMNQMMMSMTVVXZY[`ccgefhhkijhkfghg`^^_ZYYWYURPOMMHJLHJJLLJIIJIHHFGGGGCFJGBOGDFFGKR/ 5>=??>>><><>=>=>=>===ABCBACCEBGGHCBBCEC%*>RLJGCFGGGIGHPZY@C>@@@CBCGHHFDFBB@@ACACAAB@A>@;@@@A>;<=?=?@=???=C9=@@A?@BBAA>@>B@>@C>BFAFJGJJMGOqњіЫ£¶Ђ©©¶Ђ≠ѓ≠Ђ≠ЂЂЂ©ђђ≠ђ≠≠ЂЂѓѓЂ≠ѓ≠≠ѓ≠≠ђ©ђђ©ђ≠≠≠ђ≠Ђ≠ЃЃѓ≠ѓ±∞ѓѓ≠®іУmАєЄЄєЇљљљљљЇљљљљЊјЅјЅЄКG=@@A@<@====H:9@<=@=<;>=<<:8;99<<::<>=<:9:====<<<=@=7==9>@@B@>==>>>?==>>>>>A>>>>ABCCBBA>ABB>@??>ABC@BBBBDFDМЊЊДcfiifefegea_][_Q)Plaa`abeeeeccacceggeggglcej;  uunrnnkkkkfgdeebfeba_^_[WZ^b`[[^n"5e^kdefiijkllrqlsvxz{{ДДДПСЙРРЗМБ}vjlf`^ZXRKLHHGJHHHFFFCIHJLRX\YTMDI/(F?DBBBBBAFIEHEIFGJPTVYZ^cjvuЕЕГЙЙЕДВwusmhccab_bc^[eZZZWTPSVUVSMMHGHGEPE%RJECQJHGHJGHHJIKJIIJNIGGGDGCGGIJHHGJJMQGJJLJJJMQMOOQQQUTYXVNNMJLHJKJHK:GRMOMNMPNSRQORRQRRIRWPPPNNMNPTPTSMRXZXZUZ_cegmlrvruyzy{|yБyzvvsmnmfhb[[ZS$%[sYYZYZZZXZ^WZZXW[[YXUXXYYZYVYVVU[WXTSUWW[UTTTTWTUTVSSSTRPORUSUSRRTQSSQSSUT_0&CMNNRUSUSUQURPQPPSQSNQQSWSSSOPNSSRQQNNNMNLPQMOQJMNNMMNMMOLLPMMMMNNLMNNLMMNMNPOHW/CIMMQOMMORMONORTTQWYZYYZ[^_`dafceljhegkglccb^_ZZVUPQPLMKQPKMMMMMLJJJJIGKKMGJHGGMIJT/!5BFMQTVVPMNGGICC><<>??>><@>@>>A>>=>ABCCCCFACCDCCEEEH!!*;MHEFDFGEDEEHNQQFE@A@=@@=>@>@@AA@>@EHEAEDA>@>A@CCA@@@@B>;ADACA======>>AA@@D>=@@@?@CA>@<=<>><>@<>C>EMFJHLHSrљ≠Э¶І©©©©ЂЂЂЂЂЂЂЂЂ≠≠ђ≠≠ѓѓЂђ±±Ѓѓ∞ѓ≠ЃЃђ©®©©ђ≠ђђђЂђђЃђђђђђ≠≠ђ©≠І±Х` %ЛєЄєєЇљљљљЇЄЇљљЊЊЅ√√¬ЇКG;A@===<=@@==<95=<@==<>=@@<=?:9<===AA@=>==>@@@==<@@=;@B@@>>>AABA>A>>>>>A>A>>AABCACBBBB@=B?ABBABCCCCACJDЧЇЊ~ckikfeccec`_ZVZY! M_Z^\]_]]_^_\[[]``aaaa_^]Y[<  oЕvsvvssrronkklklifeb_a\Zb`aba^^h%<``caabefeifhijklqorsqtww{}}ВЕБНЙИЙХУЕИ~|xrjbc\XXSHLMILOJLNPQYZZUMGT/(RAB?>>@@??@BGHFIIGGGGNU]`ihl{|wwЖw{u~turmi]gfbd^^_]`^\\YWROOLIXH*QRKHJIKIIJJJHGEJIGGJJIHDCCBAHGIJHHJJJIMIJLLKJKKNNNNOPQVWZYTPPKLMJKMLOM<BGIMKMMMOOOLKNNMPPPLMNMNPNMNLOOONQOQRORQQUUTXYZ^ab`gjjsy{ЦДКПСНЗГ|uuwplgX)!Xr\ZZY[X\ZZ^YZZXZ_ZZUUUXZXZ[WYYVRUTUUUSYUWUVWYYWTSVXXUVXWUWYYYZYUXTTVTSTSSPZ/QTRQMSSQSSOSSSSQTTQSNQQSSSSSOPNRSSRSQSSNQTPSSQOSQRRMNVQNQMNPMPMJMMMMNNLLMNMLJMFJ.GKQMOMMMQQLNLMQQNJSQQQQSSTTVVSNXZ[^]]egauehmdiffb`b_[^[W\VUVTTRRQPOOKKMMLOJJHHGKGHT,7CGNQUYQPNMGGCGFDDBFFCCADCBHGCBCCFBCB@CECBBCC@B><<<>;<<<>>BBCCEBCBCBCGFCI(->NHDGEFDCCDEGNUSKEBB?>@AB>:ACCDC@CB>B@>>@C@>@@>@@@DECCA>??==>@@AA@@>A@A@AABCAAAA@==@=>@@?ECGHHHHJJMuЊ≠†§¶©©ІІЂІІЂІІЂЂЂ≠≠ђ≠Ђ≠≠ЂЂ∞±ѓѓ∞∞ѓѓѓ≠ђђђЂђ©©ЂђђђђЃЃђЃђђѓ∞≠ђЂІѓЫV *РєєЇЇљљљљЇєєЇљЊњЊљјјјЈИG<@>>@@=;==<<:90=@@@<====>8<@===>AAB@@@A@B@>BBB@=AIBCCCCADHCCBBBBABA>@>>>AAA?A>B>>AAABABB@@A??ABAABBBBBBFMLУЅљxZkffcccc`c`a^[_^%,IZY]`___[]\Z\YWYYYZZ[WWWSMP7 Ysghmlnnlwnnqnrkkohffaa`\a\`a_\`h*=jdbbdhffffeijmknnjookpspttvwvww}}ГЮВЙ§ДЧ†ЫПФНtjffZZ\MUXTVZ\\XOJZ3'MDC@==@BCDBCAA<CGCJFGMSSSV_cglszДqЕЗoЛxutrooikcef_]WXXVX_C8£bAMMFKFIJJJJIGJIJGIIIGFCCDDG@CFCGKGHGMJKLMMMLKKKMMMPQVWZYTNMJKKKMMMKH<(@EMMJLLOOHMLMPPTVNPLMMMPMMJMLLMNMONMMMPPPPNOMQQTVNQSZ[agoszzВНЗВЗ~ЕГГД|xm(&P}rmihjgfeba[^^\^^ZZZZZXZZYZYWYURSRQSQUZXTUWYZZZXTVXZVTVXSUYZYYYWYWYVXVZXWQ`2eYRSQSSQSSQURSQTSQSNQRRQQPQQQQOQRSQSSSNNQSNSSQPQNQQQQSSPQPRQOOMMMQQNMNNMNSNMMMUE-CFIKMNNMNNMMNNNMMMNMMOSNNMMSQQLQQRUMQQSWW[Y]bcfqcfihgjjrngfaea_^_^_\XWSUURQQMLKLJJP."5GINTUTQPMMGGFFFFCBFFFBBCADEFCBCCFFECCEFCEBFC@@B>><<<<<;>><@?>=<<<=><>>ABCBBBBABBCC@H%/AHHGIDDCCBDFFPUNGGBBA?A@@@E@>@B@BBCDEEECEFCBA@@>CC>@>>@=@@@@BA?=>@=@A@@A@E@@@AACDDECACB@AACAB@@CFGGHJJJLMQ{ј≠†§І©©ІІЂ¶ІЂІЂЂЂ≠ЂЂЂ≠≠ђ≠ЂЂѓ≠≠≠Ђ≠ђ≠ђђ©≠ђЂЂЂ≠ЂЂЂђђЃЃЃЃЃђЃѓЃђІ£≥ШM 0ЦЇЇЇЇЇєєЇЄєєЇЊЊЊљЅ¬ЅјЈЕH@A@<>==;<<<>:<:<<===>?<<><;=<==<>B@>CAAA@>>@@BA@AAAACDCACFFFCBCDBC=AAAABBBBBBBFB>ABBDABB@@A?>ACC>>A@BACJIIМЅљvWicc_aaa`a`^\ZW\&'GUW\[ZZ\]][[[ZYWWWYYZUSSTMU?  R_X^_^_^^idceiollpigighedda\bb]dg-5jbfdfhhdeifjknnnqqrrnvssБttuvwtwwy|yy{u{А~АГЗЗКСЖЖМЙН|Гzvpghjkh_PNZ5!OGGB>>@BBBCA?A>>ABDDBCABCBAAAB>ABCBJFCBLMMOPWZ^fjftprzА{|{rrnYda\\^@ ^ќНfSMFONNLKJJIIMMKJJHHEFDDHHGDFGFIKHHDMLLMMMMKIMKJIJMNOVXXRMKJJGJGJJHB</AFJMMMLOMLMMMQSTSNNMKKNRONLLKMUOOPPOMOQPTQNNOPPPMNMPTTZ[Z^[`e]Xgikkmqtrqo"GА}u|wwstrmmjkhfdda\]``\\ZZZ[Y[YUUTRYQWWRUUWYWUVTVVZXXTVYPYYYWWWWWUWWVVXYXQg/YRQRSRQSWUSYVUSSSTUTSQSSURSQSSQQSQQQQSNNMLLNMMMOMHQQQSSQUSSQOOPMMQNNMNPMMTQQQPPD *FCIMONNQVQMNMLQNMQZOMMSNMLNNMNNLMMOJKMPMPSQSUWXUUXZ^_^bidjnhqfiolrolsjeec^]]]YXVSQ[,%8INTYVVYVONKKGFCEDCDCDBCC@AABABB=BCCCE@@BC@AA=@@@@><<<;<<>@B@AB>A>A>@@@BCCCFCCBBBCBBB#0EFIFFCCCB@BEELQM>EA?A?A@@@E@>@B@BDDEGEEFEECBABAABB@B<<@@A@=?@@@=@=A@=>=@A?@@AAACAAA@@@CCBCECEEGHJJLNLU|ƒ∞Ы§ІЂЂЂЂ¶¶¶ЂЂ≠≠≠≠≠ђ≠≠≠ђ≠ђЂ≠Ђ≠≠ђђ©©©ђ®ђЂЂЂЂђ©ђђЂЂђЃђЂЂЃЃђѓђІ¶±ПK 2ЮЇЄЄЇЇЇєЄЄЄєљњњЊљЅЅјјЄЕG?A@==<=<>===;<<==>==@><====C=>>>?B>>CAABB@B>>=A=<<<<@AA?ADFDCB@DDC=?BCABBCBDBAFCBBCCFCDBBBAAACBCA=ABCCCMJBЦ∆љy^f`_^_^\Z^][XXWZ$'GTYYXSV[[[ZZSZYWWUUUWSUSROOLT\WZZXVYZ]ZP[acgedggjkjjljifjjfig1/ecjfhkhfiiijmonnqqrpltrqxrttsvptwuyuwytu{z{{{}}ААВЖВЙГПИНЛЖКВЖwred:%KJID>@ACCCFBC;>@@ABAAA>=BCBABA>?ACDFDDDCADHIJDRPKTXY]dehqvt|Вt|yntpmkk>T≠±§bWUXRNQMOPLOJONMKJHF@FHHJGCFIMJMMGHLLKMLKOLKSKKMMPOOTYXRLLJHGFCFDD@9!/BDFJKKKKLLLJJNONNNNOKKNNMMLJLMQPRMPROQQQQQPPPOPRNVNPUTUYW[^\ZYPMTTUQYV[[Q"!Bslm{q}yyv~ЙytЗqqsmiihgfda`\\Z^\ZYYX\ZVVXXXY[YXZXZZZXXXXYWWYYYYWUUUWWWYYWXRh* bXQVTUSUWUSUTVVSTVSSTUTSWWYYSSQSTSTSSVQRRQQMNPSSQJQSNQQNSQOQQOSSNNMMNPQMJOOQNNME*SFIMONNQRRNNMMQOMSYQOMOPQPORPQQNNNPMMTPMPQONPOQONJMRQPSRUUVXZZfjlhijmokhumithjmea`g(!*?MUZ___a^ZWRPKGIGGGFDEDFJBA@BBCBAACFBD@>@CB@@>>=?><=<<;;<<>==?A?@@BBBB@ABBAA@ABCCFFCC.2GFLJHGBCBCCCGNZLE@?@>>><>A@>=@ABDDAACCACBBBBBBB@A@>>>><@?=<==?=AB@@F>A@<=<@CAA@ACAAHCCE@ABCA@CCCEEEHJJJHKYБљ£†§•®ІІІ¶¶®®Ђ≠ЂЂЂ≠≠ѓђ≠≠ѓ≠≠≠ђ≠ѓ≠ђђ≠ђ≠ђ≠≠≠≠ђ≠ђђ≠ђђђђЂЂЂђѓ≠ѓђ®£≠ЙJ 2§ЄЈЄЇЇЇЇЇЄЇєЇЊЊЊљ¬ЅјјЈЗF>B@?@@@==<;=<<===>===>>@@==B<>?>@B@>CBCBB=BB@AC>>><ABDFHE@>AACA=@@@AAA<@>?BBB@ABBCCCC@BABFBCBBB@BDDOOBЭ»Ј}jic_a__^[\]`XXWW#&GNTXUSYYYYYWUYWWTSSRTSSUURQF ReQVVUUSWYYVWZ[`_^^abcbccdegsifqg90cgpklsgdjjjijmllmlmnqvsr{roqtwrtttruuwtuwtuwtxwwwxwxy|}yЕЕВПЖФСЗУЮС9%gtxaYUPQQIHGIC>DB?B@B><;>>@?=@<@BD@A?ECBBA==??><<<88<<<<<=?=??@>?B?@@@>A@AFCCBG@C*,LHMLKGDFFGGCGRcMGCBB@@@@AAAA=>@ACB>@@A@@<>>><<@@@><<;<==9?=?>8;>@CECB>BCBCHCCDDCCCACC=7<9;:<<:=>><>@@A@=>>>>B>@E=>@BCBBACBBBDBDDA@BB>@BADFICC@ACC@A@?AC>>AA=>AAACBBCBB>@ABBFCFCCBCBDDOOEЮƒґtckeaa__a]][][XWU(%JOTXXZYYYXYWXYWXSUURSRTUUSR> P_STUUUUSUUSSWXWZYY]\[\^Z]^__b^ao(2dvpostzwurqrrtqooqsrrtrtqkorrqrqqrrruttuttttvrrqtttsttrvwt{}АААЗХШ:(uЩКЛ~~|zyqa__PXVLNNKK@DB=>>?>=<@BAA?==A>CABDDCGIFFIKKKNMNOVYZVSPMHPOOP<8pfeehhlvsswoeegeba^ZXUXVXUWIQOFNKMPGKJGFGJHFIGGHHJJNPQVYYXPMMKMKIGFFGK8!/CGMNMKKGKJHGJIIMPOMONLKIBIMJJLHJKKKLJLLLJOOLUQRNPRRPPVXVX\\ZVTQOOMPPPSUPH'8cSOWZZZZ]]_aaehkkrqptwuuuvrsrsplnkffd`^\Y^bb\Zf^[^[[[[ZYZ[[Z[ZYZYZY[ZZZYWZY*-z^XYZZZUUUSZUTXVYWYYWWYWUSQSSSUSQQRTTVVUSSTTSTTSRQQSRRRTWSRSVSTTUUUTTUSPSUURPPMD-RGLNNNORSSLQOOOOQPMMKLMMQOMOMMNNJMNNNSQNPSPMNLMMNOOOPQOMOMNNNOQOMSTSSQMVXT]YZ^_^\hi*Ww{xИuy~w|qkh_d_\[ZURRNOLLIHHHJJJKHHEFFCCHCEEBA??BB>>@DBB@>>?BBBCCCBB<%/IHJHFFFCCEECEQWJCCB>>=>A>@>>@@@ABAACAB>@@A@@=<<>@@<<;>>@=?<>>@>>?><><<7@@@BCEC7B@;CECCAHDCCACGCGHFEGHJHNH^Кє£ЯҐ£•®®©©®©®©≠≠Ђ≠≠≠ђђ©≠ђђђђ©ђ∞©ђђ®ђѓ≠ѓђ≠≠ђ≠Ђ≠ѓ≠ѓ∞ѓѓ≠ѓѓ∞ђ≠©Ђ°ЈЗ@<ђґіЄЇєєєєєЇЄЇЊЊЉЄЅЅјЅЄЙG:@@>=>@A<><=:<=<=>@@A@@@A>>@@BB>>A<=>AABA>ABCBBABBBB@B>>BABCDCC@>@CCCBACCCEFB>CBBCDDDCBB@BBCEECFCFFIIFBMECП»ґqdicca__]]`][\XSQ#*MSWXZZZZ[ZZZVWWXYYZXZWYYYU]B V\SWZUUTSYXVSWYUUUXYYYYZ[YYYXZWZh2cichknruxxy}{}zyxvwylwururrutuutttwwuАttvrsurrrqqssrppqprsrwuutww~Л<'~М|ЕГЛЗЙПЖЗГwrxqnkf^UUJDEGCCBACCCBC??AAABADC?DFDCFGGJMJNPVVVQOJDIFGGL= 4CJLJGV]_bossmrАotslgecbacac[ZZYZYYZRPPOMMMKJJHHJJJMMMNSUXVNIMKIIFCGGCR51BGNNKKKKKJFIIIIJMJJLJKKJGHKMIIGJJLLLJLMMMOOMOQRONPPNMQSUVY\ZUTRMMKOOOPPIJ!7NQQPQSVTYTVVVXZZ\\\\cceiipnrsxupБwroqnylqhimh^c\\b^`^X_[Z\ZXZ[Z[Z[[[ZZ\ZX_T)/У`YZZYXMUUWZWWZYZYXXVXZYYYWWWWYUWWWSSUXSVTTVTUVRSQQRQQRQSRQSTVTSMUUTTUQPQSTVNRYE0EJPQSQQRRRQRRSSQSQPPMNQNOOMMJKLNMNNNNMMLMQJLNMMMNNPNMPFLMNNNNMOMNQNMNMMORNSSURUSMZ^*a]^cjhlrtrpyrwpnpkjf_cXTWYROPMNKLIHGHFFFFFDGC?BB=<==99==>@>>@?BAA?C?BFCCFDBBGGBCCCBO9!4FJIHDCCBBCBEBXVGBA?@@>=>>>>=>>>@@>AA>@?>A@>><>==>>?>=;>@>H==@>>>@8AK8<>BB@BBC@@BA@ECBC@IHDEAEEEGEEEGEGHNHZПЇ£Ю£§¶®®©©©©Ђ©≠≠ЂЂ≠ЂЃ≠ЂђЃ≠ђђ≠≠ѓђ≠≠ђ≠ѓ≠≠≠≠ѓ©ђЂЂѓ≠≠ѓ≠ЂЂ≠≠ђѓђђђ§≥Л68≥ЈґЈЄЈЄЄєЉЇєљЊљЉЇјЅјјЄЙH9@=>==BC>:<@=======>@@@C>@BBB@BCCCAAACACBBDCBCEAA?>>@B?>BBCBDCCB@@CAA@@ACBDDBACCCCACFDBBCCCBCCCFEEEFIDDMJGЛќЊqckeccaa]Z[[Z[XZ['N\VVYYY[[Y[ZYUWWYY\Z[[[[ZXVH a_WY\ZXWU^[ZXZ^YXRXYYYYZZYWWWWTT_#3WX]]]bcgqptvx|{|Б{}ЕzЙ{Аxwxvuuvvvwuqvttttrtrttrtuvtrtnpssstturtuwy@ $Зtwx}u~ЕАЕЛГЗИЮЦСРЖДА}ofb_\SPIHKIIHCDDHGEDFD?DFGGJKKLKLQUX^VPOJ>=@?=AB?B@BBBFIGCCGDCCCB?L<"#5EHGHFEECCCEGEXVGCCAA>>@=<<<<<=<<>>BAA@@>@<<;<<=@?>=>@=AA:<>@>@B@CBCAACCCAEECEHECECCECEGGGHGLHTПЈЯЪҐ§£¶©®¶®®©Ђ≠≠ЂЂЂђђ≠ђђѓЃђђ≠ђ≠≠ѓѓѓѓѓѓѓ≠ђ≠ђ≠ЃЃ∞ѓђ≠≠≠≠ѓЃѓѓђ≠ђ•≠З6 L≥єЄЄЇЄєєЉљЉєЇљљЉЉЅ¬ЅЅЄКJ;>><<<>B>;==<<<===>>=>?@@@>B@>B@CDA@CFFEDCFFEGE@AACBBBCBCFFFFBC@>BB>>=>@B=A@ABCCBB&Дyuzwwuy}ywt}~~АВАГДЖЙНЕАЖДzre__Z\VPPMKPKDMHGFGGGKKKKKLRVY\XQNKAGHFGN55EGGFCFGMJIGIIEFKPPQPVYZdfhrr||u{rs{mi_d^YZYYZSUTTSYONSQSWUQOMJHJHHKHHS24HJFFMNSKGJMJJJIIIIJHIIJIGIECCA>DDHGHHLMJMOMMMPMLLMMQOOQUYZYYUQNOMMNPPSMPJ)7FIPZQTRPPRQOOQRRURQROPRUVTVNJMTVVZ\^_cglno}qs~v}В|||xyxusrqllkjbcc]Z^^`^_U&<Ъ\\ZX[YX\UXYYYYVVVVXXZYYZ[Z_YWWXZVWTRUUWWWVXXVXXZZXXXRVVZVSUYXTVVVVXXWQOROPSNOP51GQOQPSRNZTQRMSQPOQQPSQRSUSSSQPPSTVSQQSTQQQNNNRNNNNQMNNMNQNQRSRMLLQSQMQPMQOOOOMQMKLI*;KMMRRQRQJMTZZ^a_`hihmkqmrmksplnhhecb_\ZXXUSPLMMGCCBA>>;C?AB?>>>@>>@@A>BDD@BBCBBCA>B<%7DIEEDEEBBBCCFWQKGEEA>@AAAA@>@@@<=@@>>?CBAG>==;;;<;=>>><<==>?>@C@A@@@ABCEGGGGGGDEEECHHGHHJHHNMQШЈЬЪ°§°®©®І®®¶®©©®®©Ђ©®ЃђђЃђЃђ≠ѓѓђђ≠≠ѓѓѓ≠ђ≠ђ≠ЃЃѓЃЃ≠ѓЃЃѓЃѓѓђЃ©•ЂД5 ZµєЄЄЄєЄєљЊљєЉЉЉЉЇјЅјјЈЛM>B@<>=>>><==<=@=<>>>>A@AA=>==>A;ACAABCCDCABDADBBBBCBBBBCCCFCFBFBBDDCBBBCB@BBBCCCABBCCB@BABCAACCCFEEEGGILDGХ«µz_ggceca]]`]`]Z^['RYZ[Z[ZZZYYZUZYSZ\a\\[Z^^[aH Z\TXXUUSSQTSUWUZZZZYYYYQZ^YVWYYXe'3V]UUUXY[aaeggjomppqrvy{Б~}}ББГВЗБЕ~|{nxsoxuqtsroororpppqqqqrrrrur;*qprrruttwyuwyyz{y{y|~А~}ДЙУЗКЙБЖzБznkdRUXCCHGELKKMKILIKPSVXUOMIGGHCGK8">@BCC=CEA>CBCB>?>=B5%!/FCGEDDGA=ACGGTUMFCCA@AAEAAA@ACA@ACEAA@CCCH@=@><<;;?@@>;<<=>A>>>@===A@AGGGECEEECCCA@HHHHGHGILGWЭјЪХ£••©¶®І©©®©©ђ©®©ђђ©≠ЃђђЃ≠ђђѓ≠©©ђ®ђђѓѓ≠ђђЂЂђЃѓ≠ѓ≠ЂЃђЃђ≠ђ©®§©Д. SґЄЈЄЄЄЈЄљЊЉЄЇљљЇЇ√ЅјЅЇМM@=ACAA<>==>@@CC@@ACAFA?BABBCBBBCBCBA@ACFCB>BICCBCEFCDCBFHDFBBBBEFFBCFCCMFGGGGFFCFGGJMJIС¬≠|^hea_^]_`a`]ZX[P!NXZ[ZZZZZYYZUY[WZ]_\\Z[^^[_M!VaWXUXXUUSUSUUUYYYYZXUTUYZY[YWUR]%5Q[XXXXYZ]^_cbcedggikkprrttsrywy{|КГНЖКИ}ГБw~zw|xrqouqsroqoooqrtqpuo6/gmtoruwusssuut{xtutvxzzvw{w|{ГБЙЖТЩЮЪЛФСФП}xrh_]ZXVJORMTUYZXNKIGGKDGK;>BCCDFGFDFDFFJFFGFFFEBCFCGIGFKJEMQOWY^_hqrgА}u~gvqhmbbe^_^]][YXXSSRNKLL8'@ZDHGIJJJIKHHGGGGIIJMMLMKJIJCFCDHGCGHJHLJLMJJKIHJOHHLLLOPPXXTRNJJJIIIMJHNC! 5HLNPPQWQOOOOOQQRUVRRRQQOPPROTPLMMRQRWWXWUSXWYZW]\^cigprtw}ДППКГГРЗАВ}zvrqrf%@Эf^bb`Z^`\\\\][[ZZZZ[^_^\^\ZZZYWVVUXVSXXWWW[YYXTSTTVVXZVXXVXZZZVVTTXXWUWVUSUZUU67MNMSUWUWUWWYSUMSYRUUSSUSTUPQSPNSTTSQVSOOQRNNMMNMMNNPMQQNNMPQOQTQQQQNSQNNSQNSSPPPQRL"4=FIUNQONNNNQNMWQOMMPNJPKSTRUUPWZZ[^caceholgtdaobec\XZZURPMKMKHEBBBFEGHCFEBCCCBCCBCBJ/)%2NRJIGEGCBFDBD\NJDB?@@>@A>>>>@@?@A@A@C@CAA@B=@@><<<@C@BB?:::;>>=>>=<;=>@A>>>@==>B@AF@CAAACCCCEA>CAACHGEEHFZҐіЪЮ•Ґ£¶®®®ђЂІЂ©©ђ©©ђђ≠ђ≠Ѓђ∞∞ђЃѓЃђ©ђ≠ѓ≠∞≠ђђђІ©Ђђ∞Ђ≠ђ©ђ®©®®©®•§§Ж$QєєЄЄЄЄЄЄєЉЄЄЄЇЇЄЇјјЊЊєКH=BAAAA@A@;<=@@@@=A@A>>BBA@A@>>BBDDCDCBBQBBGCBGFBBBCBDCCA>ACCC@CGBBCDFECBDCFFFFCBBCFDFCCCGGIIBFIGGJIIJIGOICРЋЄЖlhjfaaaaa`_[YWbU"R\YZXY[][YYZYUZZ]]\\ZY[^][TK'  P_WZXZXWUXUSXUXYZZ\[XXXXY]YYZXT\U*2XXPUUTWYYZYZ]__\gfcgegjkmfhkolqrrrsv|ББББА}}~~~Г}}А}|zuxvsttut{qqsr5.knrrptvrrorurovurusvttvtwvwwwx{yy{|~АВ~МДЖМЗСНХЩЖ~wsjjhcfgf_ZMOGMMIHE@BJDCBFFFDBAB?FFDEFCFBBDB@DDGAABBGGCKJMMMQWY]ecieorsy{yq|tnvflhc`^ZZ]UPc3|rWIFIGIJGIJGJGFGGGKJHKKJKJGFGDGGGCDGHHLJHLJJLLKKMJLLLMORTXXVSQMKMIKIIQHKD" 5MIKMMNPOKKOOORQRRTRRSRROMMPNNMKNNOORTSVWQUXXXXVYYYYZQ\^`fiorwy|zБ}ДПДВГГБk#2Тsmmjjgbfd^``\[^[\[Z\^_^ZZZZZ[YZWWYZXUYYTTTYYUZYVZXZ[ZZZZZXZZZXXUXYYYYWTUUSUYUU<8KKPQWWSSSWUWWSSRUWWWUUUQWUQQQSQTVVTSWUQQSSQQQQSPNJNSNRQQMQOOOOSSQQQNRQNQNQOPNMNNNNI &2=FILOPMMPPQSQMQOMMPPNPSOOMNMNNNRTRUTXY[]^^`_aaefnmechf__d_ZYWQRONJNNPNLJH>GGECEEEDDF.*%5SNKJICEEBCFGKWZKFC@?@AF?<@@A>A@>@>@<<><<<@AA@@<<<58>@:;;=>GA=@A@@A>A@ACCCACACBCGEDAC@@CHHHGLB_°іЬЯ£ҐҐ•¶®®®®ЂЂЂЂЂђ©©©ђђђђ©©≠∞ѓ∞∞ѓѓ≠ѓ≠≠≠≠ђ≠ђђ©ђ≠±ѓ∞≠≠ѓђђђђ≠Ђ•§•Л ^ЄЄЈЄЄЄЈЄєЉєєЇЇЇЇЇјЅЅЅЉНL>BA@A@=@@=@=@===@@@@@BBA>>A@<@CBFDDFDCBHCCGFEGGFGGCCEFFFCBCCEEDKBCDGFGFFDCCDEFDCBCCADCCDFFJFBFGIGIIIIIHRCEС»ЈВbjjhgecccccc^[]V&]dZ^^^]`][aYXXYZ[[[ZYYZ^]ZQO% SdUUUYXUVYXSXUXXZ[\ZXXYYXZYYZYWYQ)%8WWUVXVYZY\Z\`ca\dcbcb]dcfcbcffhkllloqrutsqqrortzz{~}}~АБГ{~~t|qrss9,kqsrruyrusuvtttrwtrvtrssvrtxuuwqtutvrvsvx}{~~ВЙЗГЗЕПЕЕЙ|ПД~{rng`]ZRRLN;#COKGEGGJJGFFFGDDCCBJEBFDACCAABCBCEAGDFDBBIIELMPOSSYa`kivut}t~|sploehc[c6|Ћ|fYRPPPMMOMLJLLJJKKHHJKMJGCFFFDFCFGGJHJJKJJLIMNKJLLKMMPUYYVUPMNNMNMJMJJB+"=OJMMJMKNLOOOOQQRRRPRPPQOLMMLMMMJMMMPNNQQOQRVXXTXVVTVVXYY\aaffgffkkorprvzЖf"*|Ч|y}{Ж~{riljadfb``\Z\^ZZZZZ\ZZZZXZZYXYYTTTVYUZZYZZZZZZ_\ZZ\ZZZZY[][[ZWZZZZZYY_9=PPOQSWUURUSUUSUSOSURQQSSRSSSOQUPTSTRSSSSQSQTVSTTSMOSVSRRQRQQQQUURNQSRRQVPSQONNPOMN?#2=BGKNQNQQQMOMMOOMNNJNNOMNKMRMKKKMNNNPQSTRSTWPSXXZ[[[\^_^fbcig]ca`c[]\YVTOMPMOFKJJHDJ/*3MJMMIFEECCFGMWZKECCBBCD@B@=>>=@>@=AC@@EA@A>>><<;=<>=>=><<=;;>=;>==@@ACCABECBCEFFCEECCCHJJJMMc£±ЬЮҐ•§•¶®®®©ЂЂЂЂЂђђ©©©©ђ©©©ђ≠≠≠≠≠≠ђђђ©®≠≠ђ©©ђђ≠Ѓ≠±ѓ≠ђ©ѓ≠ѓ≠©ђЂ®П]єєЄєЄЄЈЄєєєєєєєЇЉјЅјјЉСO=B@ADA@@@@A@@@@@@=A@AAC><>>==A@@@@CAACA=@@=>><>=>>==>><=?>>>>====<=<<<:;=<<=<<=?@ABCCCAACBCDCCECCGHJIHJCZ£ЈЪЮ£І¶І®®®®ЂЂІЂЂЂ≠≠ђђђЂ∞ђ©©©ђ≠≠ѓ≠ѓѓ≠≠≠©≠ђђ®®®©ђђЂѓђ©ђђђ©©©®®§ҐНaЇЄЈЄЄЄЈЄєЉЉЉЇєєєЇЅЅјЅЇПM?CA@@B@A@=@@@@@@@@AABAABABAAACCCFDFFFCBCABCBCCCCFCC>ECABAAAFFCECCGGGGFFBFCDECGGGFFIGDDCHGIFIGFFIGGIIGFEJSMСЊЈЖ]omkjifeefeb`][g#jc[`_^]_\_a^^`^]]Y]]]Z]aa^`P( ej\YUXXXXYXXVYXXWY[YYXUUUXXTVVUQI#"=KQTTTUQZZ`\_^_^cae_[cdcbcacacffgehjehmmmmha[Z]ccaggfplmosstsvyyz~~Л--fИ~}~~yyyoqxxuusrtrrtutturt{utvttttsrrsrutsttttuwwvuy{{|ВГГДВГИЙЖЧСНФ59\ibb`\VOPQNLKLKGFGGGFFGDHHHHDDCFGCDCFGHDFEGFIJEGGGJMJMOXUPKJHJOXUW`jz_/GcАyf`bb\bb^\^ZY[YX]RSSRSPQLIJIGHHFFFGJJIIMMJMKKMNNMMMQLKUXVQOHGFBCICFGIJ4%%6OGIIKKINMPMNPNOMNPNOPPPQPMMOOOLMMMMJJMNPQXRRVTVUPURRSTXZZ___\\YZUXXVVWYYYZR.skceikgrsr{xxyx}}З||АzwusomjhfddZ]aa^^]^[[\aZZZ\\\\[\ZZ[ZYZZYYZYWZYW^ZWWYZZZZUY5+DUXWXXZZZZXUWWYYWUZZXVSUSWSUSUSUXUUUUUUSSSUSUSMRTLQQMQSQQVXQTTSTVRQRSVVSUSOUSUSRQNLA&!*>FMPTSSSSSPWPNMNOQPPPNMMMNMMQMOMMOFMMMMMMIJKLMMJJOIINMMKMFKPPQSXZ\\\_cfoqjsoiwhinip`$!AbecaYWPMLMLNQY\KHEC>@>@>>A@;;=>A@<<><==?@C@<>@=>>>>==><<<@@>>@>>;=@@CCCDCA@DCACCDDCDGMEDGG@S®ЃЫЯ°¶•••¶¶І®ЂІЂЂЂ≠ЂЂЂ≠≠≠ђђђђђѓѓ∞ѓ∞∞∞ѓѓѓ∞ѓ≠©®¶≠ђђЂђђђ≠≠ђ©©©©Ђ•£ЕbєєЄЈЄЄЄєЉєєЇєєЊјљјјјјЉЙJ?C@A@A@AAAABCBBFFCDHFEEEGEFCDGFEFCCGFGGHDBCD@@CBFGCCBFCBBDDFCEGEIGGACBCEGCFIKKIIGFGGIJJIGGHSMХ√ЉЗisolmmljikfef`_i'ic]`_a^```_`a`]Z]]]^]]]_^ZaM% [m[XXXYXYYZXZYUXZZ[Z]]YZZZ[ZZXWcR%FORTURUXWY^Z^___^_a^Zcbbb__a_aaccdehegmmmmg\XYZ_][bbagecejegikoooqq{//dГyВАГ}{Б|wГ{v}zwrjuoorqoqqВqqrrtvstssrv|rrsrrtttutrruwtxz{}xw}}~АЖЗЙН58s}ЙВКЕzrsmd_ZYPBJOMKKGJBGFGECB@BDCG>GMFCDDGDHIFFFCFGGJMRUQLJHGHKH@?LMV*!@N[_addfmuithhfZb_d]V__\]]ZVSSRPPPMJJKFKJJMKKMJJKKMMMNQLOVXVRQHKLGGMFFLJW5%%5HGIJJJMKIKKJJJMJMMINJMMPJKLLLHHKMJMJJMNQQNOOTTSRRRRUUSSVYZ_^\ZZ_YZXYYWXXUWM-kcWY\ZZ\\__bfehkp}stЕy|ББw~wr~rgpkjmhhfc^ad^_`a__\\][Zda[[^^^_^[][ZZZUWWXZZXRO30JXWUXVY[YZWWYWWUXUYZYWWXVWUVSUWYZWWSUWWUWUUSUWUUVRUUSSUTTVVTVVSSVVVVSSSQQQQSQSQTSQLD),>NMPXVSSSNNRRQRQQPRSRRNPOOMSVQQOMQOMOMOPNMMMMMMMJJIIJJJIIGGJKJMMMMKNRRQZUY[^_eabefp_($!Xpyqpfec]ZWXMZ]cOHEC@>>B>@E><@=@@>:8<<;>=>@>9><=>;<=<;=<==@@>=>@>;<=?==@==@;@@>@@BCCCDFCDDBDDCFGFDEHJEEHJHT∞іЫЯ†£†°Ґ£•І¶¶§¶ІЂЂІІЂЂЂЂЂ≠≠ђ©ђ≠≠≠ѓѓ±ѓѓ≠ѓѓѓђђ©≠ЃЃЃ≠≠≠ѓѓ≠ђђђђЂ®£~jЄєєєЄєЄЄєєЇєЇЇљљЇјЅј¬љЙD=B@;@@>AA@AC<><<;AC@>>AAACCCDHFDEEGGGDFLFFFDBCFHIJFEGFCCFDFGGGGGFCCFECFIFFMJEEFBFCGGFHFHDDFHFIIKGIGFLLRХЊЊЖ`qtommmollkilckd-hpcececcddbded^^^^^_^^^_^\ZV" UmXSUXWUWVWWZXXYY[[YYZYYZZZYZ[YVP'(JQTXWX\\\^_^___cca__a```badaea_aaaaccgiomkcYZ\Z^Y\``^baS]___accccc^m/+eskrtvvt}}}КЖЕКБЙЙЕБ~|ywwwsvqrrqorqrqqttrqotooqrtyrtttvvwuuyttzwtvqrzw79sПГЕСФПУЦХЖЛК|vrjkgc]UQLIPNLJCADEDHCFICCDDFCCFEDGGDDFLNTTPJGDFEEFCCCJP04CGMOOSSZa^ДmyЕnЙvА~khhb\c\R\[[\\]ZUSSOMGKMMKKJKLKCGMLMMQXXVROKKNKIKGGHGP<&8BIMLMMMKMNNMIMNQPMKMJNMMJLLJGDGIMMMJMNPQOJKMTQPSTTRRQRRVXZb`^]YZYYXXXVXWW[V)VVWYYYYYXYYYZZ]^_acdikkrxuwАyy|vАzxuzusrrinnhjjhhddda```^^^aa^^\Z^^^^^ZZXX\^^XV02hcWY^ZYZY[ZZZUUXXIXZYZYZYYWXVSVZZUYUUVWWWUUSUWUWWSUWUWUVTTVTXXVSVSTSTXWVZUUUSUQSZUXC%(+>HKNQSSQRQQSSQSRMQSSQSSOOMNQKOQSMQOMMQOMMMMNMIQMMJKJMMMJJJKKJGJMJIGIMKKNFNMMQQTSRUWS(#bjwpoiortirohea]PJG@@@?B@@B@@@?@@>;;>>@B=@A?=?:9===<<<<>????=;<<<;:??===<<>9>=<<>@C@BDBBBDD?EHDGFEDGEJLKMUU±µЩЮ££§£•®®ЂІ¶ІІ©©ЂЂ®ЂЂІЂЂЂЂЂ©ђђ≠≠≠≠ђ≠ђђђ≠ѓ≠ђ©ЂЂђЃЃѓЃ≠ђѓ≠≠≠≠≠≠†usєЄЄЄєЉЉєЄєЇєЇЇљЊљјЅјјЉИG@DA>?@CDC=BBBBA>><<=BA@@>BAABCCCEDDCFHIGCFMGHDDCFCDFFFEGFBFGCFGGGGHGIFCGFFIHHLIGIIBKGINNIHHFFHIHIJIKGHKQQSМµЄЗ\qtooqqrklllkei_"clcifedffgggcecb`b_caa`a__Zb# XmWWXXXUSTZUWYUUZ[[YXYXYZZZYXZX\O+LTVXVWZ]]___ac^acacaccecgggehdaaa_`gegkrlibY\ZZ\]]``^__XY\Z]^\__a]Wd0.abdfhjjkqrty{АВЗЗЗЕЗИБВЕВА~|}zxwxvusqutqrqrrqtqrqortrrmqtrqoousstsq}s54zwrx||~ЗВДУЖИШЕПСЕ{{umfdc`\WURMMOKLKHFJGFGDFFGGHGFFNQUVPLHGDDCCDB@FM3")>AEEHLJKKOPYZ\^cr|x|АqЙrrА_gebbde]f]\lZXdWXWSSRONCJKLMPRRWVUPKIMIIIEGEGJ;!;CIJMMMKKMNNMMPPPMMOMMPNNMMKKHHGKKMMMNPQTPPOPTRQPQQSRRRRUXZb`^ZWXVVYXTTRRRXP*S\TZYXYZVXXXWVYYWZZZ]\V_bc_aghjjtxrsvyyy}~{}{vyvstogijigada\^]^\\````^Zk\Z\^_^`,1tfZZZZZ[[^[^[ZY^YXYZZ[[^ZZYYYXVZXTWVSVVVWYYVYYWUWUUWWYWVTVXVXYVSVTSTSWWWYWYWUSVTYRX>&*0>ILMPSTSRQSVSRSSLRVVQOQSQQQQNOOOMOMJMMMQMMLMKJOOMMLJMMMMMMJJGIJMMMJIMMJMKMMMNMOKMKLS!%(ZXV\^belqmtsrkr\QJE>@<<>>??>@?>>>>@@>@@=>>>>>?@@?<<;>>><<;<>@A@>>@@DD=EMDCCDDCCELMJSX±≥Щ†££§£•©®®®®©©І©ђђђЂЂІЂ≠≠≠≠ђ≠≠ѓѓ≠ђ≠≠©ђ∞ђ≠ђ©©®¶ЂђЂЃђЃ≠ђ≠Ђ©©¶ђЩr%xЄЄЈЄЄєЉЇєЄєєєЇЇљљЅ≈√јЉЗK>CCAACBCB9>ABCA?>C@AACAC@AFCFGFFGHFGIKIJGFGEGFCCCBCCCCBCFCBFFGGGEGGHIGDFFFMKHIIGIIGJJGJJIJGHJIIIILIKKJMTOUМЊґПhstrrsrnrponnili hydijghjkjgkffcefabeccb`_]Ua% YoZ[ZZZYUU_TU]YU[[\ZZ[YYZZ[XWYXVS,(KVTTPSVZ[^__aa_cfcfcaaecggfca__aefegceiokg_ZZZZ^`\`]^__\[ZX\Z]\__ZWh1*`^^^^bbcgggmorrswzz}{}~ГЖБВВВАЗАВЕ|~xmvusskqqrssqrrquqtwwysrtqttttrpwk11rrostrrtvuw{w}А~АСЕСФГЮБА|}ytn`VUVSRNJPKLMJGKIJKGGIMPUVSLLGDKDDDBBJN1"3?<<>=A@A?A?:=>=>>=<>>>?>=@B@A@BA>@@=?=><=AA>@@@@AH@>DDEEB@@ACAACCCCGIIEMZ±©Ъ††§¶••©®¶¶®І©¶®ЂЂЂІЂІЂ≠≠≠≠Ђ≠≠ѓѓ≠≠ѓђђ≠ѓђђђђђђђ≠Ѓђ≠ЃѓЃЃЃЃђ©¶•Ъm}ЄЄЈЈєЇєєєєєєЇљљљљјЅјјЇГL@CDAABABAAA>@ABAAAABACCFACCCFFEFGKIJGJMIIGFBGGIIHFFFDBCFGFFGFEGEGHEGHIIKDA@@>A@>BA?<>=@=>>=?=<>;;=><==A=;>@>@@@<=>><=AC@DDB@BDDDCBACFFCDDHHKKKKR]≥§Ы¶Ґ•••¶®¶¶¶•¶¶®®®®¶®Ђ®ІЂЂЂЂЂЂ≠≠≠ђђђЂ≠≠ѓ≠ђђђђђ≠≠ђ≠≠≠ѓѓђѓЃЃђ¶•Ьj!|ЄЈµЈєєЄЄєЇєєЇЇЇЇљЅ√ЅјЉБJCFDBACBB>AE=ABCAMOQUUSUSUSUSMUUTVTTWUUUSRSRRPQSRQRPOOMNMKMNPPOMOOMMOMMMMMMMMMMJLMIJMJMMJKJHHJGJGHGM ,>@AB>==@>@@@@=B@>@?<<=>>>>;;==<<<>>;@A>@@><<<<=>>@=?@A?BBCCCCACDDCCCFJKKIGMcЄѓС§Ґ••¶ІЂІ®®®©©ђ®®®®©©©©©ЂЂђ®ђђ≠ђ©ђђђђЂЃ≠ђђ©ђ≠ђ≠©ђђЂђЃЃѓЃЃЂ••Ґ_#ДЄЄЈЈЄЄЄЄєЇєєЇЇЇЇљјЅјјЇГJCFCAADCC>FJA=CCBCCFFCBBCC@IFDFIINBGIGGFGIJGECCCDFFFDDFFHIHIIEEGHKIIFIFCFFFJMMJJFIJKLMMMMJJMKJMMLLKJCJLOPSOРƒЅДsyyxwwvvxwyyws|yn~rvtvsrrrqponllkjklijkijf]Z* ^gUXWYZXYXXTUXUZ[YZWZ]Z[[ZYXWUTSW2.VaXWUUUXZ\^aaddadaeeghedddddffggggkkgiorsi_\Z^\^^\^Z\^W_b__^ZZZZZ\Y^5/PZZ^\YYXX\\^^^`^_a_^addfdc`cdflkqttojhghkqqruwzА{~ysЗwz}twnr{irrkttqr^.)Zurrtttryprrrqrrttnrqrsstrtttutrtwty{~В~ММВШЛЛУФШЪЛtsrrrjeZUROPQGIIHGF**CDFDCCBBBPPQWYWXYUZYWUYWWZQSZSUUSSSPRPSSRRRMPMMQQMOOQOOJMMJMOMMMMMMMMMMMMLIKKJJKJLMKJMMMMKCR$*>FIJKMLJMMMGIQ]PD@@?<:<>><=<=>?>>@>GAA<>@ACA?A?><=>=>@AA@>@=<<>>@>@BAA@B@@>@>@>>@B@CACAAA>@CCBCCDJJGEGKaјЂЪ£§§Я§ІІ¶¶Ђ©©©©®®®®©©©ђђ≠ђ≠ђ≠Ѓ≠ѓ≠≠≠≠≠≠≠ђђ©ђ©ђђђђ©©©Ђђђђђ≠®†®ҐT'ФЄЄЈЈЄЄЄЄєЇєЄєєєЇєјЅјјЇДLCFB<>BBCACCCBBAABCFFGGEGFFIFHHHJVGIJIIMMILLEDFEFHFFFFDHHFGIFCGIGIGGGJIGICFIJIGJGIIJKMKMKGGJJIJKLLLJJMLOSVQЙ єСД~}}}}||}}~|ywДxrvxvtvstrrrrpoonnjnjjjjkf^T* ]fXZYYYYXXQQXYZZ\^]Z[a[[[ZZXYWUSS3*X`TSTWUWY\^^___adaddhheaacbdecffcehkikpqmj_____aaaa\^_^_c``_^^^^Z\Yj12LV]^\ZZZXZ[^Z\^YYZZY\__ab`\^`_hgkopjb`a\_aaggjooqqrr|ww~}ГФЖ{{y{wrВi-)\rpsrqrqqoortqrqqppqqqrkrrrrrrrpprnqptrqww{~~ВЙЛРУСЛКЦКПКДywrld_a_YRV!)LOLKHDDBCCEGGFGGFDACFBEA@DCACBCGGHGFLGGFGHGHLLHL\abfvivАwЖВ~ЛБuuwonjhid^^A@ТrRNKNLKMIKJJMJHJIHLLFFIIJKHJGMMMMMIIGJJJMMJMMNPPQQQQRUURUWWZZZWXUOQMKRMMNUJ.DOSTVTPSURVTVVVQTVRTRTTZTVXVTRSRPTWUWWUWZY]ZX\\]Z^```Z[`bfjohrsrsvuuz{|ЗЗЕИХИw+.wДvyzzutpmkkkiec``b`aa\Z`\[`\ZZ^[^[ZZ[[[^ZXZYYZ]]ZZ[Y][YYYY][Z\ZZYYYXZZUZZYZYWYZURT5"3EVPSYYWXZYXXUTVWQXVVXQWWWRUSSUUYUUSMRQQQSPWMOOQMIPMMONMNMOOOOMMMKIIMMIJIKKMKKMMMPMDR%,>FJJIKJMMOMCLPcNDCBA@@>?@>>=>;<<>@@A@<<<=?==<==;;=;;>@=@>>@@=><<>@@D@?@C@@A@A@A@E@BDCDFCDDA>?>ABCCDFGEEGGDdњ©ЦҐҐ§ҐҐ¶§§¶¶І©®©®©©©®®©ђ≠≠ђђ≠ђѓ≠ѓ≠≠©ђ≠≠ѓ≠ђ©Ђ©ђђ©ђђЃЃђЃЃЃѓѓђ•ЃЮM *ЮЄєЄЄЄљЇЈЄЇєЄєЇЇљєјјјЊєГJACAABBBFCCBBCC>BAABCCMFFDFHDDFFJJIFJIIGIGFIGHIIKJIIIHFIIIKMGGJMJGGFQJIQJGJNFFGGGIGGJJKJMJMJJIGLHKMLLMLPRLOН«љХА~ВДВВВВВВВ}|ЖxБМy{yw}xzxvtvsrrrolnnlljke^T+ YbQXXVVUSTNRXY[Z]^\[[[[ZYYXY[YXYO;,bcWWWZ[\^__aaaekecfeeedehhedeccaaddffkmqkg_\\Z^_a_^Y^___bba^^_^\\[`f2!5UV^`\\\_^^ab\Z\YYX[Z\\__^[ZZ\Wccejhc[ZXWXYYZ^_`_bc_bdhjlpruwyБ{zА{||АД*!1cwtvxturt{tuwu|twppoqoterrprnppnnpmmnonqrrrurtuw{}АВАКДЛЛМХИМИДА}wyu_(QUPOMMMLJLLJJHJJGGCGIDDB@CAA@<>B@DDDIBECCCBACCGGMKKGSPS]aet|ЕЗ||Ц|ЗЖ{yvk^B@ЊЃm^RZWSVUVTTWTOPOOOOKMKKKKGGHKKMKBGGHJIGJMIJNMMNPOOOOQSSWXZZZZWWUPRRORQNMOF/JWMTTTQUVWUSSVVRRTTVTTTYVXWVUUURQQRUUWSUXYYZY\\ZY\^`[ZZ^^aff`cceeeccfjilkmrpnuh$(ЙМВМДИЖК~}xtopleb`b`_Wf\XZ^Z]]^\ZYYZ]Z^^YZZYZZZZ]][][[[]]b\\^\^[[ZY\cZa[Z^ZZZZXTL53HTPUYWWYYYUUUTXYXYVVXTWWWSUUUWWWUUSRRROSSSYQQQQQSWKNQMNQNSOONNONMIIKKIKJKJKJLMJMMNDH%*;CKKKLKMOOMKMPXMGCABB>>?AAA@><=A>@AA@@=>===?==<:>9::;<>@>>>=>;<:@ABI>@>A@>>>A@@>@@CECCDCCC@>=@ACDEGHGEEIDGoЇІЭҐ§£¶§§•¶®ІІ©®©©®®®¶®®©ђђђђђ≠ђ©≠ђђђ©≠≠ђ≠®®ђђ≠Ђ©©©ђЃ©ЃЃѓђ≠≠®∞ХK 2ҐЈЄЄЄЈЄЈЄєєЇЇЇЉЇєЄЅ√јЊєЕFBFCCCCCFECBDDFBAAACFBFAADCFCDFFGIGFIGIGFHFHFHIIJIFFLIFGIIKMMKMMMKGGPGKVMGNMAIJFIMJJLJJIJJMJJIIJHJLJMNKOPKNУ ЊТ~~ВДВВВГДГВБАЖv"ТП{~~~Г|||yvvtututqrrpqne^. WdUYUUUTRQPRYY[[[Y[^Z[YYZXWXXYVYW7%lgVUUYZ^`ba_ccghfcdccehdeheeeefcceecgjnoqgc_ZZ\^_^^\^_aa_`^^^^[\^ZYU9DrШk_R`\^__``ba__]][ZZWZTRSOLGJKKPKCGGJKIGIKIKNMKMOMMOMOPPQVZZZYWRURPQOOPPVY91JOPQQSQUUWVTUUUVTVVVVVVXXXXURZWRQQRRRQPVUVVYYZZWWY\^ZZZZ[\ab^Z\]b]ZZ\___`a^Z_aP(*Кtrx~В~ФЕМФЗМСГБЗДАwmkbji]fd^\^]Z[^[[[ZZVZ[[YYYY]]^][_^^b^^^Z^\^__\[[a[_Z[a^[Z[YZQ58IZWX^YYZZZXWWXYZZYTUVUWWURSRRRRSSSURRSQSSSSQOOSMSUPRSQQQSSSPPOSQQRNNMKMNMMMLNLMMNKG@#(=CKKKIKMMMIMMOYNGB?@>><>>?A@>>@>>A@>A@@<>>=>>>:>@@=AA@A@@?>;=<>@>@>>@?B@@AAAA>>?>@BACEGEEEE<<<<@@>>><;=>@=<>?<@?@>>=<<8<;9;<>>>@@@>AD@?BA=>==>@@A@@C@A@@A@A>@AA@A===?C@?B@A@ABD5UsґҐЫҐҐҐ§¶І®®®ЂЂ©ђђђ©©©¶ђђ≠©®ЂЂђђЃђ≠ѓѓѓ≠≠ѓ≠ђђ∞≠Ђ©©©ђђЂђђЃ≠ђђ©®ҐЂХI >®ЈЄЈЈЈґґґЄЇЇЈЄЄЄЄЄЅЅјјЇНLBICGDDDCFCBCAFFCDCBCDHCFHFHIKKMKMJJJIKIGHJIPKLLIGGGJJGHKJIJNMNJKGGDIIIGFGIJIIINMKNNPMIMIJPIIIJMNKMNNNMOQN_Н ј°СЗЖЗЙККККИЕЖЗВЩz+¶ЦЖЗДДЗЕЕГГЕББ||{{|y|xvqkj4 `iYXXUSSSXXYZ^__]]]\[ZYXZ]][XUWQH.xbUQTXWW[`^``bbdfeecfcfccfcaacacfgigghopomb^^^_a_aaa_\a_adbfcba`^]ZW>3h`[YYZZ][ZZZZYXZZXZYV[bZ\ZZ[YYY[_ehc]\XTXVUXWUXVZYZYYXVPXYYY\ZY]VY[__ga+.Zbbahllmporrsrtz|{{x{xrutrqorguqjoknqopqpqqrqoqogtnpppssrtqqrrtrrrrpzhFД}}КЙФРННИРЖЖВwtof`XYYYSLKLHCGKGFGGHGDDDBAFGGFFCKJKKMKMRUSQNGKIIKKINQKO2"3FNSTZ`coiqtpwtrprklee]]Sj[Vgg_ZY`USTRPTPOPOMMMLKOQQPNMPQPR\Z_^XWWTR^TPRTURPF4LNNQRQRUTTRRURUURPTQQQRRRRRTTUQOQRVUSSVYYUVYVVUXWZWWZXZ^\_cfc`^[[YYZ[[\^^^]ZXXL%0p\W\\Z]\\Zafddkoqrv{ГКДЕЕЗГЛ||w}wu|oqmkgeihdfhbbb^d_`__d_]`^]_\\\\_]_^Z[ZYY[Z^ZZ^Q25HRVZXXUY]_[ZXXYZZYYYZVXXZXXYTXYWWYUUWUSUUUUQOSSUQQPPPSSSNMQQSNNQSLNSQMMNMMMOMNMMKKKB%&FJIKMMMJMOQPQUaJ@ABB>@B@BC@B><@>>>=<<==>=@=>;:<<<<8:==>>?AAAAB=?@@>>;=>@BBD@@@>A@@A>>>AAAA@A@AHAAF>@>@CG>SyЈҐШ°§†£§І®®®®®©ђ©©ђ©≠ђ≠ђ≠®©≠ђЂЂЂЂђђђѓЃ∞∞ѓ≠≠≠≠Ђ≠≠ѓѓ≠ђЃ≠Ѓђ≠≠©Ђ°©Ч<?ѓЄЈЈЈЈґґґЄЇЇЄЇЇЇЇЄјјјјЉСPFIDDCCE>DBABADDDFDBFGJCDECFHHKMMMLKIIKIGIGIIILMKJJGJJKKLIGMOKKJJIFHKMJJIIMNMMIJNMMINNMMJIMMJIJMMMMMNMNQOI_Сњ≈°ММЙНННММНМИКЙЖНz*®ФЗИЗЗИМКИЗЗЕЕЕГБ{{~}{sqr7 `rYYUSRSSWWZ]]``\^^_^[[YXZXXZXSUM3!ceUSUXYZ\`dfbbbddccgfgfegfecaaaccfgffhjome\\\[^^^aaa]V^_adbff`a`^]ZZ@7di_^Y\^`^^\^^^ZZ^ZZZZZ^[^\\ZZZZ\bbfe^ZXPVTPRQQUUXWWUSVXTVXXTYXY\OVVZYWc'2XWYY^`aadccejhmrtxzzА|{}Гz}~n{uirjopnnlpooqomomotrpqptvtsqrsrttoqolr]Dujrsow{~В}}МЖСЧЖЩНЬЩЮЪНЕyqg`_UUVMGMLCKJGDAADGDGD@JIJLLLMQTUQMGIHFHHHIKFL.2=DJLKLRVY]aceltnЕ|sХrr}xtg`jigb__Z\[^c^^YXXVTQNSPRPMOOPQQVZ]\ZZWVTJUQTRUVOMH"5OMQSSRTVUTSUWSUUTQSQQTQTRQTRNPNNPRTRRQRVUUVUUTWZXXWWXXZ^^bcfab_][[[^ZZY\Z\^\XbP%3_ZZ\\^^^^[Z\ZZ_^YU_gfgmqvxuВyy||ЗД|Чy|yБГБztutomjdieefffecfb`a^_abba_^[^][[][_[[\Q0?HPUXYUXZ\YZZWWYZYYXZZWXXWUUXX][XYYWWYWSUUWWSQWWWWRRRPYU[TN[SSRSQSNQRQMMMMMRMLPMMMKJ<'%GGHIMOOMMQONPSTJ;B@@>>@>@@>@>B@@A@?AAAAB@A@>=;5B?<:;;=<>@@@?A@=<<@@A<=>?=B@A=>=>@@@@@>AA@<@@>=AAAB>@>@CEBTАґ†ФҐ§§••ІЂ®¶®®ђђ©®©ђђђ®¶®Ђ®©ЂЂЂЂЂђ≠ѓѓ≠ѓ≠ђђђѓђ≠≠≠≠≠®®ѓ≠Ѓ≠≠Ђ®©§≠Л7R≥ЈЈєЈЄЈґЈЄЇЄЈЄЄЄЇЇЊјЅЅЉНQFGIEEDHDFCDDFIDDFFDNGIIEGBDHFIKKKKGKIIKHJFGFIKKKKIGIIIELIDJJKLKKIIHIMMOMNMMMMQNMPNKMMQNIINNPKLNMNNPTNMPRDaПњЇ†ЦСЛПИПРНСРННЛЙПБ$•ЬЙКЛКЛЛИКИЗЗЗИЗДЗДГ~ГГА{r7br[]USRSUXY_`acaa`]^[[[ZXYWXZXUOT%LaSUUWYYZ\bcacbc`ca_aeeeeceegfgfcfighloomc\Z\Z\^__aa]Z`__acc`]a`Z\X`5'fd\^ZZ`aa_]^_^[[ZZZZ\ZZ]^_^\\\\_bgiia\YVVROURRWWUSUURWRTXVXVVVVXRWWXXO\-4URUWYZZ^[ZZZ\^`bfkotxxy~АЗЕНИЙЗА}|}xxwsttrrqomtoprrmroqrrsoqrkrrqrpmsUFgnqprtrvvwwty|}}ВЖЖЖЛФПРППЛЕРИ~}uoid`][XRGHMOLDHJLKHKKNQTWYROHHGDGHGHFDK*4;BFLFFKKMPPQST[\edhsks~Б}~А|w{krm^gZefbcacaea[bZXZWUOTWSWYYYXWXSPPNPPQQRRLNC3HFNTVSSWWVVUUUUVUSSSUVUVVRVRPQPNRTTRRRQUTVVUSUUWXXXXWXXZ\]b`__^ZYZZZZZXYZ\\^ZUS%6SZX\^__\_____\f`]babbcbcfghhlooqirwwyz|ДЙМСЗЛЖЖИА|xqssssqpljhjffdfaa``]_^^^^]^][ZR2#FPWY[`]Y^]]][YY[YY[XYZY[Z[RXZY[[YYZYWSXWWYYYWUWUSUSURQUTTQKUVWUURSQQOPNNNNQUMMXQPNML<'"&MFIIMPQOMSQPPWTJBB=>>BB>@><<<>@?A???A??A??A;>:8?<;8<>>>A>@<=CEBA@BCE@@@?=@=>=>;=@@>>><@>=;?>=><>=>>>=>ACBSА≥ЭЦҐ•••§§¶®І¶¶©©©©ђ©ђ≠©®ђ≠ђ≠≠Ђ≠≠≠≠≠ѓЃђђѓ≠ѓ©≠ђ≠ѓ≠ЂЂІІ≠Ѓ≠ђђђђ©І©К1 c±ЈєєЈЈґґЈЄЇЄЈЄЇЇЉЇЊЊЊјєЛMEJIGEDHCAFEHDDFDDFDIGIIILJIKKKNMKNMNFFMKIIIIIKKIKJGIJKGJIDIIMMMKLMKGJKSNOOKGMQONPNLIISJJIPNMMKNNMPSSNQQVPcХњЌҐТФСУМФФНСПТРННПzЪЭНПТРРМКЛМКЗЙКЗИКИЗГДЙЕДАБq;i^]UTTT[^^ieeiggcaa`^^[ZYXYZYWQV%OoSUTTUXYYZ\\___\__Y\_cc_cbefcgfffiihjlomib]]\\_ac`a[\ga_aa_``_`]ZVX4'WfZZYZ^___^\^\ZYY\\YYXZZ[\[`]Z\_bhiga\YTRTPUUUWWWXXWUZWVYZZZYXXXVYXUVUc,/KOUTWURSUWXWWYY]]___ggiots|~~~}}z}|Г}~}xvturwultrkuortqywvrprrrrqnyQDjmnorrpnsrqoqsuutvtt}{}~ААГГИЛЖПИМБЖВ|~vog\\YKHIJJLHPORX\YYTNJKHJJHDJFFP$3<@BGEEGFFGIIJIKLPMSPRTZTV_lpltjxumuprnpjjob`d\iZZ^]ha^b^^^a`]\\VUOMOPPORPMZC5AJMNSOQWVQSVWUTQOPNPTURTTQTSPQTRRRTRRTOVVSWVVXWWXWZZZZWX\\__^\ZYZYYXXXPYZZ\\YTL"1MWX\^^_\__\\\\^_]_dcbb`b``_accbZ\geikmfry|БГЗТЩЙЕФКЦСМНИЛВ}ztrkehihfghb_dbb_\^^\[YS2$"BRZ[]a^Z`a_^`[Z\ZZZY[[[[[a[ZZZ]ZY[[ZZVXWWWWWYUWSUUUUTSQQTVTXYWUUSUSSQRRPQPMMMMSRQOMQ>'"(PIKMQRSOOYQQWU\KFAAD>BB>@><:::=C=4>;;:<@>>==E@@CDCA@AA@@@B@@>===>@ACCAA@>@=>>B@>=:><>>>>>@D5MДЈЫФҐ•¶¶§§¶®©•®©ђ©ђђђђ≠ђ≠ђ≠≠≠ЂЂ≠≠≠≠≠ђ≠ђђѓѓѓѓђ≠ѓ±ѓЂѓЂ©±Ѓѓђђ≠ѓђѓІН1 ]µґЈЄЈЈЈґЈЇЉЄґЄЄЄЇЉјЅјЅєКLFKIFFEGCACCECDDDCCEIGHFIIKIIIIKNPNNNJJKMMMNMJMNKPOMMMMMKKQKLMMMMOMMIIINMOPMIMMPMMNMKMKGJKSKFMNNMMPPNOPTOMdЧњ√ҐТУСУУХЦФФТФФТСШz"&ҐђФХУУСРНРННМККЛКЗКМКККЙЗАm7 iwZVPNOSZ]`ifgiigjgeca`\\^][Z]ZU`$YoYWWUTXXXYZZ\\\\[_ZY\_]]__c`afccbceehgkoc^\[ZZ^`b`c`d__a\a_\]```\UX*"L_^Z^^b`^``^\ZYYY\^ZXXYYYYV]\Y\]`gge`\XRMTRTVTVWXXXWUXYVXZ[YZYXXTYYVXWf+,MPXU\WWWWWWWSXXZZ\ZY\\^`VgkprrmljjllvrxДyyЖАГ|ВЗrwrkznutksqrprutrtrqzO#Jjrrrrqqorpnroprplpmqrotttrtwtwzy{Д~КЛЖУИЩМЙПИБtoika\\UZ]`^\YSGMMDHJDJKHF(2>AGHEGIFCFGKECFCGIHKJGKGDHMNNSWZ^]`ougЕsvФn|rpnjhhfhfefde`hfab_^ZXWSTRSPSORH8SOMNSQSSVNSSUTPPPQSSQPNRQPQQQPNPNPRVVOOVWVVVVVWXVV[ZZXXX\]ab_\\Z\WZZXXWZ[\bZXSM.UXYZ^^^\_\ZZZZ\[Z___`^^^^`^^\^\Z``\_bb_[ehgkppvvxГДЦЦТЪШ¶Я££°ЮЬЧТХБyyunholhd``^W]YM.!"BQZ\`a[^][_a`^Z\ZZZZ[][[[[[[Y[]Z[^_^ZZ[[[[YXXXYXYYWX^XTTTWW[UUUTSSQSRQPIRQNMQQSSSMMU>(*GHNQQPPQQQJOTQTKDBAE?>?@>>><<<>AAA?AA=?A=>>>@>:;::8<><<>>E@AA@>=?>>>ABA@>F=<<=@CA@@A@@=>@@A>>>:>@@AAAACHIDХ±ЫЬҐ¶•¶І¶І••¶¶©©ІЂЂЂЂђ®©ђ≠Ѓ≠ЂЂ≠ЂЂђ≠≠ђђђђѓ≠ѓ≠≠ѓ∞ѓ≠ѓ≠≠ѓђѓ≠ѓѓѓЂ©®У-ZЄЈЈЈЈЈЈЈЈЄЇЈЈєЇЉЉЉЊјЊЅєЙIDJEIFEFECCCDCDECCCGGIFIIHIIHHMMMNMMLKKKKKLMJJMKKNMNMNNKIIMNNNNMLNMNMLJTJMPMJPNMNMTNMLKNKKMIJMPMJLMMMPNQGMgЪЇ√£ПФУУШЩЦФШЦЦЦФХЧ}$!ЂђЦЩЩЧХХХЧФФУНЙЛЖЖИИЙИЗГЙ|uB XeMKHIKPZ`ejigjigojegf`aa___[^YY^!]uWWWWTTUXUWWVZ\ZY\ZZ\[ZZ\___`ad_abbbfgffaZZXYZ\^^_a_a_^_Z^a^^b`^\V\1%MZZ^``_\`b_]\ZZZ\^b^\YXZ\\\c^Z\^cegf_\VRTRPTTTXVXYYXVUUVSTXXVVVVPYXVWT],0ONYUZVTUWSXXVXZZYZYXY\\`\bfjmkfb_a]aaeehljpqqrz}xzzxzzyz{uuruwsuuuqwO%Jgrrrroooqqqsrrrrquqqrqrqqqqtprsorqtx{{АВЖЖЗРПХЙСКЙК}xvrssmnh_ZYXOOQMMMJG*/=EHKIGGGGIKJGGIIGGJKGJJKJLHGBHMKLJFOQX\bgpmuuА{}ВvАxsyppqZniee`c]b^]dUVYXVOEEVRMORTUSSOQQQUQOQTSSSQSYTQTQSRNNNNPTRSVSVSVXVVWXWWaWXQZ[`^`___\Z[UYYXXZXZZ^[WVP#0YWYZ]\^\[^ZZ[[ZZZ^^__``\^\Z\Z^\\^[ZZ^]Z[_bcffeahglptw~АЗТМТЪЭЩХФШЦЧХУНМНЖА}{wuurlk]+ %H^^^``a`_]```^\]Z\]]]_[[^[[[Z[_]ZZ[^[[[[Z[YYZYYXZYYY[YXYXZW^XUXXUXUVVQPPSRSUTSYQPNKR9""1CFJKNPNNNROOTTYJD@@@=<<<<<<@ABA====??:@@@@@<;;<:;><=>@HAAA>>:=><@@BA@:A;<==>>:;=====<><@>>>==>@A@AA@@HQХЄЪЫ£•¶ЂЂЂЂ®Ђ®®ђЂЂђђђѓЂ©©©ђђЂ≠І≠≠Ђ≠≠ђ≠≠Ђ≠≠ђ≠ѓ≠ѓЃѓѓ≠ЂЂЂ≠≠ђѓѓ≠ђ£¶Ш"TєЈЄЈЈґЈЈЈЄЇЄЈЄЇЉЉЇЊјјјЇЙJAFDIGGHJGDFFHFGGGFDIGGPJIJLKHNMMMMMMKKKIIIJJKMKMKJIMMMIKKNNNSNNKLLNPNMMLJNNMNPNMPPNMMNQNNOOOLOPUQPMMPNQWVg°њЅ£ЧУУХШЦЦЦШШШШЧЧЩВ+"©≤ЧЬЪЪЩЩЩЭЧХСКЕЕБ~АДВЕ|vrqМY% GYIDCEFP[agjljljjjgcjgfeea_a^][Zb!`oWYWWTTTSRRRTXXUUYXY[ZYY]\]``^a`^b`chfhebYZXYZ\^]^`^__^_^^_\Z`^\[V\2%RgX\\\]^\]]\\\\\]\\Z\]ZZY^\^\YZ`beoie]WVXVVXVV^YYXYYVTNRQRUVRTTVTVSUSLZ.4KNUVXTTURMVVTVVZXXXVWZZ[Z^ahge_[YZY[\[\aa[ccacfjjmkprswwxzzzzwvzzwwprJ'Ocsfokooruwrruutrooqqqoqoookkmmponoonptrtuwy|}БАЗЗЗРИФИПЛЙЙГЕ|vqgZ`aUROLC(,>EGKIIJIIIKHCFFHIJIGGJJHJHDDCNFFJJKNCKPWWVV\ZZZdll|xuЕuy|~tssng^ZUPX[LXf`][B&Щv]LSVTWQRQQSQRRRQVSUVVVVTUUQQQQMNRQTSVVWVSVXXYXXXUWUWY]\[Y__^^ZYYXXZZVVWZXXZVRM%0SWYY\Z\ZYZYZ\Z\^\^^^bbb]_\\]\^___ZZ[[ZYZ\acebbfa_aabeemqsmqwyy{|~ГЕПЦЦТФЙХЛМХИМЕА|e("(U`bab`df`agfdad``d_Pcd^\\^\^[^^[ZZXZ][[YYXX[ZYYXUXYZZZ\[YZYZXUWXYYUUWUWXTUVWXXYTQTRW5 "9KIMOQQPQQXQPZTQKC@;==;;>7=9:<<<>D>;@A><><==;:<>=?>>CCCC@@;@=@@>@>=;=9;A<:B9=>>>;;><=>===;==>@>@CA:CGMJGGIIHHFHFCKMI>IIIMMMNPNNNPNNNNNMMNKKLNMPMKNPJIMMMPKKMKNOLMLLLMNMKNNMMJJPPMMPQPONPQPNOOPPPOQPPQNQTVZZbЮ»ћ£ЮЩШЪЪЩШЫЭЭЫЭЭШЩИ"§∞ЫЮЬЫЬЭЭЭЩЦНЖ~{xvx|ywwaB4QЬ≠( =TCAACHNY^iikmkjijjekkjfkfeia_^X]*'nЛZUXXXUXURSPPQOOQRQRRXTUXWWXZ[\[Z\\_gfjfaSYYZYZ\\_^\^\\_^__]\\\\ZY]2"UkYZ\\ZZ\Z\\^^^\^\\Z^^ZZY\]_``[`_nmfbZWTVVVVSVWVWVYYXWQURSTWWXXXTTWYSP]0=RVUSVRTRTTVVVRWWUSRRTXWZ[]]ccf\XVUUUYZYYYVVZXWY[ZZ\accbhjqrrtprБ|Б||СF *KaГpnqrrqroooroqpoooqqqqqoqomtoooorqqmomnnppnprrrk{}yВ{ЙНИРРЧТЧФЙЙНЛВzqhQ)*FNOPMMMJJLKJFDDGGJCGIIFEGDDDGGFFGFHGJJMMMMHMPOMSVWZ\]]ehmЕuxФvМФuЫНБtnqjfea?#4ўЊn]XYZZYZYYYVTRUUUUUSWSUQUUQPOQJNRPRTSQTQQUXXYXWXZYWYZ]\Z\a__^\ZZXX_ZXZWWUXXUVH/QVSVYWYYYZYZ^\\\\\``b``\_]Z\\]_\Z\\]Z\Z\_cegbcpba`camaeehg^bgfccagmltwx|{Д~ДСЗТМФЭf.#iЕЕЖВzvtllqlhikdcdb^cba`^aac^__^^\ZZZ\^`_[X[YY[YXYYYYZZ\[[ZWXUUXXYUVYYZWVTXUXXXTTTRS2!:OKORSSSTQXTW]ZQMD@??=;=>=C=<<;<<<>><<9<=:;;:;:;;:<;=>?@@>@@ACCAAABAA>><<=<<;@>5@=>@@A>@@>@@>@===<>@>@ECB7OЭ∞ЩШҐ•§§ІІ®©©©®®®Ђ©©≠≠ђђђђђ≠ђЂѓ≠≠ЂѓЃ∞∞≠ѓѓ∞Ѓ≠ѓ≠ђ©≠Ђ≠≠ѓѓѓ≠ѓЃ≠≥Ђ§ѓЭcєЈЄєЄЄЄЈЈЄЄєЄєєЇЉЇј≈ƒјЄЕKFIIGFFFJFHIHHGDJKGGIIIINMMNNNPVGKNNNMNNMNNPPPPMMQNKKNKSKMMLJNNNMLMMNNMPNNMMLMPPPNPNNPPQPNNNRPMMOOOPPTTSYZ]Ы¬¬ҐЦЦЩЩЪЩЩЬЭЯЯЯЭЬЭЙ"°√†ЮЮЯ°ЯЯЬЯСКyqgpruwxpoU3*O¶«/ ATB@>8;<>@>=>==>BC@?=;>A;:;;>=;<;;;<>=@><@@@CCA@>==>@@>;;;=;=><>AA@C@>@@CA@EFE:JFDC9@DNU]cccaa]``dggiffeeecb_Zf*%~Эh^ecacbb^a\Z\ZYZVXUVVWYSSRQPQQPVVVY\^__YWWRQSXUUSTSRSVVWYYXXXYYVU[.'\jXX\\\]Y^^^][\\\\\Z\_VZ_\\^^^_abgii]XSPSRTTWSVVVXYVVTTVYUPZWY\VPXWVSPT,>RMOTVVTVVXXXXXYZYXWTTXUXZ\]bcb\VSSVRPQOQOMOOUOQQQRPVVTTTTVVXX^\\WYbcqJH`qvrtyxzБxxw{wyxwxutumtprsptpkommqrqomooo{morllllpnjpllnnppqsttrsz{}~ВПm**hЧНЙНyА{ztf]]_ZTVTORSBNOIJHGGGHGGHGGOJJJHHHHHGGJHHJLMHOKPSV]^\]^WNY_]]chsklO!Ue_`j`ne^^cbOZlbbjbhecaec\\Z\YWVUSROPPPSSPPTQPTQTVY_YZZ[ZZ\^_a^YYXZZ[ZZ]^ZZZXW^F&!1MVWV[Z\ZZZY]]\]\Z\YVf]Z]^^^\\YXZYYZXZZ^^Z^^^b__abbcb`cccbb```Zc`bgc^gfgigbfcffgiitW(,АЗАВЙСРМПФМТПКСИЗЙ~~zuurqqljha`a_aaaa^^Z^^^`[[_]_b[YZ_YWXZZY[][ZZZYZ[[[[Z[XYXTTZYUTW.$7IJRRSRSRQQTQUXWJA<@?=;<:<:@=@>=ABB@@>;@;;<<>>>>>><>@CAAECCA@>J@@@>>:9::=;<==:C<>@>=<>A=:@<;76EAAAFD=X•≥Щ†•••¶®¶ђ≠≠ђђђ≠©ЂЂ≠≠≠©ђђђЃЂЃђЂ≠ђ≠≠ђђ©ђ∞ђђђђђђ©ђЂЂѓѓЃђђ≠≠ЃђІІђkЇЄЄЄєєЄЈЈЈЄЇЇЇєЇЇЄјјјјєЗNINKJJIGGGKHIKIIKMJKJKNMNNMQQMMMMMJPTPQPPNSNMMKMNNPOMNPPMNKLLLNLLMLIMPNQMQTQNMTTPPPPTSSVJQOQNSQPSSQSSVVVWV]ЮЈ¬ІЦЪЩЩЩЩЬЫЫЬЬЭЪШҐРПЊҐ††£††°£НvC*<\hrАИСЧЪЪЬЬЭ•°ЕfPG\^\RNMCGMU_iaaa]ZZ\`dfefiacca`]\h.Д£jcgeeggecdbbb`_\\\\ZZYZZYVRQRPMRTUXY\^^YQURQQSUSMLRRQVVVVWVVUVXVU\(#drWWXXYYXZZZXV\ZYY\aZ\ZZ_\[\\\___egebZXVTVVVWVWWVYYVXVVVWST[WYYXTVWVSPQ,>XQR[VWUTTYYVTTYVXXXVTVT^Z\accb\XXUVRPNMOOORUWRQOQRKNNRPRPRRTVTVVXVVS\M BR[^bcdhjkmjryu}uuВuuwtxtrtqrrlppkoooooomqyqptprrprtqqpotmoqoqompntrnrqkn&/eБАЖПДТФЮЩХУШМ{wsphd\R\ZRTQMMIJIGGHJOLKJJJJHJHJLLJJLLKMNORX]]XYWOMPPQQOSSROB!CZUVpf{yyЖrДД{njefehfg^bidffb`_][ZXVVUPOTRSWVUYYWXXYWZ`ZZZZ\^_^[[ZZXYX\^ZXXZYYU= !3NSXX[Z\\ZZZ]ZZ\]\\\Ya]\]\\\YZYYZ\XZZZZ^Z\\^^]\]b_ccbccffc`^ZZ\_]``_bccedddfcbZZh`^O'3rkiorvywzДБЛЙИЩРРЮЛХТРЛИЗДА|urqlegegfa^]`a`a`^`^`dUZ_^]]][Z[[\`YZZZZZZZXZZYZZZUYUUUZ/%"7AMTVXXUUSXXUU_^K?<>====;>;@:@@=@A>=>?<=9=>;=><>>><>@@@@ACCA@AF@@>==;=;;A@@@@=F>CDA<=<9<<<@>ABCC@K®°ЧЯ§ІІ©©®®ђђђ©ђ©©Ђ≠ѓѓЂЂђ≠ђЃЃЃ≠ѓѓѓѓ∞ѓ≠ђђ≤≠≠ѓ≠ѓѓђђ≠ѓѓѓђЃђ≠ЃЃЃЂЂ≠uiєЄґґґєЄЈЈЄєЇЇљЇЉЇЄјјЊЊЄЗODMMMKKICENIINIFIMKKJMMMPPPNMPPMNMLPQQTQQQRLLMNNPPNQNPQQQNLQQONNRNQQMNNNORPPPJUTMQQQQSQQOQQONQSQVVSVSVWUVLdЮєЊ®ЭЫЫЩЮЫЮЫЮ†Ю†ЮЪЂПИЄ§††£Ґ£££МSKkkyГПХЧЪЬ††ЭЭЫЧУЛГГ|xrre\WZ^bbbcb^Z]]_bdbde`gica]jl,&СЈkbijjjjgeffffdcddcb`_^^^`]WUXUUUVXYY[\\YRTRQPPPOMLQRQTTRSTUUSSVSOc(&bhXVZYZWXZXXZY\VXZZYX_XVZYXYVY]^_cbb]XSVXSUVXVZWTXYXVYWXVVXYVVXXYXXVTVZ,@VVVZXXUTXYYVRVXVTVVVRRO\Z^`b``YUSSRRPOMOPOTRRQOMQOPMOMMOQTRPOPTRRPRORMDQQXYXY[^^X^ceiilmqrqsz~yuuwutrstrrrqqqpoqorpsprtqqqmrqotmnpoqoopptrppprn%9gtstz{}~А~ГЖИЩНРНКТДВБzusmea_ZUXTJNNNPPMMKLKKJJLMLNJLMOORUY[^\[VRMONNPNMMMJ<&A@FF??@@<>=>>;8<=><<<>=;9;==??<>>>?@<>?>@@AAA@?A>>>;<;<:;?>AA>>B@>EA@EBB><<>>@ABA?A?=><>><;<>>>B@@A@=>AA?A?@@<>B><>@>>@>@>@@=>@5=<<8;><@><<;>AAA@<=>><<=@?@ECACECBW•ІЩ†§¶©ЂЂ©®ђ©©ѓ©©©ђ©ђ≠Ђ©ѓѓЂђ©ђђђђ©©ђђђ©®ђ©≠≠≠ђ∞ѓ≠ѓђ≠ђђѓђѓ≠≠ђ®ЃЯrЕєєЄЄЄЈЈЈЈЈЄЄєЇЇЉљЉјјЊЊЈЕTNNNOGKKKINPMMKKMMNPPMNMMNZPNQPSPPPQQQPQPMNOMMPNNPQNNNQQPMPNPQQPQQMTSSPOQQQOPQTQYUSSVVSQPTUIPQQSQQSQQPRWXSZХєі°СЫЩЩЬ†ЬЬЯ†ЯЯЮЫ¶П|±ЮЯҐ£Ґ§ЮЂC:itВСШЬ†§°Э††ЭЭ†ЭЬЪЩЧЧУСНИА~{utxz|}|{{ywwqpsjnmmkhgal0ЃЉc^rlniiiijijlllnnjjljjiijglgleccccfbbedaZ[XXVRMTOLMKKKMKKGMMNMILKm0#_pUQPPPSVVSSKPVSVSSSRTTVWVXXXYZZZ_b`ZVQTVQQRVVXVVXYWTTVWWWTSVVYVVVXXSN_$DTUMXZVYWVVXZYZVVVYYWXXVZ\^_c^\ZSRQOQRRRUPOQROVRPPPNMOMMMMNPOMLMKMMMKNC%<=?=??A@@>>><><=>@><=A?AABB@<>@BC@>@EA<>A@@>>><>@9<<==:>>?B<<<><>=@<<=<;<<>:>AA?AC?GTЂ•Ы†§ІІЂЂ®®©©ђђђђ≠≠ђ©ђђђ∞≠ђ≠≠ѓѓ≠ѓ≠≠≠≠≠ђ©≠ђ≠ѓѓ≠∞ѓЃ≠©©©ЂЃђђђ©ђ•І†r$ЖєєЄЈЈЈЄЄЄЄЇЇєЇЇЉЉЉјјЊјЈЖQIKKKIKIKKNNKIJKMNNPPNPSSV\UTTQPPQQTUZTUQNPNNPQPPQNNJMNNMJQNNTQQPPMTSSJMMQROQQTPTTN[VSVSTQSPQSVRSVSSUWUXZVZХ¬ЊЪЫЩЩЩЪЬЪЪЯЯЯЯЬЫ§М!cі†Э††ЮЯЪЩAdtЛУҐЮ†††††††††ЬЬЬЬЧЧЧЧУЛЗДАzz|ГЙМЖЙПЙЕЛЗАВ}zwturonn,≥»^bliijigijjlkiijjgijjiijjiiggjeedfhhfjgidb^[\ZY]XUXUUSQNNMKMQMJLJ`7brOLLLLMQQPLFINPNPPPNNNPPPTXUVXY[]b`YVPOQQPUUSRSTWW\YVTVXXUXVXXVV_VV\QS!JcWUUWUUWUTXYYXXVTXXWXXV]YZbb`ZYRRPMRUUUROMQQRVTSTVRONPNPNMPMMHLLMMLJNL"=CGMMLLMMONLMLMNNPTQQRY]eb`\ZYQQTXY\_a_`ehkmurmtrsrsuyrqrrrrrtqqqrsxrqm^"5ZinlnnpomsmpniononpprrttuvnxzzБЗЛУЙПНКЫСКВ{xskehec]^^Z\^^^\YYSNNMMLLLJIM7!8HIKMMOQOGJPOUWAORVXUWWYZXW^]chiruxv|x|s|rrwepgbngehieb``cnbb[^^V\YTZXOZYZYXXW[>!8LUSUVYZ`\Z\]]]]\\]Z^``\`]_b_]ZZ\Z\ZYXYZ\\Y]_`^^\^`Z_cccec^ZZ\^``^^^_baaaa_bbbigfafH'5M]aegjhiiifiiiifggigiihkkkkiflm\oqrwy|АГИЙМЧУЫЮЬ£ЬҐЮЧФСНМЗГАyusromjjj`_hbab^`^\\ZZY_9(!=??A?===><;;;=;<<<===>BB@<>=<>A@::=>>==;<;><<<<<;>>BCCB?><@@@A@>>=><<@>@A?C@MGNNMOOJLJRQLLNMNPMOOUX^\\YTRMMMOORTUSVWWYV\\\`afhjmmlrvplrrsursuturon~^!;dvurooqqrtmmnknrnjllkjkmkohiqonoqrwtyx{КНПСЖФПЙЩИИНК~xzysoigie\\[XUSONOOMLM<$;WNMQOQRQLLPPTROOPSRSVLMQQRSSTYKQZZYUcfjlhr{zwrytzxnrnd[U\hZf^cfee`_ca]^`]^][Z\5">@@>@>@A>9<>=:<==?=>>@?><;;<;;;<>=;;::>;===<@=<=<<<><>>>???@=>@@@@@<>>>>=>>BLFB@V≥ЭЫ®©©©ІЃІ®®¶®®®©ђ®©®®©®ђђ≠≠≠ђѓђ≠≠≠ѓђ≠≠≠ѓ≠ђ≠ђ≠ѓ≠ЃЃђђ≠ђЃЃђЃ≠Ђ¶®†c *ШЄЄЄЈЈЈЄЄЄЄЄєЄєљљљЉј√јЊґНSJNMJKNPBJJJJMNMNLMNMMNOPQQNQTSVTQPPQQVVUQQUTTSSXQQVUQQTTQTQPQTTQSSUVWWRMWWWY^PTUNMPPVTTUUTTSSTQTTVVYXZWWR]Шљ≤ЭЩУТХШШЩЩЩЩЬЮЮЧ§Л!NіІ°°ЭУНЫW =k|ДЦУШЦЧЧЧФХШЧЧЧЧШЧЧЧЧЧШХУПМММЙМСУУУФРСПМЙЙЙЕЖЗИИДxА/ђЇzzurrrrrpnrnokkklkjkjlkkjlnlnjlkkjiijllkljghfda_\\_\\_\Z[YYYYXYTNf<hВLIMMJKMILKGGKNJMLMMLMMMJMMJNQXYZ]XVUPNMLMMNJJMNPPTQPNTRTVTRTVTVVWWXNL!M]SVXXXZZZYXYVTVXXXVVVVVVZ\]bb\YVRRRRTQNOQPQQOOPRRPOOMPQMNNPGJLNNOLMNSD?SLNMMOLJLJMOMMLJMLLNNVX``^YRLJLLLLMMMMMNOQMMOOOPTNNRYZ[hackhiroorryrmnt_%<>@@???CC@@@@@===>>>===>@??@@B?><<<><<@>=>=::=C>>:<=<;=;<;=<;<<<><=<=@A@AC@@>=@>@:ADFBD^іҐЦ¶®Іђ©Ђ©Ђ≠ђђ≠ђђ≠ђ©≠ђђђ≠≠ѓѓѓђ≠©ђђ®≠ђ≠≠ђ≠ђ©ђђ©ЂђЃЃЂђ©©ЂЂЂЂЂІ£ІУ\0ЫєЄЈЈЄєєЄЄЄЄЇєЇљЇєЇЊјЉЉЄС\MNMMPQOIJNNPNNNPNPPNPQQTUQSSUTVTQPPQPWWTTQTPQSSYTQVTNPPQQQTQNUTQQQSSSWVRRVWVVUTVUVUQTUVVZYPVWYVVUVVYXZWX^`Шљ≤ЩФНССУУХЧФЦШЩЩШЬ~%O∞•ЮЯЩТМЙF ;pxДФУФФХФУСУУСУФЦЦУУЦЦУХХСТСПСПМТФЧФФТНПЛКЙЙИКЖЗЙЕ}Е/®»АД}zyyyyusuttnppommnmmkkknnlnjnnnnlmmmlkonkkjgddabcc````e``^]^]ZRq9bOOPQPRQIJMJIJKJKFCJLKLLKKLKKORTYXSSQNPMMNMNMJMKKPQQQPNPRROPTVVSVSUURM#SZQSTUUUWXXVVSPTTVXVVVVVWZ``a_]YTPRRRRTRVTRRPPMPQQPORORSMPNNMNNLNPMLK\:"CIKNJKMLLNPMOOJLMJLMMPRPZb^ZUHJLMHLKKMLKMKKMLMKJHLIGIMMKNTSWVZ]`eggkkkhrZ$MRRRSSTVSURQRRRPRTTRRPRRTRRMRUVQOOPPTSTUVVYV\\ZY^_cfinrqvvuutЖuyrkommk^ddefccb8ЌЪqWR^]`\WZZ[\[Z^Z]\\]ZZb]^^]ZYZZYZYXZ\]\\Z\\^b^b`^^_acaef\^^Z]_`_```_b`a``gbceeebr@"%:Q^_]feffgiggegikmkgghjkkkggiigffcgfiiieiiikmmmmiruirywww}|ЗЙИКЛХЯШЬЬЪ®ЩЩЮЧХТРЛИГ~reH, L_fmgdeabhc^^\dRDA<><=>>BBABA@<==7:=@@>=<>=<@>>><<=<@@@@A>===F>B>AA>>>>@@@><<<=>>>?;?@;@=@@BADdі†Щ£®Іѓ©©Ђђђђђђђ©ђ©≠©ђђ©≠≠ѓѓѓѓ≠≠ђ∞ѓ∞≠ѓѓѓѓѓђђ©ђђђђђЂЂ©ІЂІЂІІ¶ҐЭУR9†єєЈіЄєєЄЄЄЄєєЇљљљљјјј√љУ^QPMMQNNNNOMNNNPQPQQPQTUUVTUVWXSQQQQTQYXTTRPQQSSVTSTTOQQSSTTQTRTQQTTSQTVVQRVTSQTVSVVTTVVVYVUVYUYUUUUVWXZ[bdЪ∆ґУУЙПСУСССУЧШШФЪЬy'P®ҐШЬЦМКН? 9r{ГСУУРУТРПСРМПУСССССПППТРУСРННЛЛРТСУРПРМЛМЛКУНЗЙЕ{М,Ю»ИЖД~|}||{z{vussrqqqqqonmmmkklnqoqnnmnnomkkjifjdfiijdgemddbdcc_Ys>pЦVZYYXXVSMRNKKKJJFFJJKJJJHFGHLMQ\TQPPLLLKKMIGKHJKMMNTMMMNNPPPRRRSOQPYV+&W`OPTRMRWWVVTOPPPRTTTTTVYZ]ba__YTPQQRRRRTRRNRRMMQOQQRQRRPNMRPPSPPRRNSX8(FKMMMNJLONMRPOJMLHKKLQPVX\\ZODLJHHKJKKIIGHHIKMKIGFGGIIGIIIJIJMNPTWXWZ[YeW">crllnvsrpuvttqjqooommmosmmsomqjjjjkkiiijjmmkooqrrplnqtouwxz}~ДЙНТЖ£ТУСБСЩИu6#F^^TXVVYZYVVTVSQNPRPRRRPQRPRQRRPQOOPOUVSSXVYWYZZZZWZ\Z^_`aklnlrnromrurqzsntjgjV<:ƒд|cTeebccb`eb_^a]^W]]ZZ]^]ZZZZZZ^Z\YZ[^^^\^\^`bcbb``eeakg^^^```^^_`^_``c`_f`cc_bbg@9P\_chfegfbgfikgikikikkjkikkikiiiipiikiikkkmkkmkjkmpmrmchichjqokkrw|~ЕЖЙКМФУЩЧЭУЮЦШШnB+[vzwpmkcjjefafOC@AB?=>@FAA>@><<=<:::7:;;;;<<:<<<<;;<;A@@=>@@>?=>><@ABB@>>>CB=<=<=>D>>>>>?><>>@>??=B>@@C?Iiѓ†У§¶¶ђІІЂЂђ©©©©®©©ђ©ђ≠ђђ≠≠≠ѓ≠≠≠≠∞ѓЃ≤∞ѓ≠ѓ≠ђђђЂђЂ©ђЃЃђђЂЂђ®І®¶©ШM DІЄЄЈґЈЄєєєєЄЄєЇљљЇљЊјЊЊЄС^TPPONNMMMMMMNNPQPQPOQQQQWXVWXUVTTTSUSUXVTSQTUSTXXTTUSSTVWUSSTQSTUUVTRTVVVVWURQSVWSWTUUUUWVVVUUVTVVUVVXZ^gdЮ»±УЛКЛНННЙПУУУСУХШw*T•©ЦЧХМЗУF2rНПСУХКУРКРРППМПММММПЛЛМНПРНЛЛЛЛЙЛЛЙЛЛММЛЙЙЙКЛПЙЗДАП/К–НЙЖДЕЗДЗИГЕВГВДИБ~Бzzywrrrrppnlmnmongnnprokjjifdffikjhgfdffdhihe^5ДЪ]^]]_^ZZXXVRRRNMQNNMMMLKJIGJLLPUQNNMKKKJJDFFGFGKJIJMJMKJMOMMNMMMQONUY)`aTTTRLRVTVXUQUQPPTVSTQXZZ]c]_^YTPNNRONNPNPMPPOMMRQOQQRPPNMRPPSRRPRRPZ8/IPMMKPNOPMJPOOKNOMMMMRTV`^^XPMJHDGJJGGHDEGHGGGCCBGFFGG>FIFFGCEFGGGMLKOMSP!:pЭДnbkjechgdlbfdcdcacb]^^_YZ[^[YZ\\]]b]^_^^^^\_`bcbbceccffc``aaaada___`bd``cbcg`bhf@B=@><@>>>?=>;;;<>@><<<==@?<<<9<>==<;;7<<<=7@?=A?@A@B@<;=<===<<<>>??>>>>=??=@@BBECMnЃ†Ь¶І®≠©©Ђ©±©©©©©©©©ѓђђђ©ђ≠≠≠ђ≠ѓђѓ≠≠≤ѓ≠≠ђѓ≠ђђђЃ≠≠ЂђђЂЂЂЂ≠©©ђ¶±ШM H±ЄЄґіґЄєЇЇєєєЇЉљљЉЉјјјЊєУZSSTSPPPPPNNOQQQYQSQSUTSTUWWUWUTVYVWXVVVSQVVSSQSSVTTUUVXYVSSSTSSTUUVWVXYVW^YWVUYWYY\UTYUUVYYVVUVWVVZUWXXZed†≈≠НЖГИЗИКККЗНКЛЙМ~'RҐЭРСРЙВУY *hУФЪЩЫЪЩЦХФТТРУУУППММЛЙМЛМУЛЙЙЗЙЗЗИЕЗИЗЗЕГЕЕЕЕЕДДАВЗ/В»СЕЕЕЖЖЖЛЛКЛММЙНПЛКНЕВБ}zyywusrrrrrrrpsrrsqkknkkiififgjjfgjjjhfgb`i5 Рµ^eb_bc\^\[\[[XUTXUUUUSRRPMKNPQRWUSUPMKKHHCGGGFGHFFGGFGFGGKIIMJKMRLKVZ%&YTQQRPPPQMTVRTQTSTTTRTTVZZ_gb`^\XTRRYTPQQPPRKPRMOQOLMLNQNNMONPQOPNPRLP;,MMMMMQPORLKLLMMPNNPPPSVY`\\YQQMLHJJKHHJGFFHKGDGA>ABCCFCGGGCFFBDFBCFGDDOOH:FLPRVVYY^cfjrqrrttsvvvurrrrqpqoorlrnntmjknmooohkmkmomqkkkkjjgkkkkqwjnstruzrC]РЛЬЙЙХЪХКД~|tspkhfca\]Y\ZZYYVRTRQPMTSRTVPRRRURUUXYWXXXXZZ^_]_\ZYZ\XZ```^c^fmmr<&'Pfolrwwuqtrjnemhceddddndohar__fX\^Z]UZZ\]ZZ\\_\__^_aaaacfa```a_a_aaaa^bbbccffikb`kp>@<=<=>5<><<>>=??><<<>@>=A?=?@=><=>@======>:@@?9>>A@>;:;;;;;<<<<<<<<>=;<<=?@>A@@CBGn∞ђЬ¶®¶©ђ©©®ђ©®©≠ђЂђЂ±≠≠≠≠≠≠ѓѓђ∞±ѓѓ≠ѓѓ≠≠≠ђ≠ђ≠ђ©≠≠≠ђЂђЂ©©Ђ®¶®©•ЃХH=≥ЈЈЄґЄєЇЇЇєєЄЄЇљљЉЉјјЊЊєТZSVTSPPPPPNNSRSUWWTSTUVXXXZYYWVWVYXYYYYWSSWYSVSQQTVVSVXYWWWWVVSTTUUTTUVVUY^VVYVYYYZZYVYYVY\YYYZZZVV^YYZZX]i°≈ЃЕ~ЕГГДЕЕЖДВДДЖЖy"MЮТЗКДБ~Кd'KВЩШЪЪЬЬЫШШФФХФУУУУУТМСППСЦУРРРНЛКМЖИКИЖДДЕДАДАВВ|~})uЊМ|ВЖКММСУТМПСУПМЛИЖЕБ}}|yzywxvxyvvvuwvvtrokmollnfigkjlkjmjggdaw/Л£h_daeaaa^a__`]]]YXdZXXXZPRUSSUSYYXYTQMLIHGIGEEGGEDFDFFCFCIIIMJKMJJIQX*`XMKKMNNNINPNPKPQPRPPRSUXY[_^\YVNQTTTVRPONOOMTTNPPSNMMMbUQOOPOOOPTPPLV5)GMKNNNNMQLLLLKJMNMNNPSPYY\ZYQMNLJJJHGGHHHGHJIFGC@CFGDDAGGIFGGCFFBCCBEDGJB>GEHJKLJFMQMWZ[^ddhmqqvsrurrprpopnqnpsnkmoorqokmsoqqowpkokkjjmkjjkqjknmnfgh>[}rr}~ВСЖВЮКЬЩИФДМЙВ~vpkebfdZYWZVVVVUVSVTSSURXWWTXZZZZYXXX]`^^[]YXZXXZYZZYPZ[Yg4$*BacbhorrqrsvvxxprphlfbpQj`]s\ambhpgfacddbZ^^^b_`]]^_a_afa____^``_ddaadfffcccfgfdfar8! BS_efiggkjjkhikkkiklkklkkghsgghgiigggkkeinllkkkklmilkkjcab`ciigimpmlkklklkjlkimkijhia( rppx}ДЙСТЮ®∞ЪrXJC>><<<<;:<;;<;;==;>=<<=??<:<>==?9<>A>>;<>@==@=>>>>A>?<>D@?><<>=9:9;:<@>::;;<@;<<@ABGs≤ЂЫ£®•¶©©ђ®©ђ©®≠≠≠≠ђЂЂ≠ђ≠ђђ≠∞Ѓ∞∞ѓѓЃѓ∞≠ѓђ≠ѓ≠ѓ≠ђ≠ѓЃЃђ©Ђ©©І¶¶¶¶ҐІФC M≥ЈґЄЄЄЄєєєєєєЈЄЉЉЉЉјЊЊјЉТZQPQQSQQONNPTVTSMVSTTTVXXXZZYXXXYWYYXXYYVVYZYYWVUWWXVVYYYYYYVYVWTVTUUTUUVUTUUQQTVVYZZY\VVZYUVYZ\\WUYY\Z]W^mҐјѓ|АДБВАА~Аo#KЩИ{Б}|z|i<$/xЖСЧЩЪЬШШЩШШШЩЧЦЦЦУУРУРТСУФУФФУФМММММКМИЖИЖЕЖИЕД|~/n±ЗВВВ~БИКПУФУСМНПСРПММКЕГ~Б~|}zzzzz}zxyxvyzvrpnqpoqnllooplnmmjjhcr-Шљhkihieeececcab__]U]ZZ[[`[[ZYYZZZ]]ZXUTRMTKDHIGFCCCECEECFFFGIIJMJGHGMU,c_MKMKMJJJKNNNLMLLNMORPQTUZ]\YSPOOPPNPPNMKMKNPPNPQTPMOMOOOOOOOMNNTQRPS2)BKMNNLPNMLJMLJIMMMJNPPRXYYVTLJLJJHJJIIHJHGGEFDDCCDGGGDDGFFFGFGGGCFFCFDDLD>CDJ@@OGFIKJMNNNMOPX]cjinvklnjplnlnumnpqorqrplmmqooqrossknkooqomkmmromorrffj@ \wihqqpwxw~ДЗДНЛФХТССУСМГАВytrijg___ZZ\\ZYXYXXWXYYY\ZZZZ]^_cdc_\YYZYXXYZZZXXRY0"'BLYZ]]`addcpmqxqx}rЕvx{u|sprhkfhhefidiikhaiefgccaa__b__ac_^_a`bb`dbaccfcecbde`aacfh4CQ_ehikikkjjjlikiklllklokjkmkjjikkikimmikooonkooqliolkgcbbbekmkimmmmihklolkkigkkkggl[)#Ybimorrmmrs{~oVJD>><;<==>=;>>>>@@=><<>?>=<8:=;>>;>;=<<99?=><<<>><<<>>>>@7;9;59@<<><=>==>@>C@<@DCAQ}≤ЮЮ£¶•ђ¶®¶•¶©®®©®©ІЂЂЂЂЂЂђђђµѓѓѓѓѓЃЃ≥ђђ≠≠ѓ≠ђђ©ђѓѓѓЃЂђЂЂ©®¶¶•§¶Х@ ZµЄЄЄґЈЄєЄЄЈЄЄЄЇЉЉЇЇЊЊЊЊЇР\QPONUTQMQOOQSTPSTSTTSUXZYYYVYYZZYWWVVYVVVYZYYYWUUUXYY[YZ\\ZYZYWVWWVUWUYVUV^VTTVVWXYYTXXUVVWYYYWWUVZZVY]`[hЯ–ђ|А}Аz{z{}|yzАk$IФytuuvrsjfL;/1QhxИРЧУЦЧЦЦШЧХЩШЧУХХУУТТХХФЦЦУЧТСФУСПСМММКИИЙЙЕАВ0!b±Й|ГДГЖНУФШШФТПРТТСРПЛЙДВГ~||~~|}}}АВВ|}|}{zywwutrrsrprrpoonpnnnkkp*†Єqmnjjijfiiefefab^__^^cccd`^^^^_b``]]ZXYUTPMNMKKKDIICHKKGIIG<><<=<>>@@>=<=?>;=;>==;;J<<<<<:<<<@@>@><>@<>;=;;/898<@;9><>@A?B@>>@>9QДЄ†ЮҐ§¶ђ®©®®©ѓђ©ђ©ЂЂЂђЂЂ≠Ђ≠ђ©ЂЂЂђЃЃђђЃЂ©ђ≠≠ђ≠©©ђ≠Ѓ≤ђЂђђЃђ®®¶§Ґ¶Х5 ZґЈґґґЈЄЈЄЄЄЇЄЈЄЉЉЄЈј¬јЊЉТ_QSQQTUWQVTTXUUU[UXVYZYYZ\ZYVZZZ\YWVVWWSWYYZZYWUTUUUYYYXZ\\ZYZWWVVWWWWYZZZZ_\XXYZYZZZZZ\ZYZY]ZYYYVYZYY\]Z^c°Љ§~xxzz{{{wvtvvu~si%=hloollkhp^PB96T]XhxВВЖМППСУФЪФЪЦФЧФЦФЦШХФЦЦФЦХХХЧЧЦФУССПТРПРКГ}Е3YІЗЕГЖЙМНТ•ЩЩЦНКЛСНСФМЖЕДАА|}|}||~}АВБГЙДГБ~|~}{xvvxusssorspqpoqmrp*!¶«ikmjkjieiiffffcfeeacccedfdbbbbdffeb_^[^YYXUVTRRRPPQNNPPKMLIEGIIEGFEASzbAAGHHEFFGJJJJIKKKJMNMNNOTXZYRMMOMNPMJOLHHJJJMMMPMJLLMNKOMMLLMLKMMNPY5&IMKKNNNOPMMTMNMNMNMPPTVVZ\\ZRLLLLHHHKLLJJDGHGHKIIFCBDBFFDIFFGCCCBFEDDC=LD-ODCCDCDDFIGEGGGJJLLLQW\ZZVTPOMOQRUVZZ[`_bbgihukqnntooqrfkkomkkkmodoomomnjht8 Hbojrjfggjpkillnpnkkrtrw{БЖДЙУБГХДЪСККПКАВ{rlf_b__ZZ^ZW\YW\_`aa^QXVXYYZYZZZXXSO2'%FVXYZZZZ^ZZZZZY_^^_cfffgjlosrurww|Лtztrrr\ahWhSVh[dd`ccckbf`]`__g_^_abdf\cdcdfdcfj;&E`jehkkkknllllollkgigmjgkkkkigigiieegijhllkkpoppqoolrrkcb^cfmikmppmkmmpqrmkoomtoqmgjW)'MphllmmkkkikoibOC<<<<;=@>=9:<<@=>;<=<<=A@>======;=>@@@@@>GA@D@<<<>==?@D@@F><<@=9:;;:7989<=<5<;=?<>A=>@@:>OГ±•Ы£§¶®©©І®ђ≠≠©©¶ЂђђЃђђЃ≠≠ЂЂЂЂЂђѓ±Ѓ≠ЃЃ∞±ѓ≠≠≠©©®ђЂђ©®©¶І®¶¶¶£†ІР. _ЇґЈґЄЄЄЈЄЄЇЇЄЄЇЇЇЇЄјјЊљЇС\UTTTUTVTTSSUTUUUXZXZY\]]^YZZZ\\]\ZZWYZYZ^\Z_\TUVYUUXZZUWYYYYWVVWVVYYYZYY[[\[ZZYZYZZZZZ^^\\Z\\ZZaZ\\ZZ\\`]h¶ƒ•Аwxzwwwzwtssrrnc_)5fbfihgfeecaYSYZ\_`cifclnnsurnyАПЦУУСФЦШЩШШЦШШШЪЩШЪЬЬШЧХЧХЦЧХФУРТЛ2N≠ЛЙККНТСФ†ШШФЛЖЕЗЕККЕГГАААБ||v{{x{~~~ВВВ~~~}}|{|{{zxxvwxuvtqrqrt*"§ƒtfoklkjjjjiiiiffffbghffdhhdbbbfgeiedbbb]^\YZ[ZZZXXZXWUUTTRQMMMMKKKMGJ+zr?GICCCBCFGF@FFBFFFHGGNMMLQVTPMKHLMNLHHJGJLMMMNNNMJKKKNNMMLLLLMLOMNLT7!$\QJMPONNOMNPMNNPKMKNNPVXZZ\WPLMLJJJGGHJHJJLKGBGIEFCCBDGGGMFCIGQGFBDDFCCLD5BCDGGDCCDCCCGGGGJGJLMRXYXTMJHGEHJMLLNRNNRTWY\a^_cflhjpvqqqooomlnnkroktolkhp6 DafklkjgjfujirlommmjjgjjlqqnpptruyАЖЗЙРХФХФССЖГzwspooccf_`defccb\[Z[ZZZYYXXXXQP3%"FVVXYY\[Z^ZZ]ZZ^]_\^__`^___^`becejlinmsvzЙsЕ~rЖЖВwpqkehec^ccba^aeegacfbccWb^^cia^\\;'KZbeikkkkllllmolkkiiemmimkknkikiipghkjsklmkrmkmmpnlqqqmgb`bflkkkkpmbrppppmmropqonkgrU)$,MlenppomkmkmwnbME?>=<;=>==;;<<=<>;9<<<===<<:=====>;=>>=@=>A>@><<==<<>>A<@B><>@A;;=<;;7;8<8:8L<;>@?BCDEFCBCGCGFFCCEDDHSI?@?=A7>@>==;;;;;;;=?=<<;;;;9;<<@7<<=;A;=;=A=;9:=;=;;:=<;@>=@@@@BEJMЬЃЫ§¶¶§¶ѓІ©ІЂЂІ©®¶®¶ЂЂЂЂЃђ≠≠Ђђ≠ЂѓЃѓЃ≠≤ђђѓђЃ≠ђђђђ≠Ђѓ≠ђ≠ђ©ђ©ђђ©І¶Л+ZЇЄЄЄєЄЄЈЄЄЄЄЄЈЄЇЇЇЇјјЉєЄЙ[TUUXXUPMPPPSTUXXXZZVYYZZ_\]^^ZYZZ\\ZYZWZZ\\Z\ZYZYYVVYYVZ\YYZ\ZZY\Y\\Z\ZZ[\\\\W][XZZZZ^ZZZ\\ZY\\\ZZZ\\^^``iЮ Ыxtttstrttsrsrpmk^%9fpcbbecceec`cceac```]ZZZRLAAWX_hlosw|АВЙМФУФЦЩЩЫШЫЬЬЬЬЭЬЫШ§Ф17ЈЦЧШЩШЩЩЩЫЩЧФФТПКИЗЗЗЖГГББГ~|z{{{y{{|~}}}zz{{{{wzzzzzxxz||xzzzwvГ{'µ“{ryxwvxvvssrprpooptnnnhjkjjkgggdfgieeeca``[a_`^`^```_``^_]ZXY[YXXYWVX!$Ж|NNNOKKMPMKMIEGEGEEGEDKJKMSXQQLIHJJJJJJGCDBDDGDDFFGFDGGHHHH@JJDLOJKIJ@'WMKFKKKJKJGMNMPMMNNPNRRYZZYROLLIJJKHHIKLJHGHDGDFBFFGBDCBBCFFGFGEBCCECCCLD9:9:;=<><:=;<;7?BA>=A=A@>>@@A?><><;===:??==;;;;;=<>>@>=>=3>;;;;@;;999:::=;;9:@=;>><=>BHLЪґЭЮ¶•¶¶Ђ©©©©ђЂЃђЂЂ≠ђђ©©ѓѓѓ∞≠≤ѓ≠ѓЃ≠ѓђ≠©ђ≠ђ≠ђђ≠©©ЂђЂђ©ђђ©©®©∞®І£Й']ЇЄЄєєЄЈЄЈЈЄЄЄЄЇЉЉЉЇјјЊЉЈЙ\VUVUVVSQTSVUWXZXXY\\\ZZZc_]^^ZY\Z\\ZYZYZZZ\\\\ZYYYZYZZVZZYVZZYZYVYZYYZYZZ[[_`\^ZZ^^_`_^]\_]^]\X\__^\^^X_glШ√Чsrrrqssrspnnlnhc`#";jkbeeecfdccbeacca_]``ZZ[UOA;hSY]_aafginrs|~ГЖКНФУХЪЩЬЭЬЬЪЧЯХ,;ѓЦХЧЪЫЮЬЬЬЮЮШШЦЦТСПММКЙИЕЕЕББ}}|~~А}}}}|zxБ{xy{|{zxz|zzzzvvx|*ђ–ГwАААБАА}Аxywuvrsroonolkjkkjjjkllkjjiecfeffeacccedcdcbcb^]\]]]^[XZZ!$ЛvWWUQQRTYTQQMJKJKHIKKKMKKQQTPMLKIJKJGHHGCCCCCDBDGFGEFFJFDHGFJJHHEGFJP5*aLGDHLLKKKJMJKMMMPPPMQSX[ZYROJJJHJJJHIMMKHHJCDCDFGFFGFCADDGGFFGCBBACDFCM<?GAFFGHFCCGJGGGFFGJMMPTY\ZSJHHGGCCDGFBCFFFCBFCCCCAFGDDGCGJHJJJKOQRV\\\abcrmo+Kinonmqrmmkjnlmkrmmokmkkkkmmhjffhhhmffjjhgkjlnkmrtwx{~}ВЗСЩПУУСЩПФРЗЕ||{vrokhXK9&KQY\`^_^Z\\\^Z\\]^]`]^\_`_^\___\Z^__^ZZZ^Z^``bdbadeiijjjmmkimkpБrzzvtwruvukkrmnhlnc+h—Ќ|R^hhffggffhjhgqgfgiikkkikidgfdiiiokhhkgkmpkppmqppqqpighhhgikpmpkmonmpmpnmooqpoqjqL#0Olqpkqsmmmmmof\PC<;9;9;;:<<=>===<<>;;<===;<=>>>>?>>=6>>=3?>A?=::?>>>@@AAA@@;@>==>=9<><9:8;;;;99=::==<>>@BIЪ≥†Э££¶ІЂ©©©®®≠ѓЂ©ђ≠ђђђ©ѓ∞ЃѓѓѓЂЂѓЃ∞ѓ≠≠ђ≠ѓ≠≠∞ѓ±≠≠ЃђЂѓ©©©¶®¶¶®¶££З%^љЄЄєєЄЄЇЄєЄєЇЄЇЉЊњЉјјЊЊЈЙ`XZXPTWSRVXUXXWXZXY\^]]\Z]]\_Z\\_^\\ZZ\ZZZ\__\\ZZYZ\Z\Z\ZZZY\\YZ\YYZYZZV\[ZZ^^Z\ZZZZ^_^Z]Z^ZZ]\]_ac__^a_bfrЮ≈Ыxlrrssrrrnnpkld__,1`ebcfb`fb_bba`a`b_^^[YZYROG">kQX[Z[Z^__aabfhjjrrx{|ЕИТЦФСУФЫЦ/;•ЯСФЧЪЮЯ†Ґ†ЯЯЬЪЪЧЧЧЦХФФТРМЛКИЖЖЖЖЕБГАВАА}}||y||yz|~~|xzyv{zyvuvx~*•ќК}ЖЙЖИИЙЙЖДЕ~~{ysttrrppoliljljnnlljlljififfieeeeeifffffghedbb`bh^]VO,ЭЕ\\\XVXXUUTTQQRQQNNPPNQPMTTQMMMKIGHHHFEDCCBCCAACEEECFCFDCGFEEEGEGFBCJ8.\HGGHKIMMKGGFKJMMNNPNPRWZYUROJIGHHJH>JKQLJLMJGDDGGHDFGDFGFGJDGIFDDDDDDFV8>GCFFGGFCDDGDDDFGGIIJQTY`ZRLIGDLGCCDFCFBCCC?ABBC@@ACB=FCEGGGFDEHGGMPJPVVVPYe/$Erellnqrqpmmmmmmsomrkmmmomkkhjffjhhjhfhhjgjgglkjjoommnlrrvzz{АГЗЕЙЛЙРНФИПИДНБ~e+!*NV`]]_\\]\^``^_\]^a`^_^^_\\___a_\Z]^\^^^^^_`bbedddeddggggfeddcgjjmmmqwsu{zyЕy|БrАum+Oњ≈rYbffdgohgigmkdgegfgikkifijhiefkkkrmiomkmommoolpmpqpmkhhhegfikpmmmpmkmmkppmpqppmrq<'"5Qgoomqqppqoqoi\PHA><<=>==<@???<<<<@;<;;=><><<<=4A>:2>>>=>@@>@=>=@A??>=E@@AFЬ±ЩЭ••£•©©¶¶®¶®©©ІЂђ©©©©ѓђЃЂ≠≠ЂЂ±Ѓѓ≠≠ѓЂђЃ≠≠ѓђ≠©ђЃЃђѓђ≠Ђ©®®®®¶¶•Л"eЇЈЄєєєЄєєєЄЄєєєЇЇЇЄЅ√ЅјЄМbZYWVRSWYYYWX[\\Z[Z^\\_ZZ^\Yh^Y`^^]\\\\\\\\_]Z\^^Z\]]^]_\^^\^^\\\\\^Z\Z\^g\\^\ZZZ\^^^^ZZ^ZZZYZ[\\]^\\\_`bfsЮƒЮzvrorrrpmnonlkf_c//[ddfg\fgbbeecc`_aa^_^^ZYSOM"FaVZZZZ[[Z[Z[Z]]^]^bed^jrswy}ДИЩ}98°ЫССТЦШЫЭ°†Ґ§††ЯЫЭЬЫЫЪШЪШЧХТУТПРМЛЗЙЖЖБДВx~ВА|~~|}||}xvw|zzwytsy*†—ЕДЛПМСМЛПЗЕЙДАВ}{z{yyxwvsmqoqpqoooooolihhehhfiiigidfgggjgiifbccdc^_\≥Тde`]^]]YZZYZ[ZXXYVUXTXXYXYXSQNQMKJJIDCCCDCCBB@@CAAACCCBBBCACCCCECBDI5/cKFFGKHKKIGKJJKMMNNNMNSVXZXQMLJIHHJDFKJNHGJJHGBCCFCFCCADFDDFEFFGF>GGGCCM;BHGFGGGGEFGGGC<>>@@<<<A>=>=>>>>>>>@<<<@=<;<;9:;=>;=====?>?>>>>=>>CBBDH£≥Ю£¶©§І©Ђ©®®¶¶І©©©Ђ©ђ©ђ≠ђЂ©ЂЂЂ©±ђЃђІ∞Ѓ≠ѓ≠≠≠≠©©ђ≠ѓЃђЃѓђђђ®©®•І£ЙrЄЄЄєЇЅЇЄЄЄґЄЇєєЇЇЇЄјЊљЊєТf]ZYYWWZY\]YY\^\\Z\^\]_\]]^_e`bb\^]ZZ\\ZY\Z\]\\^\Y\\Z\\___^\^_]]^YZ__b_`bf_^_\Y\_^``_ZZZ^^ZZ[\\^\^\ZZZ^^agqЩЊЬtrojmoqnnqjllkfgg,2]eceeefefiiffecacccgeb``Z[X Om^Z]]]][YZZZ[ZXYYY]^]XZb^^Ybijke43ЮАЕЕЗЛРФХЩЭЯ†Я††Я†ЯЯЯ†ЭЮЭЭ†ЬЬЫШЧХХФТТПЛФЕЗЙЕЖЖВДВДВБ}|~}{zzzyzw{vrl, •ѕzЕПССУПЛЛЕГВБ~АВА}}В~}~~|zywtwwtuuuttrrrljjjioiiiiijjjjggijfeiidb^_Y!%ЄЪ`ea`a_a`_[^^`]ZYZ]]][[[[\^^[ZUXVRRQPJIIIJIDDDCABA??AAA???=ACACACBB@N3/^KDDCFCFCBFJJGJMKMMJJNOTVXWTOLLKDJKKMKJOJHHGAFDBBCDCE@@CCCEFCBBDBBBFCBBAAAA?@@B@CCCFGCS'%CGIJLOTUU\``ccfjjlpppyrporooknkjukhjjlnkmkjjjhgfgkjggjkgjgggfiiijjprpppspwy}ЕЛe/.fУЮЪУ†ППСМДБzxrrolkgkicca_cc^\^^\\][Z\Z\XZZ^_^_^_daacffkifed_dcdbcbffcfggjkigmmqnpY/%Y[girkznr|mpnhpjjljlijelkikjgghehigglichjqjllmmmooqqqqqmieeimqooopppqprrqqkppqqwqmmr05/>>=9>>@<9;<>>A==>>@<<;>=>A>>?A?<=<<=;:===;>B>====@<=<<<;<:<9<<@5;:;<<<>AC@@>ICCAAAB>B3.g@ICFGGKMIKLRVUPP[\adgklnnpoompnqqlkmkmqmommkkkhhjmlkkkqgjfgjffffghhjjjiifklng_S.,]Д~ДЖРРПХШПМТЛРЙ|ДВyuujhheeheb^`\aa___]^^]]_ace^_cfcfegikhda_adda`bbccggggggffgkiiQ5#H^`ijkrry{{z|В|zzu{ypsfpnijjchnjiqkiujfjbkgijijkjjmppqpkfbegnooloppprqquqppppoqqokpv55+?YompqrrrqloppxhCC<<<<@@>@?><<<<<;:><;;;<>A9====:::;=>A><=??<=?=>>=9=9;=@====>AA@?>>;:@=<=<;9==;;::A>@>>?C>і≤УЭ§І¶¶©ІІ©®ѓЂЂЂЂЂЂЂЂЂЂђђ®ђ©ѓѓѓѓѓѓЃђѓ±≠ѓ∞ѓѓ≠≠ђђђђђЃЂђ≠ђђђ©≠•°§ АЈЄЄЄЈЈЄєЄЄЄЄЇЇЉЉЉЉЇЊЊљљЈСcZZZ\ZYZY[[Z\\]]]^aaaaaa_]aa__cab`cbb```^]aaaa`_]_[\[\\\__^^_]\]]__^^_```^]\]_]]]_]_^_]``^]^adabb`dd_a``_glЪљ°hrqqqrqqnnnlomfai*3Zeeffffiieififccccc^aacb]\XACACCACFBBBCBBCBCCADDFAABF*%=GCFFFEIFGJKMMJKMPUVZ^`bba___aienffrkkxnommoomkilnjljjmgkjjjghggmqkjgffijjjjfkN,!.Kldjqttx~ВАВНЙУСЛЮЭЩЛМЙАyywrqjkdhggeebac``_beeaafgcffgkkjhddeeeccecefgffccfefgfc^L7$Ia[cffjlqnrtsvtx{xАВ}Гxutjmebfj_qnh{mnunpnpmmjijllooqnjecafjjmkkmqpqqprloprqqrolkst84/BWjkmrrrorrqppseBHA><@@=<<<=??><:;;;;==;;;:;9:;;>><<<<==??=>>>2;9;>??===?AA@>==<;>===<=:==;=<>>@CBCЄЃЩ†•Ђ¶®©І¶¶£ІІІІЂ§ЂЂЂЂђђђђ©©ђ≠ѓѓѓ≠ЃЃЃѓђђ≠≠ѓђ≠≠©ђђЂЃђ≠ђ≠≠Ђ≠≠¶¶¶u%ЛґЄЄЈґЈєєЈЄЄЄєЉЇЄЇЇЄјјЊЊЄХfV\\\ZZZYZZZ\\`^[^`a`_bca]ab_ac__^_``````_aaaa``^_`b```_aa_aa___aaaa^`__``_]_a___^aa_ca`b`^^cdab`^bc`dgddloЩ«Ьbrwrnomnlnnhmjgck,#9^lhkiikkjfifkifgggeeeecc^^Y$ @@>>?>><<;:;:=>>=>=A<;=>@>><<<==?=<>>>;=;==?@@=>>>@=;;<<;=;:=;=<=5;=<<@>@@@AEO≥ђЩ†•©ІІ®©ІІ®Ђ≠ЂЂѓ≠≠ѓ∞ЂЂ≠≠ђђ©©ђђђ©ђђђђђђђЃђђђђ≠ђ≠≠Ѓѓ≠ђ©ђЂЂЂЂ¶ђЮo.СЈЄЄЈЈґЈЄЈЄЄЄЄЄЄЇЉљЇљЊљЊЇЧh\^[ZY\\]aa^____^_bfccca_accibb`_^^\^^```aaa__^``^``^ba^__aaa\^_aaccaaa_``cccccaa_a_cecdcb\_addcb`p`[eeadirЬƒЭ[rronkiklnlnnkgc_4;aefiijjikiiklkkijkhgigefc`\* Bwfbcba_c_a____`c`a``^_aa___^`_\`+%CWZ^adfkrsxvy|{{~|~ДДДЖИКПРУЦЧШЪЬЫЬЬЫЩШЩЧЫЬЭЬЭЬЫ†ШШЪЬЩЪШХЦЦЦУТТРРИЛЗ% _¬ЪЪЭЩУМЗББ}}|АА~~~~~~|}~~}}}z||vvyvx{z{}АА||yy{|y|ytxwuywutspqqoqhipZ 3јШZdikjhifjgfdeeiiccffeeggggiiieeccdbb^b`^[^[ZZZ`ZZWWUUSURNMMMMKLKLGC>,?BCC?@?>>A=@AACACCCB?B*'9CCCCEDFBCDDGGGJLMMOVXZYSPOLHK>JJORUVXY]\_fefkghnnhhhhkjkoijknllmkjkjjljjjghcbK/%-Hi`efgdgijjellljiitpr{{~~БДНХПЕЖЛУЛАЛВ{xwutrpihbcjhjjkhljkihhehehhccggggiggidcgf_gM7!,Gfcfllklomklooolpsilpqqrrrtsty{{|||{{В|x{}yworqprpnpvsrmklhdjjijgjjjlllloklmqpqqqlmo?/,DZikmnpqqqrqqrp^C?<<<;;<;;=;;<;;;;=;==><<<<<==C>>@;:<>>>>=@>;;9:::;::;:;<:5;=;8=;<>@=KR≠¶Ш†§¶ІІ®®ІІђЂ≠ЂЂ≠Ђ≠ѓѓЂЂЂ≠≠≠ђђ≠©©≠≠Ѓ±ЃЃЃЃѓЃ≤≠ђђђ≠∞ѓ≠ѓ≠≠©©ЂЂЂ¶®Ьj-ЦЄЄЄЄЈЈєєЄґЄґЄґЈЄЇЄЄЊљљљЇФe\^\\ZZU\_^^^aabbfcgfageeccegcbcdbb__bb`bc_a]^^^`b^^^b__^__a_^^^__cac__]a_cbd_]`a_a_cecabb_bbccfffib_ghcjorЮ≈Ь`wkkpnlmnqqqnkga^.@@C>>A<B=>@GGDDBCAA@AAABDBB)/H>DCABDBGDGHFGFGJJMMMRVVXUPKJGFHFFDG@GGDGHDBCCCDAACGABBCCFBCCBAB>>CCADDDFBBK)&ALACBACCCGDCCADHJJLOVYbWQMLHDGGGGIGIGHMMOOPTSUWZ``[]_`kegnhinnlmkkjlljljljhkddO(#.KicffggjhjkfjiijillfljepjrqsttswzДД~ПСЙЗНФУЙЕЗЙЕИВ||yxrromollhieahdehhihiiigf`gfa^L3$(Jibgmllmmlkkoqqpqsopppppomrrrtspvustx{zy{АА{xvГzuvkg[OmP`ddmmjhjmjjmmmkjfiijjmonjlrE8*FYgpprrrttrrrqnfFC=><;;=;@>;;<=<<<<<6><<><<<==><<==;@===><<@?==@====<=::;:=;=>>;;;:9;::=@:HSЃ¶С§¶•©¶••£¶®®ЂЂЂЂЂЂЂЂЂЂЂђђ≠ђ©ђ©®©ђЃ±ЃѓЃѓѓЃ±ђђ≠≠≠≤≠ђ≠≠ѓђђЃ≠∞®®£Z,ЯєЄЄЄЈЈєЄЄЄЄЄЄЈЈЄЇєєЊљЉљЄЦaY\Z\Z\Y\\^^___aaceceaceecaceecfcc`ccfbb`a_c_aaaeebb]_aacaaccc`aaaa_aaaa`]b`f`^`c_aaaea_aa_`b`bcbebfegjfkmk°≈Чfxooprprrpqqqohch/=anjjkilnnpnlilijkkkhikgige[. Kxfcecfeacaaceccceceeaa_^[``abb^a'"CP[cdiir|xz|||zz|~АА}~~АААВ~z~ЗЗЗИЙЙЗЗМНУФФЧЪХУЦЧЦЧХШШЪЬЪШЪШШШЮТ) ]Њ¶£ҐЯЭЩФРЛЛКЙКЙЙЖЖМВВББВ~}~|||yzzxxxzzxxxz{{|x{|{{||}}АВ}||z}{|{zws|d*ЌЬtw~yxvromkmkkjhjgjiihgeegefkkfiiifc^caceecaccc`b`^^\^\^^Z[ZYWXYYURTM*@ЛYPOMJMMKDGGGDEEGIFCCCGLMPNKIGHFBB<=?><><=9==>>>><>B>>CFFG03JDGDDBCCCGGGDFDBH."BABKBAGDGHGGCCGKKGKPVY\ROJHHDGCCDHDF>=<<<>=;;<==?<<<==:=@@@;<><<@<<=<<<><<;<:;==<=?=@>@>=<=>;:::::======;;:;;;;@=DcЂ£Ю•ІІЃ¶¶¶•¶ІІѓЂІЂЂЂЂЂІ¶©©®©©•ђ©ђ©ђЃѓЃЃЃЃѓђђђђ≠≠≠ѓђђ≠≠ѓђђђ©≠®ЂШN/¶ЄЄЄЈЈЈЈЄЄЄЄЄЄЄЄЇЉЉљјЊљЊЇЦc[]^^__^^^a^_^\aaefcacceeffefffeebabbcac`a_a_aa_bbbb__a_eccfca``bafcfeeffgfgjcbdffgfacccaaa_cbba_accedgdhih°√Уhromnpnnnmonqojad5!>fpjkmmpnrrnnnljlllnnlnijkn]. OsfeccficcccecccbdbceecaaW_``^\dj%!CV_`bhmqw{{~}ВЕВВАВВВДВ}~БД}ГБ|~z}ВЗИЛПНПРРСПТФУЧЧЧХЧХЧХЫЦ% ZЄ≠°Ґ°†ЬШФЦФУСПТПНМТЛЙЙЙЗЖЕЕГБА~В}||xz||zxzyzywzzy{{|~А~}{{{z||}{{wuГ`(∆°КЗМЖД~zvtrrqqrppnpnljliikcfkllnjiiefecceeccfefff``bbdb```a^`ZZ]]\XXO*I{ZVURQPPPMNPLKKKDKKJIDLNQQPLJIIHCCAAE><><<<9<<<=>>::><<<<<=<=>9ABCCG52LFDDAABAFCDDFGGGGJKLNTXYXQQMMHGGCCJCDDGGGDDAC@CC@CCB@A>BCCFCC>BBBADHJCGBDDCH/""@BCGFGGGDHJHHJJGJFMRVZ\UQJJJGGCCDDBEBDDDGDGDCCBFGDFDFGJJK>RPXXT^_\`aabchfmklfaR0!4Qkdkljkmkkkhholjgijffefjfflgceddfceijjlnnntuxw|ВЗСЮЮЯЫХЬЩУЮНФМГЖБv{zsrqsooomkjmkkkI,"9Meeilomlloollklmgooopooqolqorqqqokmllpnorrrplrsssw|}ААДВ{}}А~|ВxyvitrnpommmfmmlАjeo]@*$M_iqrrutttrrqpncN>;<>==<9><><;==><;<>=;;>@@>?A<=A<<><<>>>:;9:;9<===@?<>;;9=::=:99;8::==;;;;;;;;;<@>Me≥¶Ц§¶ІІ¶©¶¶®ЂЂ∞ЂЂЂЂ≠∞≠Ђђђ®©©ђ®ђђђ≠≠≠ѓђ≠ђ©ђ®©©®©ђѓѓђ©≠≠ѓђђ©©©®ЂНI3≠ґЄЄЈґЈЄЈЄЄєєЄЄєєЇЉЇЊЊљњЇФc]a_a]^_a\_^``_cgehmcccfefffjffhgf`b`fa^cccacaaabcbbaac_faccff_b`ajcdefhfh`chbbgfgihhffccccefceceffcecfehhg¶ЉФjppnlnlnllkjlngac7Odmnpkjlnqnnnlljlklnnnnlkkn`. Mukieeifafecgecdeecdcfeaa__^^]Z\a(9Q^bchmquy|~ББББЕЕЕГВГГДДДВВВДДБ~А~ДД|zwrw~~БГЖЙЗЗККМЛТТТФУФХХФЪЧ!NЃ§Я°ЮЯЩШЧШЦХЧУФУЦХШТТМЛЛЛККЙЙЖДЖЕВВА}~В|{||{||{|||~~Б|~|~Б}}|||{xxГ_+∆≠УХСЛЖГ|z}wvtwwzwuwsqponkljjjoooojiiiefeeigfgggjjddddfbdbdbbc_`e`_]\S,UФ^ZZZZXXUTUTQQQQNNKNOMNRUTQMKJIGDDCCEAA@B@B@==?=?===><=<<<<<<><:=>===BAA20UDDD>?BABAABDGGGGGFJKQWZYTNJMJHGGCGGFFFFCECDH@?=?=<=<=<<<<<;:>@>==>=>@??=>>9<;=;=<<>>@@<>==<@;:==?>C?===;==;:::9:;:::9:;;:;::;;<=@9Mc≥ҐШ§І•Ґ¶®¶¶®®ІЂЂ©ЂђђЂ≠ђђ≠©©ђђђђђ¶≠≠ѓ∞ѓ≠ђђ≠ђђ©ђђѓ≠≠ђђѓђ≠≠©©©¶•ІФI;∞ЄґЈЈЈЈЄЈЈЄєЄЄЄєЇЉєєјјњƒЅФc\a_`___^\\^_ca\fggmbcceefffgefgigcbegc\fececfffgf^cafcafcccgcccebfdceefgg_ccccibdkffffbeecceaeffmccfefffre≠∆Шoprnloooqslmorjbf2mЬrtrlkjjmlnliijkknnnjnnkjqb, J}kjhiikffffieeeeccc`aeffecbdcccg/*[_cfhmqs||~БЕЕВЕЕВЕДВДДЕВВВДЕЕВВДЕБ|wsrs{{}БАДГБГИВНИЛММУФУХЪМ"?ђҐЫЭЯЭЪШЧЧХХЧЧЧЧШЪЩШШЦУСУРРПППЛМЛИЖИЕДД~АА~|~~~|{||~~|~~ГГБ~~Б~~{|Т_/¬ЂЛТПЙГВ}||{xz|~~{y}yuvsrrrrrlssqqqmkjij`figfffijjgfhfffffgeceefhba^[T._®g]_aa[ZZZXYXXVXUTRQTRTVZ[TSQMNKJFCCGACFCABCBBA?AA?A<@,2cJDC>@BABA@@BDGGDBHIINQXWOJHHDDCCCCFFFCCCCBCCDBBCDCBABCCCCIFFGGCBCGDDDGEGGHB. *@>?=??=<<<>><>=;>=>>><>=<=>==>9<;>>@;<=:;;><=?D>>>>><==>;;=;:99;;;:89<:;:6>@7<@@:MoґЭЧ¶ІІ••¶§§¶¶ІЂІІЂЂ©©ђђ≠ђ©®≠©©©≠©ѓ≠≠∞ѓѓђђ≠ђ≠ѓ≠ѓ≠ђ≠≠≠ѓ≠≠ѓ≠≠ђ≠®Ђ†HJ≤ЄЄЈЈЄЄЄЈЈЄЄЄєєєЇЉЇЇЊјЊЊєТa_b_aaac_^^\ccccjcjkiiffhiegefffabbbecfdaeffbcfffgagfgffffffgcacdehfggfggfbdcccigffffeebffdcgafefg_acegg\la≤ЅЪornljllnoonoookfk7љƒКУvrlppsoomlllllrniknnlknb. Gydhhjiiiiffeeeecceeacefececeee`k,._dfinrsy~АББАВБГЕЕЕЕЕЖЖДДЕЕЖЖЖДЕЕЕДЕБББtuutsyzБА~~А{~~БДДЕВДЖЖЙЕМА%>•ЯХЪЫЧШЧЧЦХХХЧЧШШШЪШШЩЧФЩЦЦЦЦФХФРПММЛКИЕЖДДДДЕЕДБ~~|~~ББББГГБББ~|ЩX.ЅЂПНЕЕГА~~БББ~}Нx{yyuvvyyyvwvzxqqnohjkiiijkljigfggegfffeeefdca^_R/tЈmZb`d____]^]ZZ[[[YZZ^]^`^\YXYTQNMKBMIEIGEDDCCA=A?A?@??=<<<<><>=><<<<<@BCBBACCDGCAQFFNPWWOJGGCCCBDBBCCBBCBB@CB?>?@?@BCCBBCCCBDDDACDGDDGGGDKC2*C;FQCCCGEJHJGGHHJMMPSWURKJGCCCDEFFGGACACDGGDDCCCDABBABB=?FDFFFFDBADEFBJJKKJOJH@/&3DOSX\adgikkkirlmollijjijj`jffhfbefjggfd^jjnjjlfffiiekkelllpllnsvv{ВЛСРСХСХЬФ†УЦ†ЙZ+9b|yzuryzvqstrsqssrqrrvrorsrrrqrqqqooooloqrsurrrrqsrtswrnkkmmprryrruqwsuxwwy{{ААБ|Дo2%.Бnrssstqorrrvtt]MA<;=<>??<>>??=>>=:;<>C>>@>==>???@B;<::<=;;;:<=?B==<=>;;9:::;;::<<==;7<<;;;:==:=?C SіЄЈЄЈґЈЈЈЈЈЄЄЄЄєЉЉЇЄЊјЊЊЄСb]aaaacccaa_caffkimmmmikmiljffggcccebfeabcdeeccccfcffcgf_efefgafghhhljihgcefggghhfbfgiffjfheghffhggffhhghppЃ¬Чprolmlljllkmnmjrh5¶ѓ≤Яrf[bhhjleeqnonrnorqropx\3C~jijkkjiiefeceecdiieffccacceed\k%/Ybfclvuy~АВАВВЖЕГЗЗЗЖИЖЕЖИКЕЕЕЙЕЖЕЕГГВ|zusv{~АВ~АДАВВВ}}}Вzyr$<°ФЛСРТРРТТТТУУХФХШШЧШШЧХЪЧЧЪШЧЧШХФЦФТТРНРЛНККМИЕЕЕГБДДДВЕ~ББ~ББ}БВШX(љ®ЙКЕБГАААБ~ГБ~|}}Б~}~}~~А}|yyvuuqqqonnolllgggiifebfgheacbca^`W#Ж¬oQeaa_adaaa`^_^^`^aabbceed_]^ZYYUTUUQNPIMJIIIIHC>?A=====<======ACCDCCDCDJFHQQSUQJGGDCABBCGFBABDBBABA>=<<@?BBCBBGAAABBB@@BCCBDFCDH>.-C>CCBCFHGHGKJOJHHMPTXZYVOOF@LGGFDDHFCAACDGDCCCCBFBBC??A=BFBADD@@@@BFFCHDJJHJHCCIMPTUXZ^__^ihjnnqhjtkmmjmkhkhjfdfffhfficjififikgfffigiffjjijijijjnqrruw~ЖКМРТЫІЩ^*%9zЯРФННМЙИДДДzzzyyyvssuvutoroqoqqqlqrqqlorvssssrrrsutrpnikpppqrrrrrrrrsvxvxxxzxxwБh5',OrprutrqqtrssqsZL@>:<===?<<>>=BBBC>>=@<<>:===;<<;=??@=>@AB;;:58:;>=<:;=?<6;:::;;@@@>@AAM|¶ЪЪ¶•••¶ЂІІЂЂІЂ®©ђђЃѓђ©Ђђђђ≠ђ≠∞ѓђѓ≠ђ≠≠≠ђђђ©ђ≠ђђђђ≠ђђ≠ђђ≠≠ђђ©§Ѓ†5 [ґЄЈґґґґЄЄЄЄґЄЄЄєЇЉЇЇљјЇЇЄНa]aaacccccaafffgfimmmmkmmmmmiggffgggfgfegfdfgdafgiggfgifceeceecffiihhhgggfffffdfefhfiiiiijhhhhhkkiifgghkmsy¶ЉУqrpmnnlllkjkjkgie/jЬЬМ{rrlhginbgfgfimlnoqykngY;( Cwpkllmiihiiiffdffffefeefeccceb^g(3W`edmvvy~А~ГЖЕГГЕЖЗЗЙИЖИЖКЕЕЕКЙЛЙЖЙЖГБ~yuyz}ВДВДЗБГЖДВДВВВДВДВzГv!;ЗГАГЕЗИЖЛЛМЛННРТТФФФСХУТХФХЧШЪЧШЧХЧЧШШШЧЦУУССТСННННЛЛМЛЙЙЕДГГГЕГГИИЗЩX!љ®ДЗЕГББА}ГБГА~~z|~||}|{}~А~|~ДБААz}~||wuxuutsrrrnlknnlihikhhbbcdde_Y*Ъ lZcaaaaeeecbaabbbaceefeggg`]_^^^]YZWWWURSRPPPMOIGCFCCBCBAC@@B@BAA?@=9<>><>>>@@A?AA>CGGJMPRSNJIFGDCBACFCACBCCCCCA??<@ABBBCAAC@@ABAB>?BBBDFCBCN@"+C>BCBDDGEDHJHHHGGJNTYZ\SNMHFGGFDDGKIFCBCGGFGFDGDEECDBAB=DMHDCC>>AAFFCCCDGHHHGA9(%,ABCFJKJJNSSQQX\^chhffjhkknoonnmokkggmkkkljrjijiikigdefdiifiiefecceffhcbh`konnnrwysZ%%B~ЭПІЮЬҐЪЪШЦФФУПЛИЖИ|В~|~xxytssrmsrrrrssroprvuururrssuuuqkggjmmqqprrrrssuruttvvvutrw`2%(Opqrvsvtr~usur|ZODBA=>=<:7==<::;=@B>>@>A??A<<<<<<>:==::;<<>?=@<@@C@::;7;::;<<<<<@=9:::5:<;@<<>A:M{єЩЪҐ••§І¶ІІ®®ЂЂЂЂ≠Ѓ≠≠ђђ≠≠≠ђ≠≠ђ≠≠¶≠ђ©≠ђ≠ђђђђ≠ѓ≠≠≠≠ѓ≠Ѓ∞ѓѓђ≠ђ≠©•ЃЭ5 hєЄЈґґЈЈєєєєєєЄґЈєєєЇј≈ЅјєЛc``a`cccacccgffcffmmmmkmkmmokfikihhhhihhiiffjffkgkkkhihffffceecciihhgggbggcfccfgcefeeeggiiigifhhffgeijkmjr}Ґ¬Уrrppqplomomllljhl5Hs~ВЕКМБ~Еz~xi^ZYhZdecpbecZM<-Cneehjjiifihghgehifiiffffffhedbbj*$9V_hkpsx}|~~ВДЕЖЕГЕЖЖЖЖЖЖИЕДЖЕЕЖЙЖЙЙЕЖЕЕА|wuyz}ВДДДДГГЕЕГЕЖЕЕЖДДДАЙ|2}Б|ЖЕГЕЗЕЗЗЛММПМНМПММУУУТУХУТФФЧХЧЧХЧШШЦЧЧЧУТФФТУТТЦРННЛЛЛИКИИКМПҐXЈ£ЖЗЕДБЖГАЕГДВВБГ||А|||||}||~}{}}||w|}||{|xwxxwwyussssrrpnojjligijgg][&#І–o_jgifgcccfefeffeccffgdfefbbch`c_]^\ZZZ]YXVUSQPMMKKKKHHECDDCCEECCBCB=CP%IbG<@>>>@@AB>?AA@BDDCA@ABBCABAAB?BFGFBGN?!.=>EHCDDFCDHJGFGGFGJRWZZQKJGDCCCDDFGGCCGCCFFJFFFFGCBCCFCBCKGDCCABDFMJ>DDGHHGGG@9&!*CABDDDGGHMNKLPRWXZZXZZ[]Zacdfhkqonrjppopnnollnkkljkjiigijijjijfemfiifcaefeefcikff]R'%C]wzГЗКСШ†ХҐЫҐ¶ЪђЧЦ°ЧФТЗЙГ~В}y{xxwuvvvvuussswwwwyuuwvuqvskiilnpqpqsssrsrtrrsurstttqua/'Lrkpqrvvuwurr{q^CC?>=<=>>@>;;;;==:<>====;;;<<>>>?>><<:;;=><8><;<<><>@@@3>?A@5:9:;::;;<:<8@C;;;;5:;;==AAD>><>@BBA?A?AAACAADCDCCG<%"4>ABECDDHGGGHGGJIIIMQSYXPKHGDCCCCBCFCACFCBDDDFDBEFCBACBABCGCCBCB@FGGHCDDGGHHGIB?'%*HFBFH@JOJNPMMNPTVVWNOOKRPQRRVY[^_`ifloornlkknnnppmkkjjgijgikjjigjefieiiijghkgipifWJ,+5W\koknrv~АДЖИНХЩЭ°£§ҐЯ£°ЭЪХСПКЗЕЕАy}|zyxvxuwwyzyyzwwwu|xrlnoqqrqssuvrrturrsurstvtqx[,%JljooquwtussuvpZH;>=?<:B?@=<;<=;<;;>><@>>><>>=;><<>><<@><>@;>;;<;<;>>>>9>@=BBDB?BAA@BBCC@G>AAABBABF=ABCDD?C'%,EFBFGDHLMOMOKMRVXWVQNKMMJLLLMOPQRRPV][`ccddcjnpnnnkjikjjliikljhhiieifiiikggjiijcbUM'*7RZghjikjrttttx{wВДЖМПРЬЯЬ†Я§£ЮЩЧЦТСМИЕ}Г~~zyy}|zzzmy{||wlqqrqrrqssyvuuywttwwsswyvu~X/!LrprstvwttsssqpRGB?===:A>><7;;<;=;=>@<<;<<>>@><>;<<>@;>>;;=@@;<<><<>=A@>>AA@;==;;;:;;:::88767979:;<<=@?C:DЬ±ЧЩ°©¶¶І¶¶І©ѓЂІЂЂЂ≠ђђ©©©©ђѓѓђђђ©©ђђЂЂЂЂ≠≠ђ≠≠±ЂЂЂЂђ≠Ђђђђ≠ђ≠≠©ЂЃЩ!`ЇЄЄЈґґЈєЇєљљєєЈЄєєєЇЇЉЉЉЄФkadccacf_figihkloqvqoomoookkompokmnljhllollnmkkmpmiikkggifhfkmmkkjmmkkjhhhhjkmmmkkkkkkkmmmmmpmkkkkmiljklqsxЫЊ†vupppnnlpptllmkor-:_lmorsrrrrwxwuqvw{БВВЖМКАХЛЛР|Вpviec]ZgYlfegfghghhhffhecdgfjegai3*Vpehmsx|ВВДДДДЖЙЛЛЛГЖЛМЙМММКМКЛЛММКЙЗЙЗБ~|{|АДЕЗЕЕЗЗИЛКЙЗЛЙКЕЕЕЕАШy!,zИВВДЕВЕЕВВ}zБВГАБАВЕЕЗБЗЕАДЗИКЛММФСУТФТСУФФХХФХХЧШЧШЦЦЦШЦ†£WЫђТТЛРТЛКНИИЖЖЕГБГГАВБВАА~БЕАА~~ВАА~ААДЕАГ~|~}~~|}}|}{zxg"µ÷wuwvpoljjlikjjjlljijjkkjjmejjjjfdbhdcciffgdcdfdhded`_^]^]]YYXXUTRPQPLKY"IrRNIJKGECCCEBCABCCFFIMPPLJDDDC@@=>@@B>B>?A?AA@AB>>C<><>>@>>@@BB@AABABDBCBBCCFFDGHFHGA9'!-BHCFHFFGKLMJLMRVVXVQNJNJCLLKMMIJKJKLLMPPQTVGXXZ^abdffkffhikrljhgjlekijihkghkijiebRK!'?=>====9B=;<=;==>;;8:;>=>=;;<<<=B:;><;=>>;;=>=>@>BA@@@A==>@@@=:;<:88::6969:==:>>0H°±РС†¶•£•£•¶ІѓЂЂІЂ≠≠Ђ≠©©ђ©ђѓѓ≠ђђ©©ђђЂЂЂ≠ѓѓЂ≠ђѓ≠≠ѓѓ≠ѓѓѓѓ≠ѓѓ≠≠ђ•©Р("lєЄЄЄЄЈєєєЄЄЄЄЄЈЄЉЉєєљјјљЇЦpaffceeecgifiikppptooppomokkmcommopolkmkjkimmommkkkkikpkkmkommmkhnpkikljhigiimmpmjklilkkkmkkmnjlkmnhljkkqrwЩј§rtnnrpppnptpoonrt5<_uoprrttrtvvvronruuuxw||yztgrtwХГ®•ЭУСКАzvlfd][]l`gifeffefeehgebg4*figjnsyАЗЕЗИЕЖЙЛЛЛКНЙЛЛИИИМККМЛЛЛЛЗЗИИЕД~|{|~ВЗЕЕЕЗИИЙЛЙКИЖЙЙЙЙЙЙТБ0wМДГЖЗЕЙЗЗЖЕЕДВЕГВВДА~ВВ~~~А}||yrqvyxБГДМЙЛМРРНРТТСССФФХШХЧХШЧШЧ†•WФ≠ХХХХШФСУСССПЛЛНИЖДЕЕЕГДГБГББББДВДДА~БАДВВВДАВДДВДАБ|}}|ААЙlґ’ЖЖЕ|xtrrrqqqkjppmnlmmmhkmjjjjghedhddffggfbdfffffecefeeh_`_^][ZZYWXUSV_%XwVSQPVLLKIKJFIGGFFHKLPSPMKGFDCA?>=>@?<@>>>>>>=A<:<<;<<<<><<@?<>>KH"3KCFDBBFFFGECGIGMJIMQVVQOLGJGDGGJGCFDACAACFGFCGEEJKDFBBABDGECCCFFGDGECDDBHHEGE@<#"/BEEGIBIIFIMJMNRXVYVTPMJJ?HJJJMGFFGIIHFJIMLMMNMMMNPTYYZY\^bfoilnikknrlkqjjkknlljgbUJ$?9AA=>=@=@=;<=>@<>@@>>>=>=???>>>=9::<;2:79;<;:;=:<>AA?>;F£ЂУЫ£••¶®¶¶Ђ®ІЂЂЂЂЂЂЂђ®©©®©≠ђ≠©©ђ©©©ЂЂЂЂѓ≠≠∞ѓ≠ѓ≠ѓѓ≠ѓѓѓѓ≠ѓ≠ђђЂ•ЂМ"pљєЄЄЈґєЇєЄЄЄЄЄєЇЉєєЇљјљљєЧofigcifgikihkpppqpqppqppqpjkmfmoolololkkhikkmmomkkmmkpmkmpooommkkmmkmmmkknkomqqqpppkkkonmkmgknlnjjnhmikkqquЩЉЯlrknplpninorqolop=<`rtorrtttuwstrsrrrtttswxsldY#"$$zЕМЛСХШМ§ПЬНМЕ|tumkfYX]^^hcbbdc\]7@>@>?>>>><=;::89::;:<9<>85;=3?AB>>CBC>KH(6N?CBBCCFFGEGGGGMMNQSWVSPLJJHDDGIFDFDACC@BFFGGFCFFGBG????DGGDCBCDDDDFDDFCDGEECC@ #2?ECFIAIJAJNJKQTVXZYVPMKKIIJHGIGCCCBFFFIIJGIGIIJJIGGJLLMPPTVVZ^a_`bfgjkllnqonrpnjo_J%%4]]afffffffghdfccfea`abbbcccceceiooptv{ВДЙМТСШЭ†Ґ†£Ю°Ы†ЫЩЪСМЕ|Б}|yw||z|zy}|yw{yywvЛH!*Lzyvtwwwuwvwv|tFE?<===A@>>;;=A==?==BB??==>;>>==?@>A??=><<=C>8@@@@<>@@>>>==?>?>=<<;99:;937:;7=98:;:A>@?>>@L°¶ПЪ£Ґ°•®®•®§¶ІІ©ЂђЂЂ≠©ђђђђѓ≠±ђђ≠ђ≠©©ЂЂЂ≠Ђѓѓ≠ѓ≠ђ≠Ѓђ≠Ђ≠ѓѓ≠≠ЂђЂ§≠НpљєЄЄЈґєєЄЈЈЄЄєЄєєєєЄјЅјЅљЧmfhichijiiklprsqqrrrqqrqrooooooonnllnlkkhkikkmpmmpnmmpnmmmkoiiollkmjmkomokmomrqrqqqmpprurrpiopnplnpbppkmrrxЮіФwwplnnnnnonnlonhm>:;<=<<<<<;8;A;9AA>>??A>CD+AG>BA?BBBCGDFFIGGKMPSZWSOLJJHDCDGFCDCDGGCBGFIMGFFDFCF@B?>@BFGDC@CFCFCBBEBDHCCAL;!*2BBEGIFGIIIKJKNPVXYWVTPNMJGHGGJIGFBBMJFIICJGFFIMJGFCCC@CGHJHGKNPRPSUXZ\``befjnokhm`J!0dk`egkjjjgkkgkjegfdbbfd`\_ecaaaakecfgjmiodqxrДИПЩХ°Х°†Ю≥Ю•†ЮЩЩФРЛЗЛИГГДББВ}~~}x|НE&0OАuwt|{zw{yy}xpGFABA<<=<;;:<<;9;;<;>;<;:>C=>@>=<>??@C>>;:;>>>A>>@==<>@@==BQЯШНЫ†°°£••££•®ІІ®©≠≠ђ©ђђ®ђђѓ≠≠©ђђђ≠ђ≠ђ≠≠≠ѓѓ∞ѓѓѓ≠≠≠ЃѓЃѓЃ≠ѓђ©ђЂІ≠ИuЄЈЄЄЈµЄєЄЄЄєєєЇЇЇЇєєљљЉЉЈФl`jjijkijjlopqsqpqttrppqqpqpqoqhooommmmqkmkkmmqqrrqmmqpmimkskkkjlkmkmkmoomompppppomkmmssrqqtkmqropkmmqppruxҐЈЫrwsoorrrxrrsqnogtB'Dfkonoprrlqqprpptrrssvrsrqnm? G~oloorprrtwy||ЗЕЛФЩШЫШЩТЛЕРГ{{uh.o¬§ojdijmqsv||ВДЖЗЙЛНПННПЛПСМММММПММКМЙБ}|ВДЕЕЙЛНЛЛННЛЙННМПНЙЙЙДШ}!8rЧИЗЖЙДЛЙЛЖЕЕЗЙЕЕЕЕГГЕЕЕДДДДВВ~~~{trsutxxzz}~}y}{~|z}~ВББГЕЕИЗЙЛМЛМПa&yЯНСТУТРУХУХЧХЧЧШЧХШШЩШХУУТТРННННЛЛЛЛЙЛИЗИЕЗЙИИИИИЖЗЖЖИЙЗЖЕГЖЖЕКЛЛПФЭ¶ЋВАДБГАВИГБГББАА~}}}{zyyzzyytsrrrnlklkkmnpprjjjnllliiifiiiiicceefieb^Z'v†jdb`aY__]YWYWXZYWYYY^`_]YVUSSPKIKIFHHFFHHFDBAAA>>?=<;3<=A>=>BC>;:;:;==;=<<<<<><@<;<;<;;>><<>@6<?BB?<<==<>==A=AB@CL'GDABB>ABAABCCCA@MGHMTTTNLJHD@BBBBB>@CACDGCC?BCABB?@BB@?F?DBDFFGFFFDFGGCFFDGFFFC5#+5>EHJIJLJMNLMLPTV\XMNMKHGFGDGDHFFDFGIGIJJHGHGFGJIGIHDCDCFFCBCFGIIJJGKKJKGAPRPKORXVP?"5Zgchroorpqrrnpmjkjdgebebecefecefkffggffffejjjifcllgkloojjlr~ЕЙЛРУЩЮ†•§£Э†°ЫЯЩЧФРКДЙS*8[wy~А~БИ~||yxlSDABA9?@<<><AA><>><;>>>=;<><>D<9==>;<<:;;;<;;<<<<>@BCBBA<=A@>?>>@?@CN+GF?AA=>BABCBBBAAGDGMQYVMLIHDBCBB@BABDCDCECCCACAA@@>@A@>>ADDBBCCBABCBCFCC@JGGGIA9#!5@GJMJMMJLMMMLQRU^ROMKKHJGGGGJLGGGEGGDGHJGGDFFGGGGGFFCCACBCCCCFFFFFCBIGIFDJJMNKKJLC9%5HPZ^acfjloroorkmnpjjhfjfeceecedbjfdjjhjfgfggffgdigdkeefchdhhhmoiou{~КНУТЦЮЪЃ•£ђ†±ђЬU*(5mЧСКЕЕЛЙЕДВ~{xkM=C><7<<<<>==?===>A<>>>><;>>@A9:<<@B=?:;>=>E@@AAAA>>=A=<<::;;99;:;;35A<<==<=@A@ZЩЮУЫ¶©£ІІ¶¶®®ІЂЂЂЂЂ©Ђ≠ђЂђђ≠ѓђ©≠ђ≠ђђђђЂѓђ≠ђђЃЃ≠ѓ≠ѓ≠≠ѓ≠≠≠ђ≠≠ђ≠І®°u (СЄЈЈЈЈЄЄЄєЄєЇєЇєЇєЄЄЄЊЊЊњЉЧkjllknkmqrqqqtvtvvxuvvvtrqqqqorsrropqqqqtrrrqrqpprqqrqqpoppqomqqmoorqqrrtrrqoppqmprrrqrrsqpqqqqqrrqqrqprt}}†ЅЧwopwsssqqrsrtrrokK(HgqprpvsqqsssqrstuttvtttvuqkG AЗorllkkljkikgjkommmkjkkkklhopoks: *\lr|ЙУЕЙЗАЕБГ~sibrfjqlpqotwz|ДББИИННЖЕ~|ЕЕЕИНННННССПППМПРМММККФ{,.{ПДЗЙЛНЛНЛЛННЙНЛЖЙЙЗЙЙЙЗИКЗЕЗЕЕЕЕЕ|xvyz|}ВВ}ААВВВВА}|||}z{{xu~Q"aЗyz~}АБВДГЕЖЙМСППСФУФФСУУХЧУФУФЦТЧШХЧЧШЧЧШЧШЧШФФТФТФТТПЛЛКЙЛКМХХЧЬ•†o!Ж•}ББАГГГБГГВВВААГББВВЕДАААДВБАААВВБ}|}z~yvxvvvuvtrqonnnpnkmmlkgfhdjR!©Їqaiddggiffiffhbhhfdfggggliffeaa_][[ZYYVYXXTRQOOKKKKLKFFGEEGF@BBBCC?A>CA@BCM,GRA@AA@@AAADCEKPWQNKHIDFGGCBABBEDCDDFBCBCCBAA@AAACBCDCDBCBAABBBFFFGCIGGGCC>$5CDFMMKPLHJLMLPRTVRQPMLJNHHGGHLHHHHJJHGHHGJFGIGFDCGFFCCDCEDACBCCCFFFCGCJCCDFILJJGF>8 !5BJPPRTX``fggeigqknrpkmrrnllikljhkkjqkjjiikjjiiififdjdcfcdbbbbfbfhlnkqrvvz}ВЗЙИС†•ђ≤M.*5ВЃ•§ЪЮЭШЧУРПЙВp=BAB><<<:<====<===>><<<;:;<<@C26;=?=<=??=<;=<<<>>==A>@CC?ABBA>?=><:@85::::;6<:;9=>=>=<=@=C]°†КЭ°§£Ґ§••®¶ІІІ¶ЂЂЂЂ≠ЃЂђ≠©Ђ≠ђђђђђѓѓѓ≠ѓѓ≠ђђѓЃѓ∞≠ѓђѓѓѓѓ∞ѓ≠ѓђ≤¶ЂҐl,ЦЈґґґґЈєєєєєЇЇљЇљєЄєЄЉЊљљЇХllnllpqqrqoqrrxvtsuuuwrttrqqqrssrrqqqrrsvtrrtttrprqpppqpqpq|rqrqqroqrqqprrqrrtrrqtrtqrsuuqqrrrrssorqrqptuy|£µФttsxvtvvruvrsrunvG,Mgjorstsssssoqrstsstttsstrlj= >КolonnknliikgjgmkmmkkkllnljoljgkN3^oorx{ЙЛЙМНЧФХХЛЗД~{qlhb`]Zkamhgsw}}}z|zz}ЙВЕЙЛМНПУРРПППРППППММЦ|.!3wЦЙЛЛНННПНННПНПКЗЖИЗЙЗККИИЕИИЕЕЕВДБyvvzz}|}}ВВБГД}ДДА}||}|~~|{zБQ#[Б|zyzz}}~}}}ББЕЖЙНЛМРНМСТПССРУСПХФТФХФЧШШШЪШШЧШЦШЦШЦХУССУПТРСХЧШЪШ†u"zєБГЖЖЗЖЕБЕГЕВАДВГГАБГАЗВАААД~~ВВВ}А~~БЗБЖ}|||~}z|yvwussssrqrpomlljjlT&∞ќqkkggiiicikihidikjgfeggklljiieed`bb^_a^]\ZXXXYURRSVTROLMMMKJEEHGEECGGIGEEKX+'GRABA@AA?@@@AA@@A@BJMPNMKIBCBCHCB?AB>>ABBBBBBBCCA@AAACDFCFCBCBCACBCDGFFECFGGECSA!5FEFJMILJDDHJJPPTTQNNKGFGFDGGGJJHJJJJJGHHGGFJKIGGDGGGDGGGHHGGCCCFGGGFFDGDDGDGJGIKL>4!!2JKJJMNPXX\\YXXYZZY[^ahjqkqoqrnopoonrnknjnrnpnllikidfddjeadbcbddeeeeeefhdilnnllmxzБsL-)@w£Я§§ЃҐІ•£©Э†Мs>CA@>;=<<@???@><<<:;=;@@<6@<9;9;=<=@>><><<<=@D>@>@=@BE>>=<<<9;:9;;8>:;===<>><==:;@?Ma•ЬФ§°Ґ§§§¶¶І¶ЂЂІ®ЂІІ¶ЂЂ§ІЂЂІЂІЂЂ©≠ѓ≠≠ЃЂЂ≠ђ≠≠∞ѓѓ≠≠Ѓѓ∞ѓ∞∞ѓ∞ѓ≠ѓ•ѓЭk2ЮЈЈґґЄєєєєЇЇЉЄЇЄєєЄєєЉЊЊЊЉЦpppnlqqporqttsvvutwuuusrssrrrsurttrrprqqqrrkrttrqrqoppqpqqrvrsssrrrrsvrqtvttrrrqqvtvvrrrsqqqrrssrqppqpqvy}}ЂњУtusttsttruuqtsrksJ'Lhkqstvvttsssssrvvvwwwwssojh< <РtknnnlniikiijgggknklllknlkkhhfoL1\mqou|~ЖЛКМННРУХФФЦЧЩЯ£†ЯХЙzvosmdmjgeponqrnszx|ВВДЖЗЛМКЛММПРРПРМЛУ}/8|РЛЛПННПСНПППППЛЙККЛНЛЛЛЛЙКККЗЗЕЕБ|zzz}}|ВБВЕВБЕБ|ВВБ}}}}}}||{M$Vy||zzz|~zyzvyzw~|zББГЕЖЗЙЗУЙЛЛЛМУТУСУСУХХХЧШШЧШХЦШШШЦУУУФФШФХЩЪЪЭШЬp$tµЗЖИИИИЖЕЕЕЕЖЕЕДЕГГЕЕГМБВДЕИГ}ВАА~~}А}ВДВ}}|~АБ||z{|zytttsrqqqrotU!±¬vtnjjjjkilllllljlnlllljmkljlkihfffkegggaa^]^Z^ZYXY[YXVTSTTQQMDMKJJIHIKKHHLT(#OZDEDBFGCFECDDAAABFMNQPNKIDFA@C@A@B@==>AAAAAA@@?>>2!'2JDJMMORTWYXQMLMMPNMKPQXV\_aklfolvmpvpppouononljikggghfkhggffffhffafeffleiigiiffgfdaD5$G_t|ГКФТЩЮЮЂҐ±ПsA=>C>:;<<=<<<><<=@>?>;<>>@@==??=>=;=>;;<=?=;@@@<>>>:><<<;::;9<<9C;:;<=<<>;:;:;@=If•†Ф°°¶¶¶ІІЂЂЂІЂЂЂђЂЂЂ≠≠ІІЂЂЂЂІЂ©ђ©≠ѓ≠ђЂЂЂ©ђ≠≠Ђ≠ђђѓѓѓ≠ѓѓ≠ѓ≠≠ђ®≥Нh ;£єЉЇЈЈЄЇєЄєЉљЉЇЄєєЉљЇЉЊЊЊЇЧmloqpqqpqstvvsuuuuwwuwssswvuwsurstqrprrpmpqpqqrrrrqmoqrrrrrrrsssrrrruurprvvvttrrqvvtvwwuuvrsssuurrqpqrttyy|®љПttossrsssttqsrrr|J/GhmstvstssqruvuowwwywxzwvrmeK =З{npppmmiinlijgiilliiljnllkihehqJ/WpkosyАЖЙМПРТССХТФУФФЧЧХЫШЪФРЩКТУЖ~rdzpmropprrrrvyy||ДГГЕИКМММРМЙУx.5{ЛЗЛСННПСНППННММКЛЛЙНЛЛЙНЛЛЛЛЛЙЗЗВВА||}ВzГГГДЕГЕЕЕЕЕГВВВЕДДБВ}ЗАJ&L~}~z|}~~{}|z|}{|yuyzyzz|||}ААГЕДЛНМЛММНСТФЦЦЦЧЧУХЧШЧЦФФШФФХХШЪЭЬЯШ†p%wіНЛЛЛЛЛИИЕЕЕЙЖЕЕГЕЕЕЖГБВЕВДДЕДДЕЕДЕДДДЕВВДГГДВВВВВБЖ~}БАААБ||}xyyxwvs{V≥≈trmmkmolollllljlninpnnplllmmlmikkkijjlkhdebdjb_\]]][ZZZZXVVSURQQQMMMLLLLU[!"ONKHFGHHFKIHGGCCDGGMQVTRMKJJCCAAACBB@@@BB>>=@@>=@>;A=<<@>@A@ABBAB@B>@?BFCGFDBDHC)(5>BGGGJKMHKMMJNQYYVPKKGGGFGIJFHJHHHHOGFIIGGFGIJGFBCFFCDBBBFFCFFCFFGGHHGBHJJJMKKGFH<0!'2ACIJMPTUVZYTPMMLKJIIKKMMOORRVYZ\^aegjjluup|rsrqmmnjkjhhggnjhhhffhihfffhccfefefeefcaG<(BWdhmjrxtwВИНЪПnBB?B?:;=<<<<;<<<;><<<==<9B@;=?=?=A==>;=>>A?==@>>@@AA@>@>==>>>>:99::<:989999<:9;:9::;>BIe†ХЦЮ°¶¶ІЂ§¶®І®Ђ©ЂђђЂ≠ЂЂЂ≠≠ЂЂЂЂЂ®©©ђ≠≠ђђ©Ђђ©ђђђЃЃЃѓѓЃЃ≠∞ђ≠≠≠©§ЂШc C®єєЈґЈЈєЄєєєЇЇЄЄєЇЉЇЇњЅјјєФporrqqrqssssus{uuvvvxyuuswwwyuuuxxvuwvssqqrtyssqrsrqoqsutttsqqrrqqrosqqpqtrrvrrrtvusuwwwvvrvusssrrsrrttuxy~•¬ПwvttttttttwttsrqrQ,GckprtvtttvuvxwuttwxxvxwuxndM ;ЗrnnpnjkkllnlkknlnnllllvllkkjijrJ%0Qqlqrw~ГЗЛНПСУСФСТУТФЧХФЦХХФТХФХШЧФРФКЗИ||vi]W\lWlcYnmrrxz}БДЖДДХr,AФЙМСНППППМРПКМПМПЛЗПЛЛЛЛЛЛЛЛНЛЙЕЖД~||~ВВВВЕДЕИЖЕЕЕЖГДДДЖЕЕЕДВДДВГАH(M}}~||z||zy|||}zzyyvvwwywyytuqsupz|А|АВДИЙЛЛСССФРТУФФУУСЦУХЧЧЧШЬЯ°Э®q!rЃРНРПСТММКЛЙЙЖЗЕЖЗЖЗИЖГЕЕГББГВДЙЙДДЕЕЕЕВВВВГДГЕВВВВГББДВВВГЕ~ГДЕГГБГ|Н\≤њРztrprqrronnnljlljpppppjjkjmmolklijjjookkkgimhfdb__b_```]Z]ZfX[^XVWRRRRRZY"#cYPOKKKGEKIGHGFEGJJGTVTRMKJJGG>ACCBA@@BCA>>=?CA?>==B=><><<>?BBA?@>BCB@CFCFGFDCKH+*3>CFCFIIIGIIJIMQWWQONNJHGDGGGHHJHHHHJIJIIFIIEFFCCCFGGFFFBBCFBCC?FFFCHGCBGHHJKIIGFE=/!!4ECJKMPTUVZYTPOLJKIFGKKIGGJMKMPOQUOWXPYfffhqkprppnlhkkfhach]fggffhfbfdffdcfefggiefdbF17W^dffjffdjnqjyaCC>A>=>A??><><><;?=<<<=<9<>=<=<:>==?=<<;9;==??==@<<>@AA=>=@=;@>>=:99:8<>:9;;<<<<<<:;<<<=CKeІХХЬ°°§¶І•£•••®І©ђЂЂЂЂЂЂЂЂЂІЂІЂ®©©ђ≠ЂЂ©І©©©©ІђЃЃЃЃЃЃЃ∞ѓ≠ѓѓѓђ®ђ°Z GѓєєЄЄЄЈєЄєєЇЇЄЈЈЄєєЄЇЊЊЊЊєХsrrrtrrrsuusuy{wwyvw{wwwuyywuuuvxxvuywuvtrrtwyuusssurruxwrstrrurrqsrsssqttrttrrrsuvrsvwxwurxxuuwusuuvvs}ytБ¶ЄШzvtttvwwvvuwwurrsT,Cftrtt|vvvvvywttvvxxvtxuuthhG 5АjjnnkknnnkklknnlnlklllnknnnnoimJ&3Qrhqw|БЖЛНПСУУФФУУФФЦШФФЦХХФФТУТФФТУШХУЩКХЫЬСПЙВxxsooedgoitqsuvtuВr$%G}ЙЗСРНСНППРРПППММХПНННПНЛЛНЛЛНЛЙЕЖВ}|}~БВГВГДЕИЖДДЖДГДДЕЖВЖЕДВЕЕВВБГГF)VДА}~~z}|zЕ~}{{wwxz{zxvurpmlmqqsttwy{z}БАДЕЗЛНЛЛНПППСУХФУФЧЪЬЬ££ul±ТХЦХЧЦФУФТТНЛЛЛНМММЛЛИЖЕЙДГВБГЕЕЕАЖГВВВБГГББББББЕГДЕГВДВВВЕЕДБГГЗЕЕХjіѕЧНЕА}yyyvtsrsroorqronpopkkkjjlnlkiilijnnlnpijlifgebbdbeaaaaa^a^e`\\][\_ZZ_Z"'|^VVUQQKKMLLNLLJJOMQXXVPNMKJGF@ADDAAAAAB>===?A>@@>=>=@>><<>@AAAA?>CDDCCCCDFDFGOC/(5=BCCFIIKKIIJJNPTSONMMHHDEFGDGDGCGGGGFIIIFFGCFGFCCFGEEEGBCCFCCB=GGIGGCDGHJJGJFGGGG@.*3AGJJJLSVZYVPMMJJKDGIKKFFFGKIKJJHMLNMKMUVXXWYZ]^^_`_hbbm_acekhhfegh`fffijegeefbfbd_ZC* /U]haafdbddbddl^I><><=?AA???B@A==A>>>=>>?=@B;;<=>==A===:;==<=A@;A<;;>=>=?>>@>===;;::999<;<<<<<;<=<:;@==B?@>?@=><<<<<==??=?A>@@BDDCCCCDHOD3+5>>ACFIIKIGHHKPQUVSPMMJJGGFGDCBCBDCCDDGGGGGHCDFFFBCCFCCCBBDCBCBCEFDEGDHGHHJJGGKIJKK./3@EJJLMSXZYVQMMLJJHIJJFFIGIIGKHGGGFGHJJLMMMMMNMDMPMRSUXYXZ\aeejgohiimkjnnhjihjjrfff[@"!<[`a`_lccecb`_heF>@>>=>>A>;;<>@=AB???;<==@>>@>=>=:=;;:998:;<;<;5;<;::==?@?>hІФЦ†£°•¶®®¶¶®¶®ђ®ЂІЂ≠ІђђЂЂЂЂ¶§§©ђђђ≠©©©ђ®®®ЂђЃѓѓђЃ≠ѓѓђ≠ђѓѓѓђ¶І†PJґЄєєєЄЈЄЈЄЄЄЄЄґЈєљљЉЇЉЊљЊЈХurtssruuxzz|{|{{{y{}|{ywy{yywwu}zxwsxxvxywyzxrutuuvswwswsursuswuuwsuywsuuwyyxxtvxz{xyzwywxzyyy{wwwpryxuuxАЛЩ¬ЫxzttttvwvwtvvuwruW$5bsvssvvvvwvzxttvxxzxx{zyuuoM& 5РomqonlnlljkkllnllnlnnknnprlnleeT*Wmiou}ВИММСУУСПСУУЦФФЦЧЦШШЩЩШХЧЧШХФТУФСЛКЕКММТФФФФУЦЩУСЯЙИТПГzrrrmh)ѓєЧ{^hnrvxy|ВДИМВЖЙЗИЙЛЛХПППНЛНЛЛЛКЕ}zz~ВДЖДЗЙЗЗЕЙИЖЖИЖЖЖЕЕЕДДЕЕЗЕЙЗ<,XИ}~АААБ}}}ЕВ}А~{|||}~zyuqllkorqsuuususvsrowvlvzy|z}}ГДЕЗЙЛЛМСКФq $S†ТТУУУШХЧЭЧШШЧШЪШШШЩЧФТСРСНММММЛЛЛЙЖЖБДВДАВБДДДДВВЕЕЛЕБАБГГДЖЗЕЖИКППУШ©x!µ∆ХЙЗГГБВЕАББ~{Й{xyyzwxyuttprrprqoprprponnlnnnntiijghgggeeeegaddeefb_a]\`X%5§rfZ^Z^[YZZYZXVYXZY\]]]YYVRQPNKHKLKJIGGGDDBACCABA?AB=?><><@==?A=====?=>>B>?=A>???@@A>><;;<<>::938;<;<;;<<;;<==?@:Dj®ФС†••¶•••£¶®¶¶©ЂЂЂЂЂ©®ЂђЂЂ©І¶®ЂЂђђ©ђ≠≠≠≠ѓ≠ѓѓѓ∞Ѓ≠ѓѓѓі≠≠≠≠Ѓѓ©®І†JZµµЈЄєЈ≥ЈЈЈЈЈЄЄЈЈЄЇЉЇЇЊЊљЊєФvtuttwx{{z{|wwywy|||{|xy||y{yuxywwyuwxyyyx{|zxxxyyywwvuwwwswuuuuwuwuwywwuxxwwtvuwxxyzusyyzwwvwyywxwtwyvw{~ЙЧєЬ{vtuwwwvwwvvwwwvrY!9etwtsttwwyzzvvvxzwyxw{uwrqnG$ 4НomqomjnllklllpnlnnoonknlltnqmhqT'.\ojqw~ЕЙНЛППУУСТТФФУЦЦЦФЦФЦЦЦХХФФСФЦФЦУНЛИИММРСУТУХЧФСХЮФХ†ЮЮЭЬЬЧРr 'КіЊpbjhgnppnrptwx|~|АААВЙИЗЗЙИККККЗД}vz}БДИЖЙЛЙЛЛЙЙЖКИИКЖКИИИИИЙЙЙЕ}ГЙ;5]М~ВДДВБВБВГА}}ВВ}~А|}|ywrolkrrrvsrtuvvvrrrtrsrtrsrruwvxyz}~АЖВЛk %NЭПКСССУУХЧХШШШШЫШШЧЬЪШЧЧХФФСТТСФСНПЛЛЛСЗЖЕЕГДЖЖЖДДЕЕЕЕЕЕЕЕЕЕИИЕЙМНУХШ¶≤~%≤ЊСЛЗЖЕББЕГГДДДДГГЕА~~~|||zzzvuxwvusqrqsropooprppnljjjnkiijiiflijkjiifdpa]mZ<Іwkhe`b^`b^^_]]_[`_cecb_\YYXUSOLOPNMLKKHJJGDGFCFFBDFBA@@@ABBBB=BA?>>=ABBDDBBBHT=%%49=BBCGCGDDCDCKRSTKMMMJGFFDFFCGDDDCCGDDHIFFGGGFCIGGGDBCCCB")B__cghifgiedcej[DG@@<>=<<=?=?=<<>=<=<<<<8<<=>A<:<><;=;@>==;;==<=>>=@CC<>;:;;:<;=:5;<;<<;;;=;;<=?@@?@ABCCBCCX3(%:=@DCFFBFGDFGJLTVVQNMJHEDCDCBBCCCBCDD>DDFFCEFJHFGFDFCBCCCCCFABCGFFCDDDGHDGGDGDIIBFJ5"%?>>><<<9==>>>=><<=?AA?><<><<;<><>>::B>>===<>>=<@=;>=:;;;;;9:<:9:<<;;9989=;6;<@=@3Ix¶УХ°¶¶®®©©®©®®ѓђЂђђ¶І®®®ІІІІЂІІІ¶І®®ђ©ђђ≠©≠ђЂЂђЂЂ≠ЃЃ∞∞ђЃЃЃЃђ¶Ђ†2 gЄЄЈЈЈєєЇЄЄЄЄЄЇЈЈЄЇЉЇЇЊЊљљєЧuwwyyyz{}z|{~{~БАА}{|||y}ywyyxxxuwzwwyxvxwyy{{{xxvtt{zzz{y|zywzyy~yyzz|}zu{wy{z{|z|z|{{{yyxxwyywyywy||qЕ£≈Іsttuuttvvwvtvwvwuh,=luВvxxxxxwxzxxxzxzzzw{zzuorO  9КmkqurqqnmnklnkljlnnpplnnnrpqmjnT'+\lqu}АЕУННТФФШШШШШЦЩЬЪШЧЩЩЩЩФЩЪШШШЩШШЦФСКЖЙЛПФСУТУЩЦХЦШФССУУЦЦФУЛЮs(JХРЖЙЛНММВЛ|БЕokodqojrojlmpppqns{x||wyy{ААЕЙЗЗИЙЙГЙККЙНЛКИЙЙЙИИИЙЗЕВМЙ/5`ЕГЕЕЗЗЗЗЖЖДЕЕЗЕДЕ}ВВВ~~АА|ykrrqssyxzvxzzzzvuussrprppqqrrqooosppqqz^Trrux{АВГЗЗЛЛМНФШУСУЧХЦХЧХШФУФЦФЧЩЦЦШШШШФФХФФФТСПМЙИЙИИЙЗЕЕЕЕЕБЖЛТФЫ†І£§zЩ©ЕГЕПЖЗЙИИЖЕЖЕДГБДВВДВВВВДДДДГВ}}|{zyyuuvrrqqrpoonlnlmniijjkilkjjjiiiftUL√Аsnjggghhhhhgggihikknnkkkb`a^]]ZZZZQYYQRRTNRMLLKIKIKGEECDDBBCD>BB=>@AAA@ADCCBY.(-6=CFFJHCDHGJGKKRVSQMNJJHDDF@@CBBCCDHH@FEBEBCCFFBDCAAC@@@BCCAACCFFDAGJLPPTXZYVOLMKKKJJKGGGFIGGCKGGJFEGCGEGHKHEFHIGIGIFHHGGDGFFFFJGIJIIGGJKJJMRRRWXZZZ[=%0D^eilmponrkjhiiVE>=<><<<>>;<<=????><<;;=>>@>@>;;B=AAA><<==<><=;;:;<:;:9<7545:;9;978;;:69;<=B??~ЪУЫ£•¶©©Ђ©©®®©ђ©ЂђђЂЂЂЂЂІ¶Ђ®ѓђђЂЂђ©ђ≠ђ©≠≠ђ≠≠ђ©ђђђ≠∞ЃѓЃѓ≠ђ≠ђ©•ІҐ. jЄґґЈЈЈєЇЄЄЄЄЇЇЇЈЄЇЇЉЉљљєЇЄЪyuyyyxz{}y~}~ВБ}Б}~~~~}~|||zz|{{~Вyzyxy{{{wy{x|xw{xz{{z{yyx|z|Еwuzy{{wp{{y{z~{}|||||}}zxy{{~{y{y{~|rП£Ќ§qttvuttvvvwvvvvwsr/>ntyvvwxsxxyyvvtxz{y{z{|ztotJ @Нportsssspppnnoonoqrrvporpqnmpok]#,^vrr{}ВПКНРУУХЦЦШЦШЩЭШЩЩЪЩЪЩШЩЪЦЩШЩШЧЦФСЛЙЙМТХФТУФЩЩЩЦЦФФХЦФШШФФСХЛ,FzЫНТУСППМУМРЦИЕГГДЕД~{ufhlflbei]moonoopwy}БЗДЕЖЖЗЙМЛМПНККИИККМЛЛМЛГПЛ-9`ДГЕЕЗЗИЕЗЖЕГЕЕЕВГ}ВД~АА~ААА|yqrsrtvzz|zvzzxyvuvxvxtpuusrssrqruypmpn{Z!"G{mknrsuvp{{~ГДЗМЛЗМСПТУШУУССУХФШШХЧШЧХЧЧЧЧЧЧЧХФФФТССПМММЛЛЙЛКИЛКХШЭ°ЯЮЬv"ЛѓЖ|ЕИИЖИЗЗЗЖЖЕЕЕГЕ{ГБВВДГГЕГДЕВВБВА~|||}}z{xyvwwvturrrqoqnmnnllmkjjjjnhh{OLЎДfnjffiijkgjkdgjjjknnnmmkgffdaaaadc```Z\ZZY[SQSRPQPPKILJKGDCDGGGCC@ABCC@?AABDBB@@>@@DGGJLGGGGGGJL;$$6=EIJNOSYZYSMMLJJJIJKGGGFFFBCIGGHFFGFLEGHKJGGGEDFFJJGHGHDGDFCGGGFGGIIIIJKMQOMOROQTZY@'%DPYafihlnrijvirRIC><<<<8<<<;A<<====>=;::;;;;<<<;;:====>;>><=>=@>@9<=>@B@<<:<;<=;<9:;89:;;?9999:<<:;<==A@=RЕ¶ТР§•£І©І¶¶®¶©ђЂЂЂІІ¶ІІ¶ІЂ¶®®ђђЂЂ≠≠≠≠©ђ≠≠≠ѓ∞≠ѓђ≠≠ѓ±∞ѓѓѓѓ≠≠≠©•©Я- sЉЄЈЈЈЈЈєЇЄЄЄєЇєЄЄЄЇЉЉЊЊљљЄЫyyzxzu{}{zА}}{{}}zz}~|}|||{y{||}{|~|z||}||yyy}{{Аy||{{z{{|{yy|{{xvr|y{ywuy{ywy{y|{{|~{||{yzzy||||{y|{П†њҐtvtsvxwxxwyxwvvzzs-Cpuzrvyxt|zyzvvvzzzvvwyzxtrpN @Иtqrsrrrrplnolononppprnqroqrorqp_,*dtou}ВЗЛМРУХХЦЦФЩЦШШЩШ†ЩШЪЩЪЩЩШФШШЩШШШЦСЛЗЙПТСУТФФШЩШЦЦЦШЦШШШЧЦЦУЬС5Bx°ТФШФУФФХХТУХТТССЧУЛЛЙМГzwrrgVVY\[]^]ghinpmtyГДЕЙЙКЖЙЗИИИКЛЙЛЛЛЗСЛ/5iИЕЕЙЙЙЕЕЙЗЕВЕЕЕВГДДДГВВАА~~|vususwvxzx|y{yzyvvuyxytrwwssvvvtusvvrqp{Z%Agmpoqqroqrsvwwwy}|БГЕКЛЛЙЛЛМПФУФУУСУУСУХХХХХЧЧХЧЧЧФФТСТТРТРТСПТУШЫЭ°°ЬЧz+А®ИВЕЕЗИИЖЖИЖЖБВЕБИВЕЕВАДБАВВВГАГБ~|~~~~ЙБ~~~{|}zyzxvxvrsurrrrqqpkoqorjkMZѕКfpnjfiijljgkhmjjjnpopmkmmkkjfdddhgddc`bb^^f[XVYUTUTPPMMPNLKJMMKKJKFIHGDDCCGBF5'/5FFCBB?ABBBDDFF@B>AAABCBBDCCBCCB@GGDGHHGJHGEGC/**5<<@@>>>:C?=<>@=>>==;=>:::;9<;<9=<;=:;;>:=;===5=>=<@=<<9;====<6::9;;<<=;9;<;=><DDDDDCDCCCC>DDBBB=?B@BDDBB>@=AABFDBAC@CC@BHBGGDJGHLKKGGJQ*)(5ADHKNNUTVVRKHHFDDHGIIIKFECBAFFIJIGHGGGGIIKMJJIIGHEGHGJJCCGFFHGEBIIQMMMNMNPMMJMMNNSK?/3CMUY\\\VWVVVU^fRHB>>7<<<<8>=?=<<==@><>>=>==;;><>>@>>><<<;;;=>>>5;===;9=;;;;;=;;;:5:99<;<<:99<;9;@AB@@9DИ•УЫҐ£¶©Ђ©©І©ђђђђђђ©ЂЂ≠ЂІЂ¶І®®®І©©ђ©®ђ©ђ≠©ђђђ≠≠≠≠ђђЂ≠ђ©ЂђЃђ≠ђ¶£Ч"kљµЈєЇЈЈЈЄЈЄЄєЇєєєЄЄєЇЊ≈ЅЉЄЮx~}|}~|ВВГГБББВГВАААА~zzy{yyz{{zz{xzz~А{|{{||~|{{{|||{~~{|~|||||~{{~АА{{~|А~|{|{y|~|~||z|~}|~{{~}Л•ј£jvwtvttttvttvsrsqc*Lotvvw{|{y{{|z{Аzxvx{x{{xuswP 8Нrnswsrsolnplnrsrprrstssqrsrrnnz_"#ivrw{АЗННРФЦЦЦЧЧЪЩЩЬЭЭЩЭЭЭЭЭЭЭЭЪЭЪЭЭЪЩШУЛЙПСУЦЦЦЭЩШФЦЭЪЧШТХЧШШШШТТЙ;B}°РФФЦЦЦЦЦХЦЦХУФШЦФФФФССТУШРРФФРНКЗЕБ|Гz}rspjepfrrjnrrttwwswvzГ~ВАВЛЕ5/sСЛЗЗЗКЗЖЗЕЗЗЕЕЕГЕЗЗЗЗЕЕЖДДЕВ|ytvv{|||z|}|z}z|zzyyywwwxvvvvvuywxxstsw^';horrrqrqqqrpqoolklkoqqrstsrqrrt|БДДЖИМКММПММСХУХУУЧФФХЧЧЧЧЧХЧХЪЬЬҐ££°Я°r%e±НКЛЛМЛЙЙЛИЖДЖДЖЖЕДГЕГГЕГЖЕЕЕГББГГВБВ~}~}}~|~БА~~|~~А~~~А|}}~Г}yvwtttrrЖG_≈Жsrqonmoprpoqmqoopnrrtrponppmnionpkkjirjjiinhicddc^]]\YYZY[]XXXVQUTPPMMNPNOLRb7#*7JIMLLLMMLMLLNQSRTQOJGDHCDGBDGCDDCCGDDBBBDB=?B?>CB>>>@??BCFBA?B@B@@<<8<>@?<<:<;;;<<=>=:::<<<>><>?><==@><:<<<>;====>=>@=;;:69;4<;;;9;9:;;8;=<<<=<@9CР†СЪҐҐ¶ІЂЂ©©©ђђђђђђђ≠≠≠ЂЂЂЂІЂ®¶®Ђђ≠ђђ≠ђ≠ѓ≠≠≠≠≠ѓѓѓ≠≠ѓѓѓђђЃЃђђѓ®ҐЩqЊЈєєєЈЈєЄЈЈЄєєЇєЇєЄЈєљЊЉЉЈЮu}|z{}~ВВГГГГГВГААА||ААББ{|~~|БА~~~||{~|~|~~||~|~|{{yy{{~{{~}|~|~~|{~|{~|{{|~|}}~~А~~|~А||~АzН®ј£tvvwwwvtvyvvxwttum1Msrtvszzwzwz{zz~yyxyАz}|xswxI <Пrnstssroorssstssrprsststtttsrmsa"._srw|АЗНСУФЦЦЧЦЧЩЩЩЭЭЭЪЪЪЭЫЭЪЭЭЩЩЩЪЭЭШЦУППССУФЦШЭШШЦШЭЩЪЪШШШЩЫЪЪХФЗ>%B}ЧСЦШЦШШШФЧЧФФХХЦЦУУФФФСППЩТТТРПНЛЖЕДВМИРИЖЖЖЕz~|rnrphopnnpnrssvtuxА8<ИПГДСИДЗИИИЗЕЕГЕЕЕЕЕЕЕЕДДДЕВ}zyvx|}}|yz~|}}|}|zzvzx{zwxyvvyv{||ywu{}Z(@krrrrrsusrqrpompmknoopqpqpiiigihqrptuu{~ВВДЗЛНННПСУУФТХХЧЧХЧШШЪЯ†ІІ¶Ґ•k*fѓХНРРРММЛЙЛЙИЖИИЖЕЕЕЖВБВГЕЕГБДБ|ГВВВВА|А~|~~|}БББА~ААА~БББ|АВ|Б|{}||}СI[зЧyktrrqprpqrqonjorrtrrpprrppnpnpmnkknlpnnljnjjiegff`ba__b^_f]]]ZZ\ZZWUWUUUTSSc7/;MJPMMPNOMOMLLPSTVTPMHJHGGDCCFDGGCCDDBC@ACC@BC>ACBC:A>@>@>BBCCCB<@CCCGGECGL/"&5BCIMCNUY\VOMLJHHHGGJJHGFFIJIGFEGGHIIIJHGHGIIMGEFHFCFDBCDCCCDCEFDGEFGBGIMKKKMJPNNQQJ>/2DMUX[ZYUQSVVNZbMHA>AA=A><9;>@?<<<;;;<<;=@<::;:;<>@<;;;<<==<=H78><;;<5==>>;=?>;9:;9;;5<><<=<:<;868;===9;BBBBCDDCB><>@@AA<>@A@BCBCCBCBBKGFCCFDDHB* )5DEIIINQYXRJLLHJGGDGHHGGGFIGIIFCEGGIJGKJGHJJGLEGJJKIKJGGGCCFFDCDGGGIGGGFGIKKJKLMNNSG<.0DJUYYZUNPPNQNblPF8:==<;=>A=<8>@?<<;<<=?=>;=<<<<56;97<<;<<<:;<;;:9968==>ЗЩУЧЩЩЩЩЪШЩЪЫЩЩЩЦХХХЦФЧЧРСЦЦХФФТТРКГГГГЖЛМФМКЛЛНТТТППНПМЛМИЛИ}rprrphu0|ЯМlkrswy|ВДГБДГДДЖЗГДЙГЗЗЗЕГ|zyzzВ}ДА|~}~|y}||~v}~{~|z|{{{||}yx{|sr[(Corssrwvuwxsssruvtrrqrurrvskigcgigggefdeceg`gikpqsvxz{~ВВДЗЛЙММРТУХЬЭЭ†ҐhkҐЩФЧЧШШЬЧЧШЦХФФТРТРТНММЛМЙЙИЗЗЕЖЕЕ{ГВ~~~~~~||Б|ББ}~Б~Бz}|}}}БВЕЕЙНРЩ£C kеЫМЕ}||{y}zzzzyxwuwustssuuurroopprorprprppllnpmokmmkjifhiifhhbdhfggggdcahf`_\hn8"2GZUYYZYYZXUQTXZ^^ZVVUXNLJJHGGGGHJDCHD@CCA>>>@@<>>>@BABBAC>BDGFFBCCGFJD()/;5=9<>>B@>><@<>@<<>>AA?>>5=><<@>@C>;;;<<<899:9:<99=<;<:8>=;;36<><<=EBMЯЦСЭ§®¶£¶•¶©ђђђ≠ђђђЂЂ©ЂђІђ≠≠©¶≠ЂЂђђ©ђђ©ђ≠ђђ≠ѓ≠≠ђ≠ѓѓѓѓѓЂЂЂ©ЂЂ¶•†ИДЈґЈЈЈЄЈЈЈЈґґЈЈЈЈЄєЇљљЉЊЉЊєЮАБББГГЕЕЕБИЗЖЗЗИГИИЗВДВДВ~ААГГГГАА{АБ~~А||БААБ|||АА~|~А~А~АА|~А~ВВААААА~АААААВВА~АА~А~~ВВВВГА~~~ВАЛВГ~ДТ≤њЫjvvvttvvvwvvzuuxqo/Avuww|yyxx{zywx~ww|z|x|yywwp_,Пzpttspprrrprrstrstttzrrstvtrrqzl$._lrz~ЕЙПСУЩЧЩЩЫЫЮЭЭЮЭЭЭЭЮЭЭЭЭЭЪЭЭЭЮЬЬЪЩФРНТФФХЪЪЭЪЦ†ЭЭЪЪЩШЪШЧЩШШШЧЦ6 @КЬУЧЩЪЪЩШЦЦШЩЧЧЩЩЦФФЧЧЧЩЩЧШЦУФЦСФРМЖБЕЗКППУПСПТПСППСРНРТФФФТФХМИПБА|y/~ШЇ~r\gZfjjoqrrww{|~ААВВАДЕДГВzzyyy}}АВБААБА}~~}ВВББ~~~~||~||}{{{yuw_*Mhvuwwvwwwwusuurrsssssrqrspjggfgihhhheffeefahghhjlplqppqmvwwy~ВДДЕЛПСХЩЯehЫСТЦЧЧЧЬЧЧШХХЩФТСУСУСФФШПМНЛКЛКИКИЕАВВЕЕВ~~ААВВДЕБ~~БББАz~|||}}ВЗЗРУШ††IkаШЛГВВБ}В~А~||zywwwxxyyxxwurrsssrrrttvttmporrqlnnlilijllkijfjiifhhhfdfhfffasf9/PY\\]^`]W[Z\Z^^c_^YZYVSRMLMMMLLJLGGJIIGGFCGDFHCCGBCDDAC@@@<>>@??A>>@@A:BCBCEBBBCDGI*"-7FCDGIMTTUWOMKMJHJGHJHGHHGGGGGFGHJFDCDGGGGDDACBGGCGFIFGDDGDDCGHGGDECJJKJIKKHHKLMNMOJ4#4CSY\ZZWTRZPMQcfCD?@><;<:=;83868<<<<<><97?A=?A<>@><<><<<:>?==><>>><>>>@=;:>9<:8:6:::<;9=<<>:=>==>;;><;;<@>VЭЦКЫ§¶¶¶¶•¶ЂЂЂ©©©©ЂЂЂђ©©©ѓ∞ѓ≠Ђ≠ЂЂђѓ≠≠∞ѓ≠ѓ≠≠ѓѓ≠ѓѓ∞≠ѓ≠ѓѓ≠ђЃЂ©©©®£u!КЈЈЈЄЄєЄЈЈґґґЈЄєєЇЇЇљљЉЊЉЇЈЫБГГГГГГЕЗИЗГКИИГГЗЖДВВЕГАААГГГАГАВВВБ~~ГВВГБАВГВБ~~А~~АА~А~{А~~АВДААА~~А~ААДДВ~БАВААЗААВАВАВВВ{ВЕБР≥¬Ыtwwvvyy|xzsxzzx|yt9=x~zwywwwzzxzzw|wwyx|vxw{w{l],Рtpstsporrrrrrpprstwrurvtswwwtoyl#)^qtАВЖЛСУФШЩЦЩШЪЭЫЭЭЫЭЭЯЮЫЬЫЮЮЭЬ†ЮЮЬЪЪЩЦРНТХХЦЩЭЪЭЩЭЪЭЪЭШЪЬЭЮЮЭЬ†ЬР5'8Р°ФЩЩЪЪЩЩШЦШЦШЧЧЧЧЧФЧЧХЧЩЧЦХУУУПТНЛЖЖЕЗКРРРТСУУПУПУППНРРФФУТПСММЩПЧЬП2%YСЖВ|uskl^hj_\ajlimrsuwxy~~А~}yytwvz{|~АББА}}}}ДЖВБ~~ВА~АА~}}}|xБb$Qrvvyyvxxyxywusrsqrsrsrquuqkjhefhljljhfgiggfgedfggikecffcgggfmprqtv|АЕЙЛg eЬУПТФУХЩХЧШХХЪХТУУФЦФЦФШТТФТСРПМНЛЛЗЗДЕЖДДДВВДДДИДАБББВА}}}|}}ГЙНЛШЩ¶ЫФH Z’ЬГВЕГЕЕБЗЕГГ}~||{zxx{}zzyy